Search Results

Search found 518 results on 21 pages for 'rahul singh'.

Page 12/21 | < Previous Page | 8 9 10 11 12 13 14 15 16 17 18 19  | Next Page >

  • Super class variables not printing through sub class

    - by Abhishek Singh
    Can u tell me why this code is not displaying any result on the console. class employee { protected String name; protected double salary; protected String dob; public employee(String name, double salary, String dob) { this.name = name; this.salary = salary; this.dob = dob; } public employee(String name, double salary) { this.name = name; this.salary = salary; } } public class Manage extends employee { String dept1; public Manage(String name, double salary, String dob, String dept1) { super(name, salary, dob); this.dept1 = dept1; } public Manage(String name, double salary, String dept1) { super(name, salary); this.dept1 = dept1; } public static void main(String args[]) { employee e = new employee("Vikas", 122345); employee e2 = new employee("Vikas", 122345, "12-2-1991"); Manage m = (Manage) new Manage("Vikas", 122345, "Sales"); Manage m2 = new Manage("Vikas", 122345, "12-2-1991", "sales"); m.display(); m2.display(); } public void display() { System.out.println("Name " + name); System.out.println("Salary " + salary); System.out.println("Birth " + dob); System.out.println("Department " + dept1); } }

    Read the article

  • How to store date into Mysql database with play framework in scala?

    - by Rahul Kulhari
    I am working with play framework with scala and what am i doing : login page to login into web app sign up page to register into web app after login i want to store all databases values to user what i want to do: when user register for web app then i want to store user values into database with current time and date but my form is giving error. error: List(FormError(dates,error.required,List())),None) controllers/Application.scala object Application extends Controller { val ta:Form[Keyword] = Form( mapping( "id" -> ignored(NotAssigned:Pk[Long]), "word" -> nonEmptyText, "blog" -> nonEmptyText, "cat" -> nonEmptyText, "score"-> of[Long], "summaryId"-> nonEmptyText, "dates" -> date("yyyy-MM-dd HH:mm:ss") )(Keyword.apply)(Keyword.unapply) ) def index = Action { Ok(html.index(ta)); } def newTask= Action { implicit request => ta.bindFromRequest.fold( errors => {println(errors) BadRequest(html.index(errors))}, keywo => { Keyword.create(keywo) Ok(views.html.data(Keyword.all())) } ) } models/keyword.scala case class Keyword(id: Pk[Long],word: String,blog: String,cat: String,score: Long, summaryId: String,dates: Date ) object Keyword { val keyw = { get[Pk[Long]]("keyword.id") ~ get[String]("keyword.word")~ get[String]("keyword.blog")~ get[String]("keyword.cat")~ get[Long]("keyword.score") ~ get[String]("keyword.summaryId")~ get[Date]("keyword.dates") map { case id~blog~cat~word~score~summaryId~dates => Keyword(id,word,blog,cat,score, summaryId,dates) } } def all(): List[Keyword] = DB.withConnection { implicit c => SQL("select * from keyword").as(Keyword.keyw *) } def create(key: Keyword){DB.withConnection{implicit c=> SQL("insert into keyword values({word},{blog}, {cat}, {score},{summaryId},{dates})").on('word-> key.word,'blog->key.blog, 'cat -> key.cat, 'score-> key.score, 'summaryId -> key.summaryId, 'dates->new Date()).executeUpdate } } views/index.scala.html @(taskForm: Form[Keyword]) @import helper._ @main("Todo list") { @form(routes.Application.newTask) { @inputText(taskForm("word")) @inputText(taskForm("blog")) @inputText(taskForm("cat")) @inputText(taskForm("score")) @inputText(taskForm("summaryId")) <input type="submit"> <a href="">Go Back</a> } } please give me some idea to store date into mysql databse and date is not a field of form

    Read the article

  • sending an email using user input from android

    - by Rahul Varma
    Hey, I am designing an app in which the data is stored in the database. There's a button in the form which is on clicked to send an email to pre defined mail address with the data that is stored in the database. Since i am a newbie to android i need help regarding sending the mail... So please help me...

    Read the article

  • Issues while downloading document from Sharepoint using JAVA

    - by Deepak Singh Rawat
    I am trying to download a file from Sharepoint 2007 sp2 document library using GetItem method of the Copy webservice. I am facing the following issues : In the local instance ( Windows Vista ) I can save only 10.5 Kb of any file. The webservice is returning only 10.5 Kb of data for any file. On the production server, I am able to List the documents using some credentials but when I am trying to download a document using the same credentials I get a 401 : Unauthorized message. I can download the document using the Sharepoint website successfully.

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • Public Wildcard Domain Name To Resolve To 127.0.0.1

    - by Rahul
    Is anyone aware of a public wildcard domain name that resolves to IP address 127.0.0.1. For example if I wanted to test a URL locally such as mywebsite.localhost.com or example.localhost.com but I don't have control of DNS settings (hosts file or whatever) then I would use this public DNS to resolve to 127.0.0.1. It needs to be wildcarded so that no matter whatever comes before localhost.com it still resolves to 127.0.0.1.

    Read the article

  • Cursor on Path doesn't appear in SilverLight

    - by Rahul Soni
    I am trying to draw a circle with a glass effect using Alpha. I am successful in creating that by using the below XAML. The cursor changes to Hand for the Ellipses, but it doesn't affect Path. Basically, I want to show "hand" cursor wherever the mouse appears over the circle. I hope this is not a known issue and I am missing something small. Any help is really appreciated. <Ellipse Cursor="Hand" Width="200" Height="200" Fill="#C42222" Canvas.Left="0" Canvas.Top="0" /> <Ellipse Cursor="Hand" Width="200" Height="200" Canvas.Left="0" Canvas.Top="0"> <Ellipse.Fill> <RadialGradientBrush GradientOrigin="0.3,0.7"> <GradientStop Offset="0" Color="#00000000" /> <GradientStop Offset="1" Color="#66000000" /> </RadialGradientBrush> </Ellipse.Fill> </Ellipse> <Path Cursor="Hand" Stretch="Fill" Height="114.598" Width="198.696" Data="M98.388435,-1.3301961 C98.388435,-1.3301961 117.1151,-3.094949 141.69321,8.1370029 C156.42262,14.868201 167.67375,23.694145 175.66234,33.657074 C183.67349,43.648144 181.90166,37.8708 191.90166,58.8708 C201.90166,79.870796 199.16658,89.212738 199.13568,92.90377 C198.77556,135.92146 175.45959,97.59124 156.75465,81.024025 C140.98892,67.060104 117.41241,64.357407 114.41241,64.357407 C111.4124,64.357407 83.061241,60.114159 63.061195,71.114143 C43.061146,82.114136 39.637829,86.429352 22.999804,100.99996 C6.5005584,115.44904 2.9997537,112.99996 2.9997537,112.99996 C2.9997537,112.99996 -1.1832786,97.194221 1.9997513,81.999893 C7.2054667,57.150185 13.999762,47.999939 17.999771,42.999943 C21.999781,37.99995 29.935833,23.400871 54.053131,10.21261 C78.91642,-3.3835876 98.388435,-1.3301961 98.388435,-1.3301961 z"> <Path.Fill> <LinearGradientBrush EndPoint="0,1" StartPoint="0,0"> <GradientStop Color="#55FFFFFF" Offset="0"/> <GradientStop Color="#11FFFFFF" Offset="0.5"/> <GradientStop Color="#00FFFFFF" Offset="1"/> </LinearGradientBrush> </Path.Fill> </Path>

    Read the article

  • calling background service from BroadcastReceiver....

    - by Shalini Singh
    Hi , i am trying to call a push notification background from BroadcastReceiver class.but my application is going to crash the code is given bellow public class AlarmReceiver extends BroadcastReceiver { Context ctx; static int count=1; @Override public void onReceive(Context context, Intent intent) { // TODO Auto-generated method stub //Toast.makeText(context, "working"+count, Toast.LENGTH_LONG).show(); count++; Log.e("broadcast***","receiver"); Intent myIntent=new Intent(context,NotifyService.class); myIntent.setFlags(Intent.FLAG_ACTIVITY_NEW_TASK); context.startActivity(myIntent); } } * manifest entry:- <intent-filter> <action android:name="android.intent.action.BOOT_COMPLETED"/> </intent-filter> </receiver> Error: 05-24 15:17:00.042: ERROR/AndroidRuntime(424): Caused by: android.content.ActivityNotFoundException: Unable to find explicit activity class {com.android.alarm/com.android.alarm.NotifyService}; have you declared this activity in your AndroidManifest.xml? Please help me....

    Read the article

  • How to covert UTF8 string to UTF16 in JNI

    - by Er Rahul Rajkumar Gupta
    Can anyone please tell me that what is going on wrong with me in this code.Actually in following line of codes I am taking the path of sdcard in a string in jni (C code) and in concatenate function concatenating these manually using loop.The string returned by concatenate works fine but when I am converting it to jstring it prints garbage value in my logcat. Kindly tell me what is the problem. jstring str=(jstring)env->CallObjectMethod(sdcard,storagestring); const char jclass cfile=env->FindClass("java/io/File"); jmethodID fileid=env->GetMethodID(cfile,"<init>","(Ljava/lang/String;)V"); jclass envir=env->FindClass("android/os/Environment"); jmethodID storageid=env->GetStaticMethodID(envir,"getExternalStorageDirectory","()Ljava/io/File;"); jobject sdcard=env->CallStaticObjectMethod(envir,storageid); jclass sdc=env->GetObjectClass(sdcard); jmethodID storagestring=env->GetMethodID(sdc,"toString","()Ljava/lang/String;"); *nativeString = env->GetStringUTFChars(str, 0); char *s =concatenate(nativeString,"/f1.3gp"); //fpath=s; fpath=env->NewStringUTF(s); jobject fobject=env->NewObject(cfile,fileid,fpath); LOGI("size of char=%d size of string=%d",sizeof("/f1.3gp"),sizeof(fpath)); jmethodID existid=env->GetMethodID(cfile,"exists","()Z"); if(env->CallBooleanMethod(fobject,existid)) { jmethodID delid=env->GetMethodID(cfile,"delete","()Z"); if(env->CallBooleanMethod(fobject,delid)) LOGE("File is deleting...%s",env->NewStringUTF("/f1.3gp")); } jmethodID newfileid=env->GetMethodID(cfile,"createNewFile","()Z"); if(env->CallBooleanMethod(fobject,newfileid)) LOGE("dig dig %s",fpath); jthrowable exc=env->ExceptionOccurred(); if(exc) { env->ExceptionDescribe(); env->ExceptionClear(); } LOGE("creating file %s",fpath); }

    Read the article

  • Auto Increment feature of SQL Server

    - by Rahul Tripathi
    I have created a table named as ABC. It has three columns which are as follows:- The column number_pk (int) is the primary key of my table in which I have made the auto increment feature on for that column. Now I have deleted two rows from that table say Number_pk= 5 and Number_pk =6. The table which I get now is like this:- Now if I again enter two new rows in this table with the same value I get the two new Number_pk starting from 7 and 8 i.e, My question is that what is the logic behind this since I have deleted the two rows from the table. I know that a simple answer is because I have set the auto increment on for the primary key of my table. But I want to know is there any way that I can insert the two new entries starting from the last Number_pk without changing the design of my table? And how the SQL Server manage this record since I have deleted the rows from the database??

    Read the article

  • check only one checkbox in gridview using jquery

    - by Gurbax Singh Bhangal
    i have a grid view in which i have placed the checkbox in itemtemplate i want only the one checkbox is selected from Gridview to select that perticular row so that i can use that id to edit or delete the row aspx page code is <asp:TemplateField Visible="false"> <ItemTemplate> <asp:Label ID="lblId" runat="server" Text='<%#Eval("id") %>'></asp:Label> </ItemTemplate> </asp:TemplateField> <asp:TemplateField> <HeaderTemplate> Select </HeaderTemplate> <ItemTemplate> <asp:CheckBox ID="chkSelect" runat="server"/> </ItemTemplate> </asp:TemplateField> <asp:TemplateField> <HeaderTemplate> Branch Name </HeaderTemplate> <ItemTemplate> <asp:Label ID="lblBranch_Name" runat="server" Text='<%# Bind("Branch") %>'></asp:Label> </ItemTemplate> </asp:TemplateField> <asp:TemplateField> <HeaderTemplate> Address </HeaderTemplate> <ItemTemplate> <asp:Label ID="lblAddress" runat="server" Text='<%# Eval("Address") %>'></asp:Label> </ItemTemplate> </asp:TemplateField> <asp:TemplateField> <HeaderTemplate> City </HeaderTemplate> <ItemTemplate> <asp:Label ID="lblCity" runat="server" Text='<%# Bind("City") %>'></asp:Label> </ItemTemplate> </asp:TemplateField> </Columns> and i want when i click on the checkbox which is at first of each row only one check box is selected from all the rows thanks

    Read the article

  • Source control on internet i.e. no private networks.

    - by Kavitesh Singh
    Me and my friend are in the process of starting a small project and want to implement a source control. Now both are located in different cities and can communicate using internet for file sharing etc. I need an online hosting solution or any way where i can maintain the source code repository for both of us to check in/out. As of now we want to maintain it as private project. Does sourceforge allow hosting projects which would not be opensource? One option i was thinking, to obtain a static IP form ISP and host the repository.But that mean my system needs to be online when my friend wants to checkin/out or do some diff with old version code. Secondly, would SVN or git be a better choice in such a situation. I have no experience in git/mercurial as of now.

    Read the article

  • select option in Safari ?

    - by Karandeep Singh
    < select size="2" multiple> < option value="1">1< /option> < option value="2">2< /option> < option value="3">3< /option> < option value="4">4< /option> < option value="5">5< /option> < option value="6">6< /option> < option value="7">7< /option> < option value="8">8< /option> < option value="9">9< /option> < option value="10">10< /option> < option value="11">11< /option> < option value="12">12< /option> < option value="13">13< /option> < /select> size attribute of Select tag is not working properly in Safari. if size attribute's value is greater than four then there have no problem, its working. But when I set the value of size less than four then it show four values. above example displays four options in safari but I want two options. What is the reason for this ?

    Read the article

  • Trying to insert a row using stored procedured with a parameter binded to an expression.

    - by Arvind Singh
    Environment: asp.net 3.5 (C# and VB) , Ms-sql server 2005 express Tables Table:tableUser ID (primary key) username Table:userSchedule ID (primary key) thecreator (foreign key = tableUser.ID) other fields I have created a procedure that accepts a parameter username and gets the userid and inserts a row in Table:userSchedule Problem: Using stored procedure with datalist control to only fetch data from the database by passing the current username using statement below works fine protected void SqlDataSourceGetUserID_Selecting(object sender, SqlDataSourceSelectingEventArgs e) { e.Command.Parameters["@CurrentUserName"].Value = Context.User.Identity.Name; } But while inserting using DetailsView it shows error Procedure or function OASNewSchedule has too many arguments specified. I did use protected void SqlDataSourceCreateNewSchedule_Selecting(object sender, SqlDataSourceSelectingEventArgs e) { e.Command.Parameters["@CreatedBy"].Value = Context.User.Identity.Name; } DetailsView properties: autogen fields: off, default mode: insert, it shows all the fields that may not be expected by the procedure like ID (primary key) not required in procedure and CreatedBy (user id ) field . So I tried removing the 2 fields from detailsview and shows error Cannot insert the value NULL into column 'CreatedBy', table 'D:\OAS\OAS\APP_DATA\ASPNETDB.MDF.dbo.OASTest'; column does not allow nulls. INSERT fails. The statement has been terminated. For some reason parameters value is not being set. Can anybody bother to understand this and help?

    Read the article

  • Where can I find a list of all possible messages that an XmlException can contain?

    - by Rahul
    I'm writing an XML code editor and I want to display syntax errors in the user interface. Because my code editor is strongly constrained to a particular problem domain and audience, I want to rewrite certain XMLException messages to be more meaningful for users. For instance, an exception message like this: '"' is an unexpected token. The expected token is '='. Line 30, position 35 .. is very technical and not very informative to my audience. Instead, I'd like to rewrite it and other messages to something else. For completeness' sake that means I need to build up a dictionary of existing messages mapped to the new message I would like to display instead. To accomplish that I'm going to need a list of all possible messages XMLException can contain. Is there such a list somewhere? Or can I find out the possible messages through inspection of objects in C#? Edit: specifically, I am using XmlDocument.LoadXml to parse a string into an XmlDocument, and that method throws an XmlException when there are syntax errors. So specifically, my question is where I can find a list of messages applied to XmlException by XmlDocument.LoadXml. The discussion about there potentially being a limitless variation of actual strings in the Message property of XmlException is moot.

    Read the article

  • Getting Json data into a list view

    - by Rahul Varma
    Hi, I have been searching for a way to get the json data from a URl (for example: http://search.twitter.com/trends.json) and display it in a listview. Couldnt get a perfect example to get it done. Can anyone plz help me out by getting the solution and providing a good example of how to do it...

    Read the article

  • How to validate SWT form?

    - by Rahul
    Label label1 = new Label(container, SWT.NULL); label1.setText("Enter the Password "); text1 = new Text(container, SWT.BORDER | SWT.PASSWORD); text1.setText(""); text1.addKeyListener(new KeyListener() { public void keyPressed(KeyEvent e) { } public void keyReleased(KeyEvent e) { if (!text5.getText().isEmpty()) { setPageComplete(false); } } }); hi, i am creating form using SWT in eclipse can anyone tell me how to validate that form entry above is the sample code of that..actually i want to validate password field it should be minimum length of 6.How to do this please reply.

    Read the article

  • COGNOS 8 Bi value prompt

    - by Rahul Kadam
    Currently I have a value prompt added to my report (with UI selected as List-Box) and the date item used is name 'YEAR'. Now when I run the report the values in the value prompt are seen as below: YEAR 2004 2005 2006 What I want to do is get rid of the year tag that is present in the output of the value prompt box, more clearly the output in the value prompt box should be as below: 2004 2005 2006 Can someone let me know how that can be achieved?

    Read the article

  • Cordova - Scrolling with a fixed header and footer (ios)

    - by Samu Singh
    Using Cordova (phonegap) & bootstrap to make a mobile application, testing on IOS for now. Getting an issue with a header and footer bar that are fixed with scrollable content in the middle. When tapping to scroll, the header/footer bar moves down or up with the content but then snaps back to place as soon as the scrolling completes. If I use -webkit-overflow-scrolling: touch; it works as expected, but it makes it really awkward to scroll through the content, and if you scroll passed the end, it only scrolls the header or footer (with elastic overflow) until you stop for a second. here's my html for the header/footer bars: <div id="headerBar"> <div class="container-fluid" style="background-color: #1569C7"> <div class="row"> <div class="col-xs-3 text-left"> <button id="logoutButton" type="button" class="btn btn-default"> Log Out </button> <button type="button" class="btn btn-default" id="restoreQuestionFeedButton"> <span class="glyphicon glyphicon-chevron-left"></span> </button> </div> <div class="col-xs-6 text-center" style="height: 55px"> <strong id="usernameText"></strong> </div> <div class="col-xs-3 text-right"> <button id="oldCreatQuestionButton" type="button" class="btn btn-default"> <span class="glyphicon glyphicon-plus"></span> </button> </div> </div> </div> </div> <div id="footerBar"> <div class="container-fluid" style="padding: 0"> <div class="row text-center"> <button id="createQuestionButton" type="button" class="btn btn-default footerButton"> <span class="glyphicon glyphicon-plus"></span> <strong>Ask a new free question!</strong> </button> </div> </div> </div> And here is the related CSS: #headerBar { position: fixed; z-index: 100; top: 0; left: 0; width: 100%; background-color: #1569C7; } #footerBar { position: fixed; z-index: 100; bottom: 0; left: 0; width: 100%; background-color: #1569C7 !important; }

    Read the article

  • Android adding HTML content on a webview without space

    - by Rahul
    I am trying to add an HTML content to a web view. If the words in the HTML content are without spaces then webview keeps that particular word on the same line.I want that content to be wrapped and be on the next line.Is it possible to do that.I am attaching a sample code that can reproduce the issue. String temp="<p>WebViewallowsyoutocreateyourownwindowforviewingwebpages(orevendevelopacompletebrowser).Inthistutorial,youcreateasimpleActivitythatcanviewandnavigatewebpages.1.CreateanewprojectnamedHelloWebView.</p>"; WebView wb=new WebView(this); wb.loadDataWithBaseURL("", temp, "text/html", Encoding.UTF_8.toString(),""); setContentView(wb);

    Read the article

  • Interesting interview question. .Net

    - by rahul
    Coding Problem NumTrans There is an integer K. You are allowed to add to K any of its divisors not equal to 1and K. The same operation can be applied to the resulting number and so on. Notice that starting from the number 4, we can reach any composite number by applying several such operations. For example, the number 24 can be reached starting from 4 using 5 operations: 468121824 You will solve a more general problem. Given integers n and m, return the minimal number of the described operations necessary to transform n into m. Return -1 if m can't be obtained from n. Definition Method signature: int GetLeastCount (int n, int m) Constraints N will be between 4 and 100000, inclusive. M will be between N and 100000, inclusive. Examples 1) 4 576 Returns: 14 The shortest order of operations is: 468121827365481108162243324432576 2) 8748 83462 Returns: 10 The shortest order of operations is: 874813122196832624439366590497873283106834488346083462 3) 4 99991 Returns: -1 The number 99991 can't be obtained because it’s prime!

    Read the article

  • bash: flushing stdin (standard input)

    - by rahul
    I have a bash script that gets some input as stdin. After processing, I copy a file using "-i" (interactive). However, this never gets executed since (I guess) standard input has not been flushed. To simplify with an example: #!/bin/bash while read line do echo $line done # the next line does not execute read -p "y/n" x echo "got $x" Place this in t.sh, and execute with: ls | ./t.sh The read is not executed. I need to flush stdin before the read. How could it do this?

    Read the article

< Previous Page | 8 9 10 11 12 13 14 15 16 17 18 19  | Next Page >