Search Results

Search found 518 results on 21 pages for 'rahul singh'.

Page 13/21 | < Previous Page | 9 10 11 12 13 14 15 16 17 18 19 20  | Next Page >

  • Auto Increment feature of SQL Server

    - by Rahul Tripathi
    I have created a table named as ABC. It has three columns which are as follows:- The column number_pk (int) is the primary key of my table in which I have made the auto increment feature on for that column. Now I have deleted two rows from that table say Number_pk= 5 and Number_pk =6. The table which I get now is like this:- Now if I again enter two new rows in this table with the same value I get the two new Number_pk starting from 7 and 8 i.e, My question is that what is the logic behind this since I have deleted the two rows from the table. I know that a simple answer is because I have set the auto increment on for the primary key of my table. But I want to know is there any way that I can insert the two new entries starting from the last Number_pk without changing the design of my table? And how the SQL Server manage this record since I have deleted the rows from the database??

    Read the article

  • Interesting interview question. .Net

    - by rahul
    Coding Problem NumTrans There is an integer K. You are allowed to add to K any of its divisors not equal to 1and K. The same operation can be applied to the resulting number and so on. Notice that starting from the number 4, we can reach any composite number by applying several such operations. For example, the number 24 can be reached starting from 4 using 5 operations: 468121824 You will solve a more general problem. Given integers n and m, return the minimal number of the described operations necessary to transform n into m. Return -1 if m can't be obtained from n. Definition Method signature: int GetLeastCount (int n, int m) Constraints N will be between 4 and 100000, inclusive. M will be between N and 100000, inclusive. Examples 1) 4 576 Returns: 14 The shortest order of operations is: 468121827365481108162243324432576 2) 8748 83462 Returns: 10 The shortest order of operations is: 874813122196832624439366590497873283106834488346083462 3) 4 99991 Returns: -1 The number 99991 can't be obtained because it’s prime!

    Read the article

  • Binding data to scroll view

    - by Rahul Varma
    Hi, I am new to iphone dev. I have a Label and a scroll view. I am trying to get data from url and bind it to label and a scroll view. I am able to bind the data to label by using... UrlValues *asana=[[data yoga]objectAtIndex:i]; self.AsanaName.text = [asana asanatitle]; Similarly i want to bind some other data in the url to a scroll view. The data i want to bind is 4 or 5 sentences. So, can anyone help me how to do it... Any sample code will be really helpful... Thanks

    Read the article

  • Getting the values from an array in android

    - by Rahul Varma
    Hi, I have a collection of strings and declared the strings individually as arrays using ArrayList<String> al=new ArrayList<String>(); and called the arrays in the program by using al=getIntent().getStringArrayListExtra("titles"); Now, instead of declaring each of the arrays i have created SongsArray.java like below... public class SongsArray { private String title; private String movieName; private String singerName; private String imagePath; private String mediaPath; public String gettitle() { return title; } public void settitle(String title) { this.title = title; } public String getmovieName() { return movieName; } public void setmovieName(String movieName) { this.movieName = movieName; } public String getsingerName() { return singerName; } public void setsingerName(String singerName) { this.singerName = singerName; } public String getimagePath() { return imagePath; } public void setimagePath(String imagePath) { this.imagePath = imagePath; } public String getmediaPath() { return mediaPath; } public void setmediaPath(String mediaPath) { this.mediaPath = mediaPath; } } Now i want to call the arrays that i have declared. How can i do that???

    Read the article

  • Trying to insert a row using stored procedured with a parameter binded to an expression.

    - by Arvind Singh
    Environment: asp.net 3.5 (C# and VB) , Ms-sql server 2005 express Tables Table:tableUser ID (primary key) username Table:userSchedule ID (primary key) thecreator (foreign key = tableUser.ID) other fields I have created a procedure that accepts a parameter username and gets the userid and inserts a row in Table:userSchedule Problem: Using stored procedure with datalist control to only fetch data from the database by passing the current username using statement below works fine protected void SqlDataSourceGetUserID_Selecting(object sender, SqlDataSourceSelectingEventArgs e) { e.Command.Parameters["@CurrentUserName"].Value = Context.User.Identity.Name; } But while inserting using DetailsView it shows error Procedure or function OASNewSchedule has too many arguments specified. I did use protected void SqlDataSourceCreateNewSchedule_Selecting(object sender, SqlDataSourceSelectingEventArgs e) { e.Command.Parameters["@CreatedBy"].Value = Context.User.Identity.Name; } DetailsView properties: autogen fields: off, default mode: insert, it shows all the fields that may not be expected by the procedure like ID (primary key) not required in procedure and CreatedBy (user id ) field . So I tried removing the 2 fields from detailsview and shows error Cannot insert the value NULL into column 'CreatedBy', table 'D:\OAS\OAS\APP_DATA\ASPNETDB.MDF.dbo.OASTest'; column does not allow nulls. INSERT fails. The statement has been terminated. For some reason parameters value is not being set. Can anybody bother to understand this and help?

    Read the article

  • Super class variables not printing through sub class

    - by Abhishek Singh
    Can u tell me why this code is not displaying any result on the console. class employee { protected String name; protected double salary; protected String dob; public employee(String name, double salary, String dob) { this.name = name; this.salary = salary; this.dob = dob; } public employee(String name, double salary) { this.name = name; this.salary = salary; } } public class Manage extends employee { String dept1; public Manage(String name, double salary, String dob, String dept1) { super(name, salary, dob); this.dept1 = dept1; } public Manage(String name, double salary, String dept1) { super(name, salary); this.dept1 = dept1; } public static void main(String args[]) { employee e = new employee("Vikas", 122345); employee e2 = new employee("Vikas", 122345, "12-2-1991"); Manage m = (Manage) new Manage("Vikas", 122345, "Sales"); Manage m2 = new Manage("Vikas", 122345, "12-2-1991", "sales"); m.display(); m2.display(); } public void display() { System.out.println("Name " + name); System.out.println("Salary " + salary); System.out.println("Birth " + dob); System.out.println("Department " + dept1); } }

    Read the article

  • Sending URL as a parameter using javascript

    - by Prashant Singh
    I have to send a name and a link from client side to the server. I thought of using AJAX called by Javascript to do this. This is what I mean. I wished to make an ajax request to a file called abc.php with parameters :- 1. http://thumbs2.ebaystatic.com/m/m7dFgOtLUUUSpktHRspjhXw/140.jpg 2. Apple iPod touch, 3rd generation, 32GB To begin with, I encoded the URL and tried to send it. But the server says status Forbidden Any solution to this ? UPDATE :: It end up calling to http://abc.com/addToWishlist.php?rand=506075547542422&image=http://thumbs1.ebaystatic.com/m/mO64jQrMqam2jde9aKiXC9A/140.jpg&prod=Flat%20USB%20Data%20Sync%20Charging%20Charger%20Cable%20Apple%20iPhone%204G%204S%20iPod%20Touch%20Nano Javascript Code :: function addToWishlist(num) { var myurl = "addToWishlist.php"; var myurl1 = myurl; myRand = parseInt(Math.random()*999999999999999); var rand = "?rand="+myRand ; var modurl = myurl1+ rand + "&image=" + encodeURI(storeArray[num][1]) + "&prod=" + encodeURI(storeArray[num][0]); httpq2.open("GET", modurl, true); httpq2.onreadystatechange = useHttpResponseq2; httpq2.send(null); } function useHttpResponseq2() { if (httpq2.readyState == 4) { if(httpq2.status == 200) { var mytext = httpq2.responseText; document.getElementById('wish' + num).innerHTML = "Added to your wishlist."; } } } Server Code <?php include('/home/ankit/public_html/connect_db.php'); $image = $_GET['image']; $prod = $_GET['prod']; $id = $_GET['id']; echo $prod; echo $image; ?> As I mentioned, its pretty basics More Updates : On trying to send a POST request via AJAX to the server, it says :- Refused to set unsafe header "Content-length" Refused to set unsafe header "Connection"

    Read the article

  • Need some ignition in Embedded Systems

    - by Rahul
    I'm very much interested in building applications for Embedded Devices. I'm in my 3rd year Electrical Engineering and I'm passionate about coding, algorithms, Linux OS, etc. And also by Googling I found out that Linux OS is one of the best OSes for Embedded devices(may be/may not be). I want to work for companies which work on mobile applications. I'm a newbie/naive to this domain & my skills include C/C++ & MySQL. I need help to get started in the domain of Embedded Systems; like how/where to start off, Hardware prerequisites, necessary programming skills, also what kind of Embedded Applications etc. I've heard of ARM, firmware, PIC Micorcontrollers; but I don't know anything & just need proper introduction about them. Thanx. P.S: I'm currently reading Bjarne Struotsup's lecture in C++ at Texas A&M University, and one chapter in it describes about Embedded Systems Programming.

    Read the article

  • Cordova - Scrolling with a fixed header and footer (ios)

    - by Samu Singh
    Using Cordova (phonegap) & bootstrap to make a mobile application, testing on IOS for now. Getting an issue with a header and footer bar that are fixed with scrollable content in the middle. When tapping to scroll, the header/footer bar moves down or up with the content but then snaps back to place as soon as the scrolling completes. If I use -webkit-overflow-scrolling: touch; it works as expected, but it makes it really awkward to scroll through the content, and if you scroll passed the end, it only scrolls the header or footer (with elastic overflow) until you stop for a second. here's my html for the header/footer bars: <div id="headerBar"> <div class="container-fluid" style="background-color: #1569C7"> <div class="row"> <div class="col-xs-3 text-left"> <button id="logoutButton" type="button" class="btn btn-default"> Log Out </button> <button type="button" class="btn btn-default" id="restoreQuestionFeedButton"> <span class="glyphicon glyphicon-chevron-left"></span> </button> </div> <div class="col-xs-6 text-center" style="height: 55px"> <strong id="usernameText"></strong> </div> <div class="col-xs-3 text-right"> <button id="oldCreatQuestionButton" type="button" class="btn btn-default"> <span class="glyphicon glyphicon-plus"></span> </button> </div> </div> </div> </div> <div id="footerBar"> <div class="container-fluid" style="padding: 0"> <div class="row text-center"> <button id="createQuestionButton" type="button" class="btn btn-default footerButton"> <span class="glyphicon glyphicon-plus"></span> <strong>Ask a new free question!</strong> </button> </div> </div> </div> And here is the related CSS: #headerBar { position: fixed; z-index: 100; top: 0; left: 0; width: 100%; background-color: #1569C7; } #footerBar { position: fixed; z-index: 100; bottom: 0; left: 0; width: 100%; background-color: #1569C7 !important; }

    Read the article

  • search engine crawling frequency

    - by Aditya Pratap Singh
    I want to design a search engine for news websites ie. download various article pages from these websites, index the pages, and answer search queries on the index. I want a short pseudocode to find an appropriate crawling frequency -- i do not want to crawl too often because the website may not have changed, and do not want to crawl too infrequently because index would then be out of date. Assume that crawling code looks as follows while(1) { sleep(sleep_interval); // sleep for sleep_interval crawl(website); // crawls the entire website diff = diff(currently_crawled_website, previously_crawled_website); // returns a % value of difference between the latest and previous crawls of the website sleep_interval = infer_sleep_interval(diff, sleep_interval); } looking for a pseudocode for the infer_sleep_interval method: long sleep_interval infer_sleep_interval(int diff_percentage,long previous_sleep_interval) { ... ... ... } i want to design method which adaptively alters the sleeping interval based on the update frequency of the website.

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • using internationalization on list data

    - by singh
    i am using Struts2 in application. <s:iterator value="listObject"> <s:component template="abc.vm"> <s:param name="text" value="listValue" /> <s:param name="prefix" value="listIndex" /> </s:component> </s:iterator> listValue is a values of list. i am using iterator to traverse the list. now on listValue, i want to put here internationalization concept.so that all the list value can be display based on Locale which store in a list. please suggest!

    Read the article

  • bash: flushing stdin (standard input)

    - by rahul
    I have a bash script that gets some input as stdin. After processing, I copy a file using "-i" (interactive). However, this never gets executed since (I guess) standard input has not been flushed. To simplify with an example: #!/bin/bash while read line do echo $line done # the next line does not execute read -p "y/n" x echo "got $x" Place this in t.sh, and execute with: ls | ./t.sh The read is not executed. I need to flush stdin before the read. How could it do this?

    Read the article

  • Problem while inserting data from GUI layer to database

    - by Rahul
    Hi all, I am facing problem while i am inserting new record from GUI part to database table. I have created database table Patient with id, name, age etc....id is identity primary key. My problem is while i am inserting duplicate name in table the control should go to else part, and display the message like...This name is already exits, pls try with another name... but in my coding not getting..... Here is all the code...pls somebody point me out whats wrong or how do this??? GUILayer: protected void BtnSubmit_Click(object sender, EventArgs e) { if (!Page.IsValid) return; int intResult = 0; string name = TxtName.Text.Trim(); int age = Convert.ToInt32(TxtAge.Text); string gender; if (RadioButtonMale.Checked) { gender = RadioButtonMale.Text; } else { gender = RadioButtonFemale.Text; } string city = DropDownListCity.SelectedItem.Value; string typeofdisease = ""; foreach (ListItem li in CheckBoxListDisease.Items) { if (li.Selected) { typeofdisease += li.Value; } } typeofdisease = typeofdisease.TrimEnd(); PatientBAL PB = new PatientBAL(); PatientProperty obj = new PatientProperty(); obj.Name = name; obj.Age = age; obj.Gender = gender; obj.City = city; obj.TypeOFDisease = typeofdisease; try { intResult = PB.ADDPatient(obj); if (intResult > 0) { lblMessage.Text = "New record inserted successfully."; TxtName.Text = string.Empty; TxtAge.Text = string.Empty; RadioButtonMale.Enabled = false; RadioButtonFemale.Enabled = false; DropDownListCity.SelectedIndex = 0; CheckBoxListDisease.SelectedIndex = 0; } else { lblMessage.Text = "Name [<b>" + TxtName.Text + "</b>] alredy exists, try another name"; } } catch (Exception ex) { lblMessage.Text = ex.Message.ToString(); } finally { obj = null; PB = null; } } BAL layer: public class PatientBAL { public int ADDPatient(PatientProperty obj) { PatientDAL pdl = new PatientDAL(); try { return pdl.InsertData(obj); } catch { throw; } finally { pdl=null; } } } DAL layer: public class PatientDAL { public string ConString = ConfigurationManager.ConnectionStrings["ConString"].ConnectionString; public int InsertData(PatientProperty obj) { SqlConnection con = new SqlConnection(ConString); con.Open(); SqlCommand com = new SqlCommand("LoadData",con); com.CommandType = CommandType.StoredProcedure; try { com.Parameters.AddWithValue("@Name", obj.Name); com.Parameters.AddWithValue("@Age",obj.Age); com.Parameters.AddWithValue("@Gender",obj.Gender); com.Parameters.AddWithValue("@City", obj.City); com.Parameters.AddWithValue("@TypeOfDisease", obj.TypeOFDisease); return com.ExecuteNonQuery(); } catch { throw; } finally { com.Dispose(); con.Close(); } } } Property Class: public class PatientProperty { private string name; private int age; private string gender; private string city; private string typedisease; public string Name { get { return name; } set { name = value; } } public int Age { get { return age; } set { age = value; } } public string Gender { get { return gender; } set { gender = value; } } public string City { get { return city; } set { city = value; } } public string TypeOFDisease { get { return typedisease; } set { typedisease = value; } } } This is my stored Procedure: CREATE PROCEDURE LoadData ( @Name varchar(50), @Age int, @Gender char(10), @City char(10), @TypeofDisease varchar(50) ) as insert into Patient(Name, Age, Gender, City, TypeOfDisease)values(@Name,@Age, @Gender, @City, @TypeofDisease) GO

    Read the article

  • Issues with SharePoint 2010 Development

    - by Rahul Soni
    I am planning to use my laptop for SharePoint 2010 development and I have only 4 GB RAM which is not even upgradable. Just because of RAM constraint, my VS 2010 keeps crawling if I try to run it along with SharePoint 2010 on the same machine. Hence, I've reformatted my machine and looking for alternate solutions until I get a new laptop. Currently, I have installed VS 2010 ONLY on my laptop and wanted to create an empty SharePoint project. Once done with my project, I want to deploy it on a different machine (which is a 4GB RAM machine as well, but contains only SharePoint 2010). I thought this will work and give me a bit of breather if everything is configured well. Unfortunately, when I tried creating a new SharePoint Empty Project in VS 2010, it says... A SharePoint server is not installed on this computer. A SharePoint server must be installed to work with SharePoint projects. Is there a way out?

    Read the article

  • Preloading and caching of images in silverlight

    - by Prabhjot Singh
    Hi there I have a silverlight application in vs2010 and iam using silverlight 4.0. I have to show a videoppt in which a video is synchronised with images and it runs as a video powerpoint presentation. Is it possible to preload the images or cache them, so that they get rendered as soon as the video starts. If there is a way out, plz guide me.

    Read the article

  • How to store date into Mysql database with play framework in scala?

    - by Rahul Kulhari
    I am working with play framework with scala and what am i doing : login page to login into web app sign up page to register into web app after login i want to store all databases values to user what i want to do: when user register for web app then i want to store user values into database with current time and date but my form is giving error. error: List(FormError(dates,error.required,List())),None) controllers/Application.scala object Application extends Controller { val ta:Form[Keyword] = Form( mapping( "id" -> ignored(NotAssigned:Pk[Long]), "word" -> nonEmptyText, "blog" -> nonEmptyText, "cat" -> nonEmptyText, "score"-> of[Long], "summaryId"-> nonEmptyText, "dates" -> date("yyyy-MM-dd HH:mm:ss") )(Keyword.apply)(Keyword.unapply) ) def index = Action { Ok(html.index(ta)); } def newTask= Action { implicit request => ta.bindFromRequest.fold( errors => {println(errors) BadRequest(html.index(errors))}, keywo => { Keyword.create(keywo) Ok(views.html.data(Keyword.all())) } ) } models/keyword.scala case class Keyword(id: Pk[Long],word: String,blog: String,cat: String,score: Long, summaryId: String,dates: Date ) object Keyword { val keyw = { get[Pk[Long]]("keyword.id") ~ get[String]("keyword.word")~ get[String]("keyword.blog")~ get[String]("keyword.cat")~ get[Long]("keyword.score") ~ get[String]("keyword.summaryId")~ get[Date]("keyword.dates") map { case id~blog~cat~word~score~summaryId~dates => Keyword(id,word,blog,cat,score, summaryId,dates) } } def all(): List[Keyword] = DB.withConnection { implicit c => SQL("select * from keyword").as(Keyword.keyw *) } def create(key: Keyword){DB.withConnection{implicit c=> SQL("insert into keyword values({word},{blog}, {cat}, {score},{summaryId},{dates})").on('word-> key.word,'blog->key.blog, 'cat -> key.cat, 'score-> key.score, 'summaryId -> key.summaryId, 'dates->new Date()).executeUpdate } } views/index.scala.html @(taskForm: Form[Keyword]) @import helper._ @main("Todo list") { @form(routes.Application.newTask) { @inputText(taskForm("word")) @inputText(taskForm("blog")) @inputText(taskForm("cat")) @inputText(taskForm("score")) @inputText(taskForm("summaryId")) <input type="submit"> <a href="">Go Back</a> } } please give me some idea to store date into mysql databse and date is not a field of form

    Read the article

  • Interview question

    - by rahul
    Recenty I was asked this interview question: There is a server which receives millions of requests every day. Design an API for finding out hits in the last one minute, in the last 10 minutes etc. What should be the algorithm and design to implement it efficienly. I want to know the ideas on this.

    Read the article

< Previous Page | 9 10 11 12 13 14 15 16 17 18 19 20  | Next Page >