Search Results

Search found 13099 results on 524 pages for 'front row'.

Page 117/524 | < Previous Page | 113 114 115 116 117 118 119 120 121 122 123 124  | Next Page >

  • Need help... how to add md5 to password field in php?

    - by jones
    Hi mates, i looking some help and nice attention here.. i bought some php script many years ago and now no suport anymore... i just want to add md5 to password field.. here my form: <?php $SQL = "SELECT * from USERS WHERE USERNAME = '$_SESSION[username]'"; $result = @mysql_query( $SQL ); $row = @mysql_fetch_array( $result ); include 'menu.php'; ?> <FORM METHOD="post" ACTION="?page=query_client"> <INPUT TYPE="hidden" NAME="controller" VALUE="USERS~update~account_details&up=1~<?php echo $row[ID]; ?>"> <TABLE CLASS="basictable"> <TR> <TD CLASS="tdmenu" WIDTH="40%">Username</TD> <TD CLASS="tdmenu" WIDTH="60%"> <b><?php echo $row[USERNAME]; ?></b> </TD> </TR> <TR> <TD CLASS="tdmenu" WIDTH="40%">Password *</TD> <TD CLASS="tdmenu" WIDTH="60%"> <INPUT TYPE="PASSWORD" NAME="PASSWORD" SIZE="40" VALUE="<?php echo $row[PASSWORD]; ?>"> </TD> </TR> <TR> <TD CLASS="tdmenu" WIDTH="40%">Email Address *</TD> <TD CLASS="tdmenu" WIDTH="60%"> <INPUT TYPE="text" NAME="EMAIL" SIZE="40" VALUE="<?php echo $row[EMAIL]; ?>"> </TD> </TR> <TR> <TD CLASS="tdmenu" WIDTH="40%">Full Name *</TD> <TD CLASS="tdmenu" WIDTH="60%"> <INPUT TYPE="text" NAME="FULLNAME" SIZE="40" VALUE="<?php echo $row[FULLNAME]; ?>"> </TD> <TR> <TD CLASS="tdmenu" WIDTH="40%">Address *</TD> <TD CLASS="tdmenu" WIDTH="60%"> <INPUT TYPE="text" NAME="ADDRESS1" SIZE="40" VALUE="<?php echo $row[ADDRESS1]; ?>"> </TD> </TR> <BR> <TABLE CLASS="basictable"> <TR> <TD CLASS="tdhead2" > <DIV ALIGN="CENTER"><B> <INPUT TYPE="submit" NAME="Submit" VALUE="Submit"> </B></DIV> </TD> </TR> </TABLE> </FORM> and the it self as query_client.php inside look like: <?PHP @session_start(); $controller = $_POST['controller']; $pieces = explode("~", $controller); $table = $pieces[0]; $qt = $pieces[1]; $return = $pieces[2]; $id = $pieces[3]; $hack = $pieces[4]; if ($qt == insert) $qt = 'INSERT INTO'; if ($qt == update) { $qt = 'UPDATE'; $end = "WHERE ID = '$id'"; } $pre = array_keys( $_POST ); mysql_query ("CREATE TABLE IF NOT EXISTS `$table` (`ID` INT NOT NULL AUTO_INCREMENT , PRIMARY KEY ( `id` ) )"); $count = count($pre); $count = $count - 2; $sql = "$qt $table SET"; for ($i=0; $i < $count; $i++) { $x=$i+1; $y = $_POST[$pre[$x]]; $d = $y; mysql_query ("ALTER TABLE `$table` ADD `$pre[$x]` TEXT NOT NULL"); $sql .= " `$pre[$x]` = '$d',"; } $sql .= " ID = '$id' $end"; $query = mysql_query($sql) or die("$sql_error" . mysql_error()); if (empty($hack)) { } else { $pieces = explode("/", $hack); $h0 = $pieces[0]; $h1 = $pieces[1]; $h2 = $pieces[2]; $h3 = $pieces[3]; $h4 = $pieces[4]; $h5 = $pieces[5]; mysql_query ("ALTER TABLE `$table` $h0 $h1 $h2 $h3 $h4 $h5"); $query = mysql_query($sql) or die("$sql_error" . mysql_error()); } if (isset($_GET[inc])) include "$_GET[inc].php"; ?> so please help me how to add md5 in PASSWORD field? thanks in advance..

    Read the article

  • GWT Clipped image

    - by Kasturi
    I am creating a widget in which a portion of an image will be highlighted and the remaining portion will have an opacity 0.5. For this i am using two images. The full image at the back with opacity 0.5. the portion of the image i want to be highlighted in the front. the front image is GWT's Clipped image. I have a scenario where i have to resize the back image. Is there any way to resize the clipped image at the front?

    Read the article

  • How to correctly use DERIVE or COUNTER in munin plugins

    - by Johan
    I'm using munin to monitor my server. I've been able to write plugins for it, but only if the graph type is GAUGE. When I try COUNTER or DERIVE, no data is logged or graphed. The plugin i'm currently stuck on is for monitoring bandwidth usage, and is as follows: /etc/munin/plugins/bandwidth2 #!/bin/sh if [ "$1" = "config" ]; then echo 'graph_title Bandwidth Usage 2' echo 'graph_vlabel Bandwidth' echo 'graph_scale no' echo 'graph_category network' echo 'graph_info Bandwidth usage.' echo 'used.label Used' echo 'used.info Bandwidth used so far this month.' echo 'used.type DERIVE' echo 'used.min 0' echo 'remain.label Remaining' echo 'remain.info Bandwidth remaining this month.' echo 'remain.type DERIVE' echo 'remain.min 0' exit 0 fi cat /var/log/zen.log The contents of /var/log/zen.log are: used.value 61.3251953125 remain.value 20.0146484375 And the resulting database is: <!-- Round Robin Database Dump --><rrd> <version> 0003 </version> <step> 300 </step> <!-- Seconds --> <lastupdate> 1269936605 </lastupdate> <!-- 2010-03-30 09:10:05 BST --> <ds> <name> 42 </name> <type> DERIVE </type> <minimal_heartbeat> 600 </minimal_heartbeat> <min> 0.0000000000e+00 </min> <max> NaN </max> <!-- PDP Status --> <last_ds> 61.3251953125 </last_ds> <value> NaN </value> <unknown_sec> 5 </unknown_sec> </ds> <!-- Round Robin Archives --> <rra> <cf> AVERAGE </cf> <pdp_per_row> 1 </pdp_per_row> <!-- 300 seconds --> <params> <xff> 5.0000000000e-01 </xff> </params> <cdp_prep> <ds> <primary_value> NaN </primary_value> <secondary_value> NaN </secondary_value> <value> NaN </value> <unknown_datapoints> 0 </unknown_datapoints> </ds> </cdp_prep> <database> <!-- 2010-03-28 09:15:00 BST / 1269764100 --> <row><v> NaN </v></row> <!-- 2010-03-28 09:20:00 BST / 1269764400 --> <row><v> NaN </v></row> <!-- 2010-03-28 09:25:00 BST / 1269764700 --> <row><v> NaN </v></row> <snip> The value for last_ds is correct, it just doesn't seem to make it into the actual database. If I change DERIVE to GAUGE, it works as expected. munin-run bandwidth2 outputs the contents of /var/log/zen.log I've been all over the (sparse) docs for munin plugins, and can't find my mistake. Modifying an existing plugin didn't work for me either.

    Read the article

  • why use mixed-based replication for mysql

    - by Alistair Prestidge
    I am in the process of configuring MySQL replication and am intending to use row-based-replication but I was also reading up about mixed-based replication. This is where statement-based is the default and then for certain circumstances (http://dev.mysql.com/doc/refman/5.1/en/binary-log-mixed.html) MySQL will switch to row-based. The list is quit vast on when it will switch to row-based. My questions are: Does any one use mixed? If yes why did you chose this over just using one or the other? Thanks in advance

    Read the article

  • Merging multiple versions of same excel spreadsheet

    - by GrinReaper
    So here's the situation: I have multiple versions of the same spreadsheet-- each one has the exact same row and column labels. The difference between any two given spreadsheets is that data in one spreadsheet shouldn't be in the other (but sometimes it might.) Is there anyway to merge all of them into a "master copy" (or just a blank version) of the spreadsheet? (basically, using the data from various versions of that worksheet to fill out the main one) Copy-pasting is extremely tedious, and doesn't allow me to copy blocks of rows IF the row numbering is non-contiguous. (For example, Rows 1, 2, 3, 6 are in a block, but row 4 and 5 just don't exist.) Ideas? Googling hasn't turned up anything that seemed directly relevant to this problem.

    Read the article

  • conditional formatting for subsequent rows or columns

    - by Trailokya Saikia
    I have data in a range of cells (say six columns and one hundred rows). The first four column contains data and the sixth column has a limiting value. For data in every row the limiting value is different. I have one hundred such rows. I am successfully using Conditional formatting (e.g. cells containing data less than limiting value in first five columns are made red) for 1st row. But how to copy this conditional formatting so that it is applicable for entire hundred rows with respective limiting values. I tried with format painter. But it retains the same source cell (here limiting value) for the purpose of conditional formatting in second and subsequent rows. So, now I am required to use conditional formatting for each row separately s

    Read the article

  • In Excel, given a worksheet "A", how do you create a sheet "B" that has a subset of the rows in "A"?

    - by user32706
    In Excel 2007, I have a sheet full of data "A". One of the columns in sheet "B" is called "Valid" and has either "yes" or "no". I've created a second sheet "B". It's easy to make each row in "A" appear in "B" if the row is valid using an 'if' statement in each cell. But if it's invalid, there's a blank row. I need "B" to show only the rows from "A" that are valid. TWO BIG CAVEATS: - No macros - No filtering (for long and complicated reasons). I feel like it might be possible with vlookup used cleverly, but so far, I'm stumped.

    Read the article

  • Nested IF's in Excel

    - by user1590499
    I have two columns with the following possibilities (0 for first column, and then 0 or 1 for second column; or a string for first column, and a 0 or 1 for second column). name,flag 0,0 david,0 0,1 sammy,1 How would I create a third column that looks like the following: name+flag 0 david 1 sammy Basically, if there are 2 0's in the two columns in a row, put a 0 in the new column. if there is a string in the first column in the row, no matter what the second column in the row says, put the string in the new column. and if there is a 0 in the first column and a 1 on the second column, put a 1 in the third column. Can I do this best with nested-if's? I tried something like name, flag, name+flag 0,0,=IF(A2<>0,A2,IF(B2=1,B2,0),0) But it didn't seem to work for me...

    Read the article

  • How do I extract excel data from multiple worksheets and put into one sheet?

    - by user167210
    In a workbook I have 7 sheets(Totals and then Mon to Sat),I want to extract rows which have the word "CHEQ" in its cell (this is a dropdown list with two options-CHEQ/PAID)from all sheets. On my front sheet I used this formula: =IF(ROWS(A$13:A13)>$C$10,"",INDEX(Monday!A$3:A$62,SMALL(IF(Monday[Paid]=$A$10,ROW(Monday[Paid])-ROW(Monday!$I$3)+1),ROWS(A$13:A13)))) This formula works fine for one worksheet (eg. Monday) but is it possible to show the extracted rows from all 6 sheets on the front page? I only have Excel NOT Access. These are the 12 headers on row A12 Col Name Cod House Car Date Discount 2nd Paid Extra Letter Posted The exported data appears like this (this just an example): Col Name Cod House Car Date Discount 2nd Paid Extra Letter Posted 12 Robbs 1244 Ren 11/10 10% 5 CHEQ 0 0 No 15 Jones 7784 Ren 12/10 15% 1 CHEQ 0 0 No 18 Doese 1184 Ren 12/11 12% 1 CHEQ 0 0 No Any ideas on what to do to this formula? I am using Excel 2010.

    Read the article

  • Can't insert cells in Excel 2010 - "operation not allowed" error message

    - by Force Flow
    I was working on a spreadsheet in Excel 2010, and all of a sudden when I attempted to insert a new row of cells, I saw that the insert and delete options were grayed out. I attempted to copy a different row and insert it as a new row, but I got the error message: "This operation is not allowed. The operation is attempting to shift cells in a table on your worksheet." I have not merged or hidden any cells/rows/columns. There are no formulas. There is no data verification. I tried closing and re-opening the spreadsheet. Searching for answers brings up nothing useful.

    Read the article

  • How to link data in different worksheets

    - by user2961726
    I tried consolidation but I can not get the following to work as it keeps saying no data consolidated. Can somebody try this dummy application and if they figure out how to do the following below can give me a step by step guide so I can attempt myself to learn. I'm not sure if I need to use any coding for this: In the dummy application I have 2 worksheets. One known as "1st", the other "Cases". In the "1st" worksheet you can insert and delete records for the "Case" table at the bottom, what I want to do is insert a row into the Case Table in worksheet "1st" and enter in the data for that row. What should happen is that data should be automatically be updated in the table in the "Cases" worksheet. But I can't seem to get this to work. Also if I delete a row from the table in Worksheet "1st" it should automatically remove that record from the "Cases" worksheet table. Please help. Below is the spreadsheet: http://ge.tt/8sjdkVx/v/0

    Read the article

  • Repeat the csv header twice without "Append" (PowerShell 1.0)

    - by Mark
    I have prepared a PowerShell script to export a list of system users in CSV format. The script can output the users list with Export-csv with single header row (the header row at top). However my requirement is to repeat the header row twice in my file. It is easy to achieve in PowerShell 3.0 with "Append" (e.g. $header | out-file $filepath -Append) Our server envirnoment is running PowerShell 1.0. Hence I cannot do it. Is there any workaround? I cannot manually add it myself. Thank you.

    Read the article

  • Convert text to table

    - by Quattro
    I would like convert text into a table. Here is a link to the text http://www.tcdb.org/public/tcdb Short example: >gnl|TC-DB|A0CIB0|1.A.17.3.1 Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1 MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI >gnl|TC-DB|A0CS82|9.B.82.1.5 Chromosome undetermined scaffold_26, whole genome shotgun sequence - Paramecium tetraurelia. MIIEEQIEEKMIYKAIHRVKVNYQKKIDRYILYKKSRWFFNLLLMLLYAYRIQNIGGFYI VTYIYCVYQLQLLIDYFTPLGLPPVNLEDEEEDDDQFQNDFSELPTTLSNKNELNDKEFR PLLRTTSEFKVWQKSVFSVIFAYFCTYIPIWDIPVYWPFLFCYFFVIVGMSIRKYIKHMK KYGYTILDFTKKK I wanted to have columns for example delimited with pipe | or ; |>gnl|TC-DB|A0CIB0|1.A.17.3.1| Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1| MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI I am working with Windows and I don't know how to do it I just know every row starts with > I want to substitute the first whitespace in a row with a delimiter like | or ; after the first regular expression new line in a row, I want also a delimiter everything between the regular expression first new line and > should go into a new column (it's a sequence of a protein)

    Read the article

  • Hide/Unhide rows based on more than one cell value

    - by Mike
    Please help me I am using the following code to hide rows if cell values are 0: Private Sub Worksheet_Calculate() Dim LastRow As Long, c As Range Application.EnableEvents = False LastRow = Cells(Cells.Rows.Count, "I").End(xlUp).Row On Error Resume Next For Each c In Range("I9:I48") If c.Value = 0 Then c.EntireRow.Hidden = True ElseIf c.Value > 0 Then c.EntireRow.Hidden = False End If Next On Error GoTo 0 Application.EnableEvents = True End Sub It works perfectly, but I would like for the code to also check column K (the same range K9:K48) if both cells in a row are 0 then the row must be hidden. How can I change the code to do this?

