Search Results

Search found 358 results on 15 pages for 'bufferedreader'.

Page 13/15 | < Previous Page | 9 10 11 12 13 14 15  | Next Page >

  • How to get java to recognize symbolic links under cygwin

    - by Keith Randall
    Here's a very simple java program to print the first line of a file: import java.io.* public class test { public static void main(String[] args) throws IOException { System.out.print(new BufferedReader(new FileReader(args[0])).readLine()); } } When I run this program under cygwin and pass it the name of a symbolic link, it prints the contents of the symbolic link, not the target of that link: $ echo foo > testfile $ ln -s testfile symlink_to_testfile $ java test testfile foo $ java test symlink_to_testfile !<symlink> ?t e s t f i l e How do I convince java to follow the symlink? I was hoping there was something simpler than implementing the redirect myself.

    Read the article

  • Java BufferedWriter close()

    - by rakeshr
    Hi, assume that I have the following code fragment operation1(); bw.close(); operation2(); When I call BufferedReader.close() from my code, I am assuming my JVM makes a system call that ensures that the buffer has been flushed and written to disk. I want to know if close() waits for the system call to complete its operation or does it proceed to operation2() without waiting for close() to finish. To rephrase my question, when I do operation2(), can I assume that bw.close() has completed successfully?

    Read the article

  • Communication between java server and matlab client

    - by user272587
    I'd like to establish a server(Java)/client (Matlab) communication using socket. They can send messages to each other. An example shows how to do this in Java server and Java client, http://java.sun.com/docs/books/tutorial/networking/sockets/clientServer.html. When I try to rewrite the client part in Matlab, I only can get the first message that the Java server sends and display it in the Matlab command window. When I type a message in the Matlab command window, I can't pass it to the Java Server. Jave code: kkSocket = new Socket("localhost", 3434); Matlab equivalent: kkSocket = Socket('localhost', 3434); Java code for client: out = new PrintWriter(kkSocket.getOutputStream(), true); in = new BufferedReader(new InputStreamReader(kkSocket.getInputStream())); What would be a Matlab equivalent for this? Thanks in advance.

    Read the article

  • Huge file in Clojure and Java heap space error

    - by trzewiczek
    I posted before on a huge XML file - it's a 287GB XML with Wikipedia dump I want ot put into CSV file (revisions authors and timestamps). I managed to do that till some point. Before I got the StackOverflow Error, but now after solving the first problem I get: java.lang.OutOfMemoryError: Java heap space error. My code (partly taken from Justin Kramer answer) looks like that: (defn process-pages [page] (let [title (article-title page) revisions (filter #(= :revision (:tag %)) (:content page))] (for [revision revisions] (let [user (revision-user revision) time (revision-timestamp revision)] (spit "files/data.csv" (str "\"" time "\";\"" user "\";\"" title "\"\n" ) :append true))))) (defn open-file [file-name] (let [rdr (BufferedReader. (FileReader. file-name))] (->> (:content (data.xml/parse rdr :coalescing false)) (filter #(= :page (:tag %))) (map process-pages)))) I don't show article-title, revision-user and revision-title functions, because they just simply take data from a specific place in the page or revision hash. Anyone could help me with this - I'm really new in Clojure and don't get the problem.

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • [Android] Force close when trying to parse JSON with AsyncTask in the background

    - by robs
    Hello everyone, i'm new to android development and i'm playing around with json data. I managed to get the parsing to work. I want to show a ProgressDialog and i read that i need to use AsyncTask that. But for some reason i get a force close as soon as i put the same working code inside doInBackground() eventhough eclipse says everything is fine. Here is the source code: public class HomeActivity extends Activity { public class BackgroundAsyncTask extends AsyncTask<Void, Integer, Void> { ProgressDialog dialog = new ProgressDialog (HomeActivity.this); @Override protected void onPreExecute() { dialog.setMessage("Loading...please wait"); dialog.setIndeterminate(true); dialog.setCancelable(false); dialog.show(); } protected void onPostExecute() { dialog.dismiss(); } @Override protected Void doInBackground(Void... params) { try { URL json = new URL("http://www.corps-marchia.de/jsontest.php"); URLConnection tc = json.openConnection(); BufferedReader in = new BufferedReader(new InputStreamReader(tc.getInputStream())); String line; while ((line = in.readLine()) != null) { JSONArray ja = new JSONArray(line); JSONObject jo = (JSONObject) ja.get(0); TextView txtView = (TextView)findViewById(R.id.TextView01); txtView.setText(jo.getString("text")); } } catch (MalformedURLException e) { e.printStackTrace(); } catch (IOException e) { e.printStackTrace(); } catch (JSONException e) { e.printStackTrace(); } return null; } } @Override public void onCreate(Bundle savedInstanceState) { super.onCreate(savedInstanceState); setContentView(R.layout.main); new BackgroundAsyncTask().execute(); } } Here is the error log: 01-08 12:33:48.225: ERROR/AndroidRuntime(815): FATAL EXCEPTION: AsyncTask #1 01-08 12:33:48.225: ERROR/AndroidRuntime(815): java.lang.RuntimeException: An error occured while executing doInBackground() 01-08 12:33:48.225: ERROR/AndroidRuntime(815): at android.os.AsyncTask$3.done(AsyncTask.java:200) 01-08 12:33:48.225: ERROR/AndroidRuntime(815): at java.util.concurrent.FutureTask$Sync.innerSetException(FutureTask.java:274) 01-08 12:33:48.225: ERROR/AndroidRuntime(815): at java.util.concurrent.FutureTask.setException(FutureTask.java:125) 01-08 12:33:48.225: ERROR/AndroidRuntime(815): at java.util.concurrent.FutureTask$Sync.innerRun(FutureTask.java:308) 01-08 12:33:48.225: ERROR/AndroidRuntime(815): at java.util.concurrent.FutureTask.run(FutureTask.java:138) 01-08 12:33:48.225: ERROR/AndroidRuntime(815): at java.util.concurrent.ThreadPoolExecutor.runWorker(ThreadPoolExecutor.java:1088) 01-08 12:33:48.225: ERROR/AndroidRuntime(815): at java.util.concurrent.ThreadPoolExecutor$Worker.run(ThreadPoolExecutor.java:581) 01-08 12:33:48.225: ERROR/AndroidRuntime(815): at java.lang.Thread.run(Thread.java:1019) 01-08 12:33:48.225: ERROR/AndroidRuntime(815): Caused by: android.view.ViewRoot$CalledFromWrongThreadException: Only the original thread that created a view hierarchy can touch its views. 01-08 12:33:48.225: ERROR/AndroidRuntime(815): at android.view.ViewRoot.checkThread(ViewRoot.java:2932) 01-08 12:33:48.225: ERROR/AndroidRuntime(815): at android.view.ViewRoot.requestLayout(ViewRoot.java:629) 01-08 12:33:48.225: ERROR/AndroidRuntime(815): at android.view.View.requestLayout(View.java:8267) 01-08 12:33:48.225: ERROR/AndroidRuntime(815): at android.view.View.requestLayout(View.java:8267) 01-08 12:33:48.225: ERROR/AndroidRuntime(815): at android.view.View.requestLayout(View.java:8267) 01-08 12:33:48.225: ERROR/AndroidRuntime(815): at android.view.View.requestLayout(View.java:8267) 01-08 12:33:48.225: ERROR/AndroidRuntime(815): at android.view.View.requestLayout(View.java:8267) 01-08 12:33:48.225: ERROR/AndroidRuntime(815): at android.widget.TextView.checkForRelayout(TextView.java:5521) 01-08 12:33:48.225: ERROR/AndroidRuntime(815): at android.widget.TextView.setText(TextView.java:2724) 01-08 12:33:48.225: ERROR/AndroidRuntime(815): at android.widget.TextView.setText(TextView.java:2592) 01-08 12:33:48.225: ERROR/AndroidRuntime(815): at android.widget.TextView.setText(TextView.java:2567) 01-08 12:33:48.225: ERROR/AndroidRuntime(815): at net.ajzele.demo.andy1.HomeActivity$BackgroundAsyncTask.doInBackground(HomeActivity.java:52) 01-08 12:33:48.225: ERROR/AndroidRuntime(815): at net.ajzele.demo.andy1.HomeActivity$BackgroundAsyncTask.doInBackground(HomeActivity.java:1) 01-08 12:33:48.225: ERROR/AndroidRuntime(815): at android.os.AsyncTask$2.call(AsyncTask.java:185) 01-08 12:33:48.225: ERROR/AndroidRuntime(815): at java.util.concurrent.FutureTask$Sync.innerRun(FutureTask.java:306) 01-08 12:33:48.225: ERROR/AndroidRuntime(815): ... 4 more 01-08 12:33:51.605: ERROR/WindowManager(815): Activity net.ajzele.demo.andy1.HomeActivity has leaked window com.android.internal.policy.impl.PhoneWindow$DecorView@4051d0c0 that was originally added here 01-08 12:33:51.605: ERROR/WindowManager(815): android.view.WindowLeaked: Activity net.ajzele.demo.andy1.HomeActivity has leaked window com.android.internal.policy.impl.PhoneWindow$DecorView@4051d0c0 that was originally added here 01-08 12:33:51.605: ERROR/WindowManager(815): at android.view.ViewRoot.<init>(ViewRoot.java:258) 01-08 12:33:51.605: ERROR/WindowManager(815): at android.view.WindowManagerImpl.addView(WindowManagerImpl.java:148) 01-08 12:33:51.605: ERROR/WindowManager(815): at android.view.WindowManagerImpl.addView(WindowManagerImpl.java:91) 01-08 12:33:51.605: ERROR/WindowManager(815): at android.view.Window$LocalWindowManager.addView(Window.java:424) 01-08 12:33:51.605: ERROR/WindowManager(815): at android.app.Dialog.show(Dialog.java:241) 01-08 12:33:51.605: ERROR/WindowManager(815): at net.ajzele.demo.andy1.HomeActivity$BackgroundAsyncTask.onPreExecute(HomeActivity.java:33) 01-08 12:33:51.605: ERROR/WindowManager(815): at android.os.AsyncTask.execute(AsyncTask.java:391) 01-08 12:33:51.605: ERROR/WindowManager(815): at net.ajzele.demo.andy1.HomeActivity.onCreate(HomeActivity.java:72) 01-08 12:33:51.605: ERROR/WindowManager(815): at android.app.Instrumentation.callActivityOnCreate(Instrumentation.java:1047) 01-08 12:33:51.605: ERROR/WindowManager(815): at android.app.ActivityThread.performLaunchActivity(ActivityThread.java:1586) 01-08 12:33:51.605: ERROR/WindowManager(815): at android.app.ActivityThread.handleLaunchActivity(ActivityThread.java:1638) 01-08 12:33:51.605: ERROR/WindowManager(815): at android.app.ActivityThread.access$1500(ActivityThread.java:117) 01-08 12:33:51.605: ERROR/WindowManager(815): at android.app.ActivityThread$H.handleMessage(ActivityThread.java:928) 01-08 12:33:51.605: ERROR/WindowManager(815): at android.os.Handler.dispatchMessage(Handler.java:99) 01-08 12:33:51.605: ERROR/WindowManager(815): at android.os.Looper.loop(Looper.java:123) 01-08 12:33:51.605: ERROR/WindowManager(815): at android.app.ActivityThread.main(ActivityThread.java:3647) 01-08 12:33:51.605: ERROR/WindowManager(815): at java.lang.reflect.Method.invokeNative(Native Method) 01-08 12:33:51.605: ERROR/WindowManager(815): at java.lang.reflect.Method.invoke(Method.java:507) 01-08 12:33:51.605: ERROR/WindowManager(815): at com.android.internal.os.ZygoteInit$MethodAndArgsCaller.run(ZygoteInit.java:839) 01-08 12:33:51.605: ERROR/WindowManager(815): at com.android.internal.os.ZygoteInit.main(ZygoteInit.java:597) 01-08 12:33:51.605: ERROR/WindowManager(815): at dalvik.system.NativeStart.main(Native Method) Any hints? I hope you can help me out ive searched the net and didnt find any working solution...Thanks in advance

    Read the article

  • Lackadaisical One-to-One between Char and Byte Streams

    - by Vaibhav Bajpai
    I expected to have a one-to-one correspondence between the character streams and byte streams in terms of how the classes are organized in their hierarchy. FilterReader and FilterWriter (character streams) correspond back to FilterInputStream and FilterOutputStream (byte stream) classes. However I noticed few changes as - BufferedInputStream extends FilterInputStream, but BufferedReader does NOT extend FilterReader. BufferedOutputStream and PrintStream both extend FilterOutputStream, but BufferedWriter and PrintWriter does NOT extend FilterWriter. FilterInputStream and FilterOutputStream are not abstract classes, but FilterReader and FilterWriter are. I am not sure if I am being too paranoid to point out such differences, but was just curious to know if there was design reasoning behind such decision.

    Read the article

  • Pass string between two threads in java

    - by geeta
    I have to search a string in a file and write the matched lines to another file. I have a thread to read a file and a thread to write a file. I want to send the stringBuffer from read thread to write thread. Please help me to pass this. I amm getting null value passed. write thread: class OutputThread extends Thread{ /****************** Writes the line with search string to the output file *************/ Thread runner1,runner; File Out_File; public OutputThread() { } public OutputThread(Thread runner,File Out_File) { runner1 = new Thread(this,"writeThread"); // (1) Create a new thread. this.Out_File=Out_File; this.runner=runner; runner1.start(); // (2) Start the thread. } public void run() { try{ BufferedWriter bufferedWriter=new BufferedWriter(new FileWriter(Out_File,true)); System.out.println("inside write"); synchronized(runner){ System.out.println("inside wait"); runner.wait(); } System.out.println("outside wait"); // bufferedWriter.write(line.toString()); Buffer Buf = new Buffer(); bufferedWriter.write(Buf.buffers); System.out.println(Buf.buffers); bufferedWriter.flush(); } catch(Exception e){ System.out.println(e); e.printStackTrace(); } } } Read Thraed: class FileThread extends Thread{ Thread runner; File dir; String search_string,stats; File Out_File,final_output; StringBuffer sb = new StringBuffer(); public FileThread() { } public FileThread(CountDownLatch latch,String threadName,File dir,String search_string,File Out_File,File final_output,String stats) { runner = new Thread(this, threadName); // (1) Create a new thread. this.dir=dir; this.search_string=search_string; this.Out_File=Out_File; this.stats=stats; this.final_output=final_output; this.latch=latch; runner.start(); // (2) Start the thread. } public void run() { try{ Enumeration entries; ZipFile zipFile; String source_file_name = dir.toString(); File Source_file = dir; String extension; OutputThread out = new OutputThread(runner,Out_File); int dotPos = source_file_name.lastIndexOf("."); extension = source_file_name.substring(dotPos+1); if(extension.equals("zip")) { zipFile = new ZipFile(source_file_name); entries = zipFile.entries(); while(entries.hasMoreElements()) { ZipEntry entry = (ZipEntry)entries.nextElement(); if(entry.isDirectory()) { (new File(entry.getName())).mkdir(); continue; } searchString(runner,entry.getName(),new BufferedInputