Search Results

Search found 518 results on 21 pages for 'rahul singh'.

Page 13/21 | < Previous Page | 9 10 11 12 13 14 15 16 17 18 19 20  | Next Page >

  • How to validate SWT form?

    - by Rahul
    Label label1 = new Label(container, SWT.NULL); label1.setText("Enter the Password "); text1 = new Text(container, SWT.BORDER | SWT.PASSWORD); text1.setText(""); text1.addKeyListener(new KeyListener() { public void keyPressed(KeyEvent e) { } public void keyReleased(KeyEvent e) { if (!text5.getText().isEmpty()) { setPageComplete(false); } } }); hi, i am creating form using SWT in eclipse can anyone tell me how to validate that form entry above is the sample code of that..actually i want to validate password field it should be minimum length of 6.How to do this please reply.

    Read the article

  • Android adding HTML content on a webview without space

    - by Rahul
    I am trying to add an HTML content to a web view. If the words in the HTML content are without spaces then webview keeps that particular word on the same line.I want that content to be wrapped and be on the next line.Is it possible to do that.I am attaching a sample code that can reproduce the issue. String temp="<p>WebViewallowsyoutocreateyourownwindowforviewingwebpages(orevendevelopacompletebrowser).Inthistutorial,youcreateasimpleActivitythatcanviewandnavigatewebpages.1.CreateanewprojectnamedHelloWebView.</p>"; WebView wb=new WebView(this); wb.loadDataWithBaseURL("", temp, "text/html", Encoding.UTF_8.toString(),""); setContentView(wb);

    Read the article

  • search engine crawling frequency

    - by Aditya Pratap Singh
    I want to design a search engine for news websites ie. download various article pages from these websites, index the pages, and answer search queries on the index. I want a short pseudocode to find an appropriate crawling frequency -- i do not want to crawl too often because the website may not have changed, and do not want to crawl too infrequently because index would then be out of date. Assume that crawling code looks as follows while(1) { sleep(sleep_interval); // sleep for sleep_interval crawl(website); // crawls the entire website diff = diff(currently_crawled_website, previously_crawled_website); // returns a % value of difference between the latest and previous crawls of the website sleep_interval = infer_sleep_interval(diff, sleep_interval); } looking for a pseudocode for the infer_sleep_interval method: long sleep_interval infer_sleep_interval(int diff_percentage,long previous_sleep_interval) { ... ... ... } i want to design method which adaptively alters the sleeping interval based on the update frequency of the website.

    Read the article

  • Auto Increment feature of SQL Server

    - by Rahul Tripathi
    I have created a table named as ABC. It has three columns which are as follows:- The column number_pk (int) is the primary key of my table in which I have made the auto increment feature on for that column. Now I have deleted two rows from that table say Number_pk= 5 and Number_pk =6. The table which I get now is like this:- Now if I again enter two new rows in this table with the same value I get the two new Number_pk starting from 7 and 8 i.e, My question is that what is the logic behind this since I have deleted the two rows from the table. I know that a simple answer is because I have set the auto increment on for the primary key of my table. But I want to know is there any way that I can insert the two new entries starting from the last Number_pk without changing the design of my table? And how the SQL Server manage this record since I have deleted the rows from the database??

    Read the article

  • Interview question

    - by rahul
    Recenty I was asked this interview question: There is a server which receives millions of requests every day. Design an API for finding out hits in the last one minute, in the last 10 minutes etc. What should be the algorithm and design to implement it efficienly. I want to know the ideas on this.

    Read the article

  • Trying to insert a row using stored procedured with a parameter binded to an expression.

    - by Arvind Singh
    Environment: asp.net 3.5 (C# and VB) , Ms-sql server 2005 express Tables Table:tableUser ID (primary key) username Table:userSchedule ID (primary key) thecreator (foreign key = tableUser.ID) other fields I have created a procedure that accepts a parameter username and gets the userid and inserts a row in Table:userSchedule Problem: Using stored procedure with datalist control to only fetch data from the database by passing the current username using statement below works fine protected void SqlDataSourceGetUserID_Selecting(object sender, SqlDataSourceSelectingEventArgs e) { e.Command.Parameters["@CurrentUserName"].Value = Context.User.Identity.Name; } But while inserting using DetailsView it shows error Procedure or function OASNewSchedule has too many arguments specified. I did use protected void SqlDataSourceCreateNewSchedule_Selecting(object sender, SqlDataSourceSelectingEventArgs e) { e.Command.Parameters["@CreatedBy"].Value = Context.User.Identity.Name; } DetailsView properties: autogen fields: off, default mode: insert, it shows all the fields that may not be expected by the procedure like ID (primary key) not required in procedure and CreatedBy (user id ) field . So I tried removing the 2 fields from detailsview and shows error Cannot insert the value NULL into column 'CreatedBy', table 'D:\OAS\OAS\APP_DATA\ASPNETDB.MDF.dbo.OASTest'; column does not allow nulls. INSERT fails. The statement has been terminated. For some reason parameters value is not being set. Can anybody bother to understand this and help?

    Read the article

  • Cordova - Scrolling with a fixed header and footer (ios)

    - by Samu Singh
    Using Cordova (phonegap) & bootstrap to make a mobile application, testing on IOS for now. Getting an issue with a header and footer bar that are fixed with scrollable content in the middle. When tapping to scroll, the header/footer bar moves down or up with the content but then snaps back to place as soon as the scrolling completes. If I use -webkit-overflow-scrolling: touch; it works as expected, but it makes it really awkward to scroll through the content, and if you scroll passed the end, it only scrolls the header or footer (with elastic overflow) until you stop for a second. here's my html for the header/footer bars: <div id="headerBar"> <div class="container-fluid" style="background-color: #1569C7"> <div class="row"> <div class="col-xs-3 text-left"> <button id="logoutButton" type="button" class="btn btn-default"> Log Out </button> <button type="button" class="btn btn-default" id="restoreQuestionFeedButton"> <span class="glyphicon glyphicon-chevron-left"></span> </button> </div> <div class="col-xs-6 text-center" style="height: 55px"> <strong id="usernameText"></strong> </div> <div class="col-xs-3 text-right"> <button id="oldCreatQuestionButton" type="button" class="btn btn-default"> <span class="glyphicon glyphicon-plus"></span> </button> </div> </div> </div> </div> <div id="footerBar"> <div class="container-fluid" style="padding: 0"> <div class="row text-center"> <button id="createQuestionButton" type="button" class="btn btn-default footerButton"> <span class="glyphicon glyphicon-plus"></span> <strong>Ask a new free question!</strong> </button> </div> </div> </div> And here is the related CSS: #headerBar { position: fixed; z-index: 100; top: 0; left: 0; width: 100%; background-color: #1569C7; } #footerBar { position: fixed; z-index: 100; bottom: 0; left: 0; width: 100%; background-color: #1569C7 !important; }

    Read the article

  • Super class variables not printing through sub class

    - by Abhishek Singh
    Can u tell me why this code is not displaying any result on the console. class employee { protected String name; protected double salary; protected String dob; public employee(String name, double salary, String dob) { this.name = name; this.salary = salary; this.dob = dob; } public employee(String name, double salary) { this.name = name; this.salary = salary; } } public class Manage extends employee { String dept1; public Manage(String name, double salary, String dob, String dept1) { super(name, salary, dob); this.dept1 = dept1; } public Manage(String name, double salary, String dept1) { super(name, salary); this.dept1 = dept1; } public static void main(String args[]) { employee e = new employee("Vikas", 122345); employee e2 = new employee("Vikas", 122345, "12-2-1991"); Manage m = (Manage) new Manage("Vikas", 122345, "Sales"); Manage m2 = new Manage("Vikas", 122345, "12-2-1991", "sales"); m.display(); m2.display(); } public void display() { System.out.println("Name " + name); System.out.println("Salary " + salary); System.out.println("Birth " + dob); System.out.println("Department " + dept1); } }

    Read the article

  • using internationalization on list data

    - by singh
    i am using Struts2 in application. <s:iterator value="listObject"> <s:component template="abc.vm"> <s:param name="text" value="listValue" /> <s:param name="prefix" value="listIndex" /> </s:component> </s:iterator> listValue is a values of list. i am using iterator to traverse the list. now on listValue, i want to put here internationalization concept.so that all the list value can be display based on Locale which store in a list. please suggest!