    Read the article

  • C# Bind DataTable to Existing DataGridView Column Definitions

    - by Timothy
    I've been struggling with a NullReferenceException and hope someone here will be able to point me in the right direction. I'm trying to create and populate a DataTable and then show the results in a DataGridView control. The basic code follows, and Execution stops with a NullReferenceException at the point where I invoke the new UpdateResults_Delegate. Oddly enough, I can trace entries.Rows.Count successfully before I return it from QueryEventEntries, so I can at least show 1) entries is not a null reference, and 2) the DataTable contains rows of data. I know I have to be doing something wrong, but I just don't know what. private void UpdateResults(DataTable entries) { dataGridView.DataSource = entries; } private void button_Click(object sender, EventArgs e) { PerformQuery(); } private void PerformQuery() { DateTime start = new DateTime(dateTimePicker1.Value.Year, dateTimePicker1.Value.Month, dateTimePicker1.Value.Day, 0, 0, 0); DateTime stop = new DateTime(dateTimePicker2.Value.Year, dateTimePicker2.Value.Month, dateTimePicker2.Value.Day, 0, 0, 0); DataTable entries = QueryEventEntries(start, stop); UpdateResults(entries); } private DataTable QueryEventEntries(DateTime start, DateTime stop) { DataTable entries = new DataTable(); entries.Columns.AddRange(new DataColumn[] { new DataColumn("event_type", typeof(Int32)), new DataColumn("event_time", typeof(DateTime)), new DataColumn("event_detail", typeof(String))}); using (SqlConnection conn = new SqlConnection(DSN)) { using (SqlDataAdapter adapter = new SqlDataAdapter( "SELECT event_type, event_time, event_detail FROM event_log " + "WHERE event_time >= @start AND event_time <= @stop", conn)) { adapter.SelectCommand.Parameters.AddRange(new Object[] { new SqlParameter("@start", start), new SqlParameter("@stop", stop)}); adapter.Fill(entries); } } return entries; } Update I'd like to summarize and provide some additional information I've learned from the discussion here and debugging efforts since I originally posted this question. I am refactoring old code that retrieved records from a database, collected those records as an array, and then later iterated through the array to populate a DataGridView row by row. Threading was originally implemented to compensate and keep the UI responsive during the unnecessary looping. I have since stripped out Thread/Invoke; everything now occurs on the same execution thread (thank you, Sam). I am attempting to replace the slow, unwieldy approach using a DataTable which I can fill with a DataAdapter, and assign to the DataGridView through it's DataSource property (above code updated). I've iterated through the entries DataTable's rows to verify the table contains the expected data before assigning it as the DataGridView's DataSource. foreach (DataRow row in entries.Rows) { System.Diagnostics.Trace.WriteLine( String.Format("{0} {1} {2}", row[0], row[1], row[2])); } One of the column of the DataGridView is a custom DataGridViewColumn to stylize the event_type value. I apologize I didn't mention this before in the original post but I wasn't aware it was important to my problem. I have converted this column temporarily to a standard DataGridViewTextBoxColumn control and am no longer experiencing the Exception. The fields in the DataTable are appended to the list of fields that have been pre-specified in Design view of the DataGridView. The records' values are being populated in these appended fields. When the run time attempts to render the cell a null value is provided (as the value that should be rendered is done so a couple columns over). In light of this, I am re-titling and re-tagging the question. I would still appreciate it if others who have experienced this can instruct me on how to go about binding the DataTable to the existing column definitions of the DataGridView.

    Read the article

  • Getting values from Dynamic elements.

    - by nCdy
    I'm adding some dynamic elements to my WebApp this way : (Language used is Nemerele (It has a simple C#-like syntax)) unless (GridView1.Rows.Count==0) { foreach(index with row = GridView1.Rows[index] in [0..GridView1.Rows.Count-1]) { row.Cells[0].Controls.Add ({ def TB = TextBox(); TB.EnableViewState = false; unless(row.Cells[0].Text == "&nbsp;") { TB.Text = row.Cells[0].Text; row.Cells[0].Text = ""; } TB.ID=TB.ClientID; TB.Width = 60; TB }); row.Cells[0].Controls.Add ({ def B = Button(); B.EnableViewState = false; B.Width = 80; B.Text = "?????????"; B.UseSubmitBehavior=false; // Makes no sense //B.OnClientClick="select(5);"; // HERE I CAN KNOW ABOUT TB.ID //B.Click+=EventHandler(fun(_,_) : void { }); // POST BACK KILL THAT ALL B }); } } This textboxes must make first field of GridView editable so ... but now I need to save a values. I can't do it on server side because any postback will Destroy all dynamic elements so I must do it without Post Back. So I try ... <script type="text/javascript" src="Scripts/jquery-1.4.1.min.js"></script> <script type="text/javascript"> function CallPageMethod(methodName, onSuccess, onFail) { var args = ''; var l = arguments.length; if (l > 3) { for (var i = 3; i < l - 1; i += 2) { if (args.length != 0) args += ','; args += '"' + arguments[i] + '":"' + arguments[i + 1] + '"'; } } var loc = window.location.href; loc = (loc.substr(loc.length - 1, 1) == "/") ? loc + "Report.aspx" : loc; $.ajax({ type: "POST", url: loc + "/" + methodName, data: "{" + args + "}", contentType: "application/json; charset=utf-8", dataType: "json", success: onSuccess, fail: onFail }); } function select(index) { var id = $("#id" + index).html(); CallPageMethod("SelectBook", success, fail, "id",id); } function success(response) { alert(response.d); } function fail(response) { alert("&#1054;&#1096;&#1080;&#1073;&#1082;&#1072;."); } </script> So... here is a trouble string : var id = $("#id" + index).html(); I know what is ID here : TB.ID=TB.ClientID; (when I add it) but I have no idea how to send it on Web Form. If I can add something like this div : <div id="Result" onclick="select(<%= " TB.ID " %>);"> Click here. </div> from the code it will be really goal, but I can't add this element as from CodeBehind as a dynamic element. So how can I transfer TB.ID or TB.ClientID to some static div Or how can I add some clickable dynamic element without PostBack to not destroy all my dynamic elements. Thank you.

    Read the article

  • How to have two UIPickerViews together in one ViewController?

    - by 0SX
    I'm trying to put 2 UIPickerViews together in one ViewController. Each UIPickerView has different data arrays. I'm using interface builder to link the pickers up. I know I'll have to use separate delegates and dataSources but I can't seem to hook everything up with interface builder correctly. Here's all my code: pickerTesting.h #import <UIKit/UIKit.h> #import "picker2DataSource.h" @interface pickerTestingViewController : UIViewController <UIPickerViewDelegate, UIPickerViewDataSource>{ IBOutlet UIPickerView *picker; IBOutlet UIPickerView *picker2; NSMutableArray *pickerViewArray; } @property (nonatomic, retain) IBOutlet UIPickerView *picker; @property (nonatomic, retain) IBOutlet UIPickerView *picker2; @property (nonatomic, retain) NSMutableArray *pickerViewArray; @end pickerTesting.m #import "pickerTestingViewController.h" @implementation pickerTestingViewController @synthesize picker, picker2, pickerViewArray; - (void)viewDidLoad { [super viewDidLoad]; pickerViewArray = [[NSMutableArray alloc] init]; [pickerViewArray addObject:@" 100 "]; [pickerViewArray addObject:@" 200 "]; [pickerViewArray addObject:@" 400 "]; [pickerViewArray addObject:@" 600 "]; [pickerViewArray addObject:@" 1000 "]; [picker selectRow:1 inComponent:0 animated:NO]; picker2.delegate = self; picker2.dataSource = self; } - (NSInteger)numberOfComponentsInPickerView:(UIPickerView *)picker; { return 1; } - (void)pickerView:(UIPickerView *)picker didSelectRow:(NSInteger)row inComponent:(NSInteger)component { } - (NSInteger)pickerView:(UIPickerView *)picker numberOfRowsInComponent:(NSInteger)component; { return [pickerViewArray count]; } - (NSString *)pickerView:(UIPickerView *)picker titleForRow:(NSInteger)row forComponent:(NSInteger)component; { return [pickerViewArray objectAtIndex:row]; } - (void)didReceiveMemoryWarning { // Releases the view if it doesn't have a superview. [super didReceiveMemoryWarning]; // Release any cached data, images, etc that aren't in use. } - (void)viewDidUnload { // Release any retained subviews of the main view. // e.g. self.myOutlet = nil; } - (void)dealloc { [super dealloc]; } @end And I have a separate class for the other datasource. picker2DataSource.h @interface picker2DataSource : NSObject <UIPickerViewDataSource, UIPickerViewDelegate> { NSMutableArray *customPickerArray; } @property (nonatomic, retain) NSMutableArray *customPickerArray; @end picker2DataSource.m #import "picker2DataSource.h" @implementation picker2DataSource @synthesize customPickerArray; - (id)init { // use predetermined frame size self = [super init]; if (self) { customPickerArray = [[NSMutableArray alloc] init]; [customPickerArray addObject:@" a "]; [customPickerArray addObject:@" b "]; [customPickerArray addObject:@" c "]; [customPickerArray addObject:@" d "]; [customPickerArray addObject:@" e "]; } return self; } - (void)dealloc { [customPickerArray release]; [super dealloc]; } - (NSInteger)numberOfComponentsInPickerView:(UIPickerView *)picker2; { return 1; } - (void)pickerView:(UIPickerView *)picker2 didSelectRow:(NSInteger)row inComponent:(NSInteger)component { } - (NSInteger)pickerView:(UIPickerView *)picker2 numberOfRowsInComponent:(NSInteger)component; { return [customPickerArray count]; } - (NSString *)pickerView:(UIPickerView *)picker2 titleForRow:(NSInteger)row forComponent:(NSInteger)component; { return [customPickerArray objectAtIndex:row]; } @end Any help or code examples would be great. Thanks.

    Read the article

  • How do I go about overloading C++ operators to allow for chaining?

    - by fneep
    I, like so many programmers before me, am tearing my hair out writing the right-of-passage-matrix-class-in-C++. I have never done very serious operator overloading and this is causing issues. Essentially, by stepping through This is what I call to cause the problems. cMatrix Kev = CT::cMatrix::GetUnitMatrix(4, true); Kev *= 4.0f; cMatrix Baz = Kev; Kev = Kev+Baz; //HERE! What seems to be happening according to the debugger is that Kev and Baz are added but then the value is lost and when it comes to reassigning to Kev, the memory is just its default dodgy values. How do I overload my operators to allow for this statement? My (stripped down) code is below. //header class cMatrix { private: float* _internal; UInt32 _r; UInt32 _c; bool _zeroindexed; //fast, assumes zero index, no safety checks float cMatrix::_getelement(UInt32 r, UInt32 c) { return _internal[(r*this->_c)+c]; } void cMatrix::_setelement(UInt32 r, UInt32 c, float Value) { _internal[(r*this->_c)+c] = Value; } public: cMatrix(UInt32 r, UInt32 c, bool IsZeroIndexed); cMatrix( cMatrix& m); ~cMatrix(void); //operators cMatrix& operator + (cMatrix m); cMatrix& operator += (cMatrix m); cMatrix& operator = (const cMatrix &m); }; //stripped source file cMatrix::cMatrix(cMatrix& m) { _r = m._r; _c = m._c; _zeroindexed = m._zeroindexed; _internal = new float[_r*_c]; UInt32 size = GetElementCount(); for (UInt32 i = 0; i < size; i++) { _internal[i] = m._internal[i]; } } cMatrix::~cMatrix(void) { delete[] _internal; } cMatrix& cMatrix::operator+(cMatrix m) { return cMatrix(*this) += m; } cMatrix& cMatrix::operator*(float f) { return cMatrix(*this) *= f; } cMatrix& cMatrix::operator*=(float f) { UInt32 size = GetElementCount(); for (UInt32 i = 0; i < size; i++) { _internal[i] *= f; } return *this; } cMatrix& cMatrix::operator+=(cMatrix m) { if (_c != m._c || _r != m._r) { throw new cCTException("Cannot add two matrix classes of different sizes."); } if (!(_zeroindexed && m._zeroindexed)) { throw new cCTException("Zero-Indexed mismatch."); } for (UInt32 row = 0; row < _r; row++) { for (UInt32 column = 0; column < _c; column++) { float Current = _getelement(row, column) + m._getelement(row, column); _setelement(row, column, Current); } } return *this; } cMatrix& cMatrix::operator=(const cMatrix &m) { if (this != &m) { _r = m._r; _c = m._c; _zeroindexed = m._zeroindexed; delete[] _internal; _internal = new float[_r*_c]; UInt32 size = GetElementCount(); for (UInt32 i = 0; i < size; i++) { _internal[i] = m._internal[i]; } } return *this; }

    Read the article

  • How do I call up values in PHP for user input in forms (radio buttons and selects)

    - by Derek
    Ok so my admin sets to edit a book which was created. I know how to bring in the values that were initially entered via a simple text field like 'bookname'. On the edit book page the book name field stores the currently assigned 'bookname' in the field (which is what I want! :) ) However I have other field types like selects and radio button entries...I'm having trouble calling in the already set value when the book was created. For example, there is a 'booklevel' field, which I have set as radio button entries as; Hard, Normal, and Easy. When the user goes to edit the book, I'm not too sure on how to have the current value drawn up (its stored as text) and the radio button being checked. I.e. 'Normal' is checked if this is what was set when the book was created. So far I have this as the code for the adding book level: <label>Book Level:</label> <label for="booklevel1" class="radio">Hard <input type="radio" name="booklevel" id="booklevel1" value="<?php echo 'Hard'; if (isset($_POST['booklevel'])); ?>"></label> <label for="booklevel2" class="radio">Medium<input type="radio" name="booklevel" id="booklevel2" value="<?php echo 'Normal'; if (isset($_POST['booklevel'])); ?>"></label> <label for="booklevel" class="radio">Low<input type="radio" name="booklevel" id="booklevel3" value="<?php echo 'Easy'; if (isset($_POST['booklevel'])); ?>"></label> This all works fine by the way when the user adds the book... But does anyone know how in my update book form, I can draw the value of what level has been set, and have the box checked?? To draw up the values in the text fields, I'm simply using: <?php echo $row['bookname']?> I also noticed a small issue when I call up the values for my Select options. I have the drop down select field display the currently set user (to read the book!), however, the drop down menu again displays the user in the list available options to select - basically meaning 2 of the same names appear in the list! Is there a way to eliminate the value of the SELECTED option? So far my setup for this is like: <select name="user_id" id="user_id"> <option value="<?php echo $row['user_id']?>" SELECTED><?php echo $row['fullname']?></option> <?php while($row = mysql_fetch_array($result)) { ?> <option value="<?php echo $row['user_id']?>"><?php echo $row['name']?></option> <?php } ?> </select> If anyone can help me I'll be very greatful. Sorry for the incredibly long question!! :)

    Read the article

  • Changing the background color of a view in real-time.

    - by Tarmon
    Hey Everyone, I am trying to implement a ListView that is composed of rows that contain a View on the left followed by a TextView to the right of that. I want to be able to change the background color of the first View based on it's position in the ListView. Below is what I have at this point but it doesn't seem to due anything. public class Routes extends ListActivity { String[] ROUTES; TextView selection; /** Called when the activity is first created. */ @Override public void onCreate(Bundle savedInstanceState) { super.onCreate(savedInstanceState); ROUTES = getResources().getStringArray(R.array.routes); setContentView(R.layout.routes); setListAdapter(new IconicAdapter()); selection=(TextView)findViewById(R.id.selection); } public void onListItemClick(ListView parent, View v, int position, long id) { selection.setText(ROUTES[position]); } class IconicAdapter extends ArrayAdapter<String> { IconicAdapter() { super(Routes.this, R.layout.row, R.id.label, ROUTES); } } public View getView(int position, View convertView, ViewGroup parent) { LayoutInflater inflater = getLayoutInflater(); View row = inflater.inflate(R.layout.row, parent, false); TextView label = (TextView) row.findViewById(R.id.label); label.setText(ROUTES[position]); View icon = (View) row.findViewById(R.id.icon); switch(position){ case 0: icon.setBackgroundColor(R.color.Red); break; case 1: icon.setBackgroundColor(R.color.Red); break; case 2: icon.setBackgroundColor(R.color.Green); break; case 3: icon.setBackgroundColor(R.color.Green); break; case 4: icon.setBackgroundColor(R.color.Blue); break; case 5: icon.setBackgroundColor(R.color.Blue); break; case 6: icon.setBackgroundColor(R.color.Gray); break; case 7: icon.setBackgroundColor(R.color.Yellow); break; case 8: icon.setBackgroundColor(R.color.Brown); break; case 9: icon.setBackgroundColor(R.color.Brown); break; case 10: icon.setBackgroundColor(R.color.Brown); break; case 11: icon.setBackgroundColor(R.color.Purple); break; case 12: icon.setBackgroundColor(R.color.Red); break; case 13: icon.setBackgroundColor(R.color.Gold); break; case 14: icon.setBackgroundColor(R.color.Orange); break; } return(row); } } Any input is appreciated and if you have any questions don't hesitate to ask! Thanks, Rob

    Read the article

  • DataTable to JSON

    - by Joel Coehoorn
    I recently needed to serialize a datatable to JSON. Where I'm at we're still on .Net 2.0, so I can't use the JSON serializer in .Net 3.5. I figured this must have been done before, so I went looking online and found a number of different options. Some of them depend on an additional library, which I would have a hard time pushing through here. Others require first converting to List<Dictionary<>>, which seemed a little awkward and needless. Another treated all values like a string. For one reason or another I couldn't really get behind any of them, so I decided to roll my own, which is posted below. As you can see from reading the //TODO comments, it's incomplete in a few places. This code is already in production here, so it does "work" in the basic sense. The places where it's incomplete are places where we know our production data won't currently hit it (no timespans or byte arrays in the db). The reason I'm posting here is that I feel like this can be a little better, and I'd like help finishing and improving this code. Any input welcome. public static class JSONHelper { public static string FromDataTable(DataTable dt) { string rowDelimiter = ""; StringBuilder result = new StringBuilder("["); foreach (DataRow row in dt.Rows) { result.Append(rowDelimiter); result.Append(FromDataRow(row)); rowDelimiter = ","; } result.Append("]"); return result.ToString(); } public static string FromDataRow(DataRow row) { DataColumnCollection cols = row.Table.Columns; string colDelimiter = ""; StringBuilder result = new StringBuilder("{"); for (int i = 0; i < cols.Count; i++) { // use index rather than foreach, so we can use the index for both the row and cols collection result.Append(colDelimiter).Append("\"") .Append(cols[i].ColumnName).Append("\":") .Append(JSONValueFromDataRowObject(row[i], cols[i].DataType)); colDelimiter = ","; } result.Append("}"); return result.ToString(); } // possible types: // http://msdn.microsoft.com/en-us/library/system.data.datacolumn.datatype(VS.80).aspx private static Type[] numeric = new Type[] {typeof(byte), typeof(decimal), typeof(double), typeof(Int16), typeof(Int32), typeof(SByte), typeof(Single), typeof(UInt16), typeof(UInt32), typeof(UInt64)}; // I don't want to rebuild this value for every date cell in the table private static long EpochTicks = new DateTime(1970, 1, 1).Ticks; private static string JSONValueFromDataRowObject(object value, Type DataType) { // null if (value == DBNull.Value) return "null"; // numeric if (Array.IndexOf(numeric, DataType) > -1) return value.ToString(); // TODO: eventually want to use a stricter format // boolean if (DataType == typeof(bool)) return ((bool)value) ? "true" : "false"; // date -- see http://weblogs.asp.net/bleroy/archive/2008/01/18/dates-and-json.aspx if (DataType == typeof(DateTime)) return "\"\\/Date(" + new TimeSpan(((DateTime)value).ToUniversalTime().Ticks - EpochTicks).TotalMilliseconds.ToString() + ")\\/\""; // TODO: add Timespan support // TODO: add Byte[] support //TODO: this would be _much_ faster with a state machine // string/char return "\"" + value.ToString().Replace(@"\", @"\\").Replace(Environment.NewLine, @"\n").Replace("\"", @"\""") + "\""; } }

    Read the article

  • Trying to get a better understanding of SelectedValuePath and IsSynchronizedWithCurrentItem

    - by rasx
    The following XAML produces a run-time Binding error when I click on an item in the ListBox: <Window xmlns="http://schemas.microsoft.com/winfx/2006/xaml/presentation" xmlns:sys="clr-namespace:System;assembly=mscorlib" xmlns:x="http://schemas.microsoft.com/winfx/2006/xaml" x:Class="WpfApplication1.MainWindow" x:Name="Window" Title="MainWindow" Width="640" Height="480"> <Window.Resources> <x:Array x:Key="strings" Type="{x:Type sys:String}"> <sys:String>one</sys:String> <sys:String>two</sys:String> <sys:String>three</sys:String> <sys:String>four</sys:String> </x:Array> </Window.Resources> <Grid> <ListBox DataContext="{StaticResource strings}" IsSynchronizedWithCurrentItem="True" ItemsSource="{Binding}" SelectedValuePath="{Binding /Length}"> <ListBox.ItemTemplate> <DataTemplate> <Grid> <Grid.Resources> <Style TargetType="{x:Type Label}"> <Setter Property="Background" Value="Yellow"/> <Setter Property="Margin" Value="0,0,4,0"/> <Setter Property="Padding" Value="0"/> </Style> </Grid.Resources> <Grid.ColumnDefinitions> <ColumnDefinition/> <ColumnDefinition/> </Grid.ColumnDefinitions> <Grid.RowDefinitions> <RowDefinition/> <RowDefinition/> </Grid.RowDefinitions> <!-- Row 0 --> <Label Grid.Column="0" Grid.Row="0">String:</Label> <TextBlock Grid.Column="1" Grid.Row="0" Text="{Binding}"/> <!-- Row 1 --> <Label Grid.Column="0" Grid.Row="1">Length:</Label> <TextBlock Grid.Column="1" Grid.Row="1" Text="{Binding Length, Mode=Default}"/> </Grid> </DataTemplate> </ListBox.ItemTemplate> </ListBox> </Grid> </Window> This is the run-time Binding error message: System.Windows.Data Error: 39 : BindingExpression path error: '3' property not found on 'object' ''String' (HashCode=1191344027)'. BindingExpression:Path=3; DataItem='String' (HashCode=1191344027); target element is 'ListBox' (Name=''); target property is 'NoTarget' (type 'Object') I would like the selected value of the ListBox to be the Length of the selected String object. What is wrong with my SelectedValuePath Binding syntax? Are there any related issues with IsSynchronizedWithCurrentItem?

    Read the article

  • I can't upload mp3 files using Codeigniter

    - by Drew
    There are lots of suggested fixes for this but none of them work for me. I have tried making the upload class (using the following methods: http://codeigniter.com/forums/viewthread/148605/ and http://codeigniter.com/forums/viewthread/125441/). When i try to upload an mp3 i get the error message "The filetype you are attempting to upload is not allowed". Below is my code for my model and my form (i've got a very skinny controller). If someone could help me out with this I would be eternally grateful. --Model-- function do_upload() { $soundfig['upload_path'] = './uploads/nav'; $soundfig['allowed_types'] = 'mp3'; $this->load->library('upload', $soundfig); if ( ! $this->upload->do_upload()) { $error = array('error' => $this->upload->display_errors()); return $error; } else { /* $data = $this->upload->data('userfile'); */ $sound = $this->upload->data(); /* $full_path = 'uploads/nav/' . $data['file_name']; */ $sound_path = 'uploads/nav/' . $sound['file_name']; if($this->input->post('active') == '1'){ $active = '1'; }else{ $active = '0'; } $spam = array( /* 'image_url' => $full_path, */ 'sound' => $sound_path, 'active' => $active, 'url' => $this->input->post('url') ); $id = $this->input->post('id'); $this->db->where('id', $id); $this->db->update('NavItemData', $spam); return true; } } --View - Form-- <?php echo form_open_multipart('upload/do_upload');?> <?php if(isset($buttons)) : foreach($buttons as $row) : ?> <h2><?php echo $row->name; ?></h2> <!-- <input type="file" name="userfile" size="20" /><br /> --> <input type="file" name="userfile" size="20" /> <input type="hidden" name="oldfile" value="<?php echo $row->image_url; ?>" /> <input type="hidden" name="id" value="<?php echo $row->id; ?>" /> <br /><br /> <label>Url: </label><input type="text" name="url" value="<?php echo $row->url; ?>" /><br /> <input type="checkbox" name="active" value="1" <?php if($row->active == '1') { echo 'checked'; } ?> /><br /><br /> <input type="submit" value="submit" /> </form> <?php endforeach; ?> <?php endif; ?>

    Read the article

  • Problems uploading different file types in codeigniter

    - by Drew
    Below is my script that i'm using to upload different files. All the solutions I've found deal only with multiple image uploads. I am totally stumped for a solution on this. Can someone tell me what it is i'm supposed to be doing to upload different files in the same form? Thanks function do_upload() { $config['upload_path'] = './uploads/nav'; $config['allowed_types'] = 'gif|jpg|png'; $config['max_size'] = '2000'; $this->load->library('upload', $config); if ( ! $this->upload->do_upload('userfile')) { $error = array('error' => $this->upload->display_errors()); return $error; } else { $soundfig['upload_path'] = './uploads/nav'; $soundfig['allowed_types'] = 'mp3|wav'; $this->load->library('upload', $soundfig); if ( ! $this->upload->do_upload('soundfile')) { $error = array('error' => $this->upload->display_errors()); return $error; } else { $data = $this->upload->data('userfile'); $sound = $this->upload->data('soundfile'); $full_path = 'uploads/nav/' . $data['file_name']; $sound_path = 'uploads/nav/' . $sound['file_name']; if($this->input->post('active') == '1'){ $active = '1'; }else{ $active = '0'; } $spam = array( 'image_url' => $full_path, 'sound' => $sound_path, 'active' => $active, 'url' => $this->input->post('url') ); $id = $this->input->post('id'); $this->db->where('id', $id); $this->db->update('NavItemData', $spam); return true; } } } Here is my form: <?php echo form_open_multipart('upload/do_upload');?> <?php if(isset($buttons)) : foreach($buttons as $row) : ?> <h2><?php echo $row->name; ?></h2> <input type="file" name="userfile" size="20" /><br /> <input type="file" name="soundfile" size="20" /> <input type="hidden" name="oldfile" value="<?php echo $row->image_url; ?>" /> <input type="hidden" name="id" value="<?php echo $row->id; ?>" /> <br /><br /> <label>Url: </label><input type="text" name="url" value="<?php echo $row->url; ?>" /><br /> <input type="checkbox" name="active" value="1" <?php if($row->active == '1') { echo 'checked'; } ?> /><br /><br /> <input type="submit" value="submit" /> </form> <?php endforeach; ?> <?php endif; ?>

    Read the article

  • Decentralized synchronized secure data storage

    - by Alberich
    Introduction Hi, I am going to ask a question which seems utopic for me, but I need to know if there is a way to achieve what I need. And if not, I need to know why not. The idea Suppose I have a database structure, in MySql. I want to create some solution to allow anyone (no matter who, no matter where) to have a synchronized copy (updated clone) of this database (with its content) Well, and it is not going to be just one synchronized copy, it could (and should) be a multiple replication (supposing the basic, this means, for example, ten copies all over the world) And, the most important thing: It must be secure. By secure I mean only real-accepted transactions will be synchronized with all the others (no matter how many) database copies/clones. Note: Since it would be quite difficult to make the synchronization in real-time, I will design everything to make this feature dispensable. So it is not required. My auto-suggestion This is how I am thinking to manage it: Time identifiers and Updates checking: Every action (insert, update, delete...) will be stored as the action instruction itself, associated to the time identifier. [I think better than a DATETIME field, it'll be an INT one, with the number of miliseconds passed from 1st january 2013 on, for example]. So each copy is going to ask to the "neighbour copy" for new actions done since last update, and execute them after checking they are allowed. Problem 1: the "neighbour copy" could be outdated too. Solution 1: do not ask just one neighbour, create a random list with some of the copies/clones and ask them for news (I could avoid the list and ask ALL the clones for updates, but this will be inefficient if clones number ascends too much). Problem 2: Real-time global synchronization is not active. What if... Someone at CLONE_ENTERPRISING inserts a row into TABLE. ... this row goes to every clone ... Someone at CLONE_FIXEMALL deletes this row. ... and at the same time, somewhere in an outdated clone ... Someone at CLONE_DROPOUT edits this row (now inexistent at the other clones) Solution 2: easy stuff, force a GLOBAL synchronization before doing any new "depending-on-third-data action" (edit, for example). This global synch. will be unnecessary when making an INSERT, for instance. Note: Well, someone could have some fun, and make the same insert in two clones... since they're not getting updated in real-time, this row will exist twice. But, it's the same as when we have one single database, in some needed cases we check if there is an existing same-row before doing the final action. Not a problem. Problem 3: It is possible to edit the code and do not filter actions, so someone could spread instructions to delete everything, or just make some trolling activity. This is not a problem, since good clones will always be somewhere. Those who got bad won't interest anymore. I really appreciate if you read. I know this is not the perfect solution, it has possibly hundred of holes, but it is my basic start. I will now appreciate anything you can teach me now. Thanks a lot. PS.: It could be that all this I am trying already exists and has its own name. Sorry for asking then (I'd anyway thank this name, if it exists)

    Read the article

< Previous Page | 113 114 115 116 117 118 119 120 121 122 123 124  | Next Page >