    Read the article

  • Need some ignition in Embedded Systems

    - by Rahul
    I'm very much interested in building applications for Embedded Devices. I'm in my 3rd year Electrical Engineering and I'm passionate about coding, algorithms, Linux OS, etc. And also by Googling I found out that Linux OS is one of the best OSes for Embedded devices(may be/may not be). I want to work for companies which work on mobile applications. I'm a newbie/naive to this domain & my skills include C/C++ & MySQL. I need help to get started in the domain of Embedded Systems; like how/where to start off, Hardware prerequisites, necessary programming skills, also what kind of Embedded Applications etc. I've heard of ARM, firmware, PIC Micorcontrollers; but I don't know anything & just need proper introduction about them. Thanx. P.S: I'm currently reading Bjarne Struotsup's lecture in C++ at Texas A&M University, and one chapter in it describes about Embedded Systems Programming.

    Read the article

  • Issues with SharePoint 2010 Development

    - by Rahul Soni
    I am planning to use my laptop for SharePoint 2010 development and I have only 4 GB RAM which is not even upgradable. Just because of RAM constraint, my VS 2010 keeps crawling if I try to run it along with SharePoint 2010 on the same machine. Hence, I've reformatted my machine and looking for alternate solutions until I get a new laptop. Currently, I have installed VS 2010 ONLY on my laptop and wanted to create an empty SharePoint project. Once done with my project, I want to deploy it on a different machine (which is a 4GB RAM machine as well, but contains only SharePoint 2010). I thought this will work and give me a bit of breather if everything is configured well. Unfortunately, when I tried creating a new SharePoint Empty Project in VS 2010, it says... A SharePoint server is not installed on this computer. A SharePoint server must be installed to work with SharePoint projects. Is there a way out?

    Read the article

  • Sending URL as a parameter using javascript

    - by Prashant Singh
    I have to send a name and a link from client side to the server. I thought of using AJAX called by Javascript to do this. This is what I mean. I wished to make an ajax request to a file called abc.php with parameters :- 1. http://thumbs2.ebaystatic.com/m/m7dFgOtLUUUSpktHRspjhXw/140.jpg 2. Apple iPod touch, 3rd generation, 32GB To begin with, I encoded the URL and tried to send it. But the server says status Forbidden Any solution to this ? UPDATE :: It end up calling to http://abc.com/addToWishlist.php?rand=506075547542422&image=http://thumbs1.ebaystatic.com/m/mO64jQrMqam2jde9aKiXC9A/140.jpg&prod=Flat%20USB%20Data%20Sync%20Charging%20Charger%20Cable%20Apple%20iPhone%204G%204S%20iPod%20Touch%20Nano Javascript Code :: function addToWishlist(num) { var myurl = "addToWishlist.php"; var myurl1 = myurl; myRand = parseInt(Math.random()*999999999999999); var rand = "?rand="+myRand ; var modurl = myurl1+ rand + "&image=" + encodeURI(storeArray[num][1]) + "&prod=" + encodeURI(storeArray[num][0]); httpq2.open("GET", modurl, true); httpq2.onreadystatechange = useHttpResponseq2; httpq2.send(null); } function useHttpResponseq2() { if (httpq2.readyState == 4) { if(httpq2.status == 200) { var mytext = httpq2.responseText; document.getElementById('wish' + num).innerHTML = "Added to your wishlist."; } } } Server Code <?php include('/home/ankit/public_html/connect_db.php'); $image = $_GET['image']; $prod = $_GET['prod']; $id = $_GET['id']; echo $prod; echo $image; ?> As I mentioned, its pretty basics More Updates : On trying to send a POST request via AJAX to the server, it says :- Refused to set unsafe header "Content-length" Refused to set unsafe header "Connection"

    Read the article

  • bash: flushing stdin (standard input)

    - by rahul
    I have a bash script that gets some input as stdin. After processing, I copy a file using "-i" (interactive). However, this never gets executed since (I guess) standard input has not been flushed. To simplify with an example: #!/bin/bash while read line do echo $line done # the next line does not execute read -p "y/n" x echo "got $x" Place this in t.sh, and execute with: ls | ./t.sh The read is not executed. I need to flush stdin before the read. How could it do this?

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • Out of memory error

    - by Rahul Varma
    Hi, I am trying to retrieve a list of images and text from a web service. I have first coded to get the images to a list using Simple Adapter. The images are getting displayed the app is showing an error and in the Logcat the following errors occur... 04-26 10:55:39.483: ERROR/dalvikvm-heap(1047): 8850-byte external allocation too large for this process. 04-26 10:55:39.493: ERROR/(1047): VM won't let us allocate 8850 bytes 04-26 10:55:39.563: ERROR/AndroidRuntime(1047): Uncaught handler: thread Thread-96 exiting due to uncaught exception 04-26 10:55:39.573: ERROR/AndroidRuntime(1047): java.lang.OutOfMemoryError: bitmap size exceeds VM budget 04-26 10:55:39.573: ERROR/AndroidRuntime(1047): at android.graphics.BitmapFactory.nativeDecodeStream(Native Method) 04-26 10:55:39.573: ERROR/AndroidRuntime(1047): at android.graphics.BitmapFactory.decodeStream(BitmapFactory.java:451) 04-26 10:55:39.573: ERROR/AndroidRuntime(1047): at com.stellent.gorinka.AsyncImageLoaderv.loadImageFromUrl(AsyncImageLoaderv.java:57) 04-26 10:55:39.573: ERROR/AndroidRuntime(1047): at com.stellent.gorinka.AsyncImageLoaderv$2.run(AsyncImageLoaderv.java:41) 04-26 10:55:40.393: ERROR/dalvikvm-heap(1047): 14600-byte external allocation too large for this process. 04-26 10:55:40.403: ERROR/(1047): VM won't let us allocate 14600 bytes 04-26 10:55:40.493: ERROR/AndroidRuntime(1047): Uncaught handler: thread Thread-93 exiting due to uncaught exception 04-26 10:55:40.493: ERROR/AndroidRuntime(1047): java.lang.OutOfMemoryError: bitmap size exceeds VM budget 04-26 10:55:40.493: ERROR/AndroidRuntime(1047): at android.graphics.BitmapFactory.nativeDecodeStream(Native Method) 04-26 10:55:40.493: ERROR/AndroidRuntime(1047): at android.graphics.BitmapFactory.decodeStream(BitmapFactory.java:451) 04-26 10:55:40.493: ERROR/AndroidRuntime(1047): at com.stellent.gorinka.AsyncImageLoaderv.loadImageFromUrl(AsyncImageLoaderv.java:57) 04-26 10:55:40.493: ERROR/AndroidRuntime(1047): at com.stellent.gorinka.AsyncImageLoaderv$2.run(AsyncImageLoaderv.java:41) 04-26 10:55:40.594: INFO/Process(584): Sending signal. PID: 1047 SIG: 3 Here's the coding in the adapter... final ImageView imageView = (ImageView) rowView.findViewById(R.id.image); AsyncImageLoaderv asyncImageLoader=new AsyncImageLoaderv(); Bitmap cachedImage = asyncImageLoader.loadDrawable(imgPath, new AsyncImageLoaderv.ImageCallback() { public void imageLoaded(Bitmap imageDrawable, String imageUrl) { imageView.setImageBitmap(imageDrawable); } }); imageView.setImageBitmap(cachedImage); .......... ........... ............ //To load the image... public static Bitmap loadImageFromUrl(String url) { InputStream inputStream;Bitmap b; try { inputStream = (InputStream) new URL(url).getContent(); BitmapFactory.Options bpo= new BitmapFactory.Options(); bpo.inSampleSize=2; b=BitmapFactory.decodeStream(inputStream, null,bpo ); return b; } catch (IOException e) { throw new RuntimeException(e); } // return null; } Please tell me how to fix the error....

    Read the article

  • Tortoise SVN revision history

    - by rahul
    I want to know for how long the tortoise svn keeps the revision history. Say I have a file which I deleted from repository through repo browser an year ago, will I be able to still recover that file? If I am able to recover, I also want to know the method to permanently delete that earlier copy of file and related revisions history so that in future nobody is able to access that file. Is it possible? I have run into problems in my organisation as I did frequent updations and deletions assuming that file was getting deleted permanently. The file system of repository has bloated now. Please suggest how to fix it.

    Read the article

  • Preloading and caching of images in silverlight

    - by Prabhjot Singh
    Hi there I have a silverlight application in vs2010 and iam using silverlight 4.0. I have to show a videoppt in which a video is synchronised with images and it runs as a video powerpoint presentation. Is it possible to preload the images or cache them, so that they get rendered as soon as the video starts. If there is a way out, plz guide me.

    Read the article

< Previous Page | 9 10 11 12 13 14 15 16 17 18 19 20  | Next Page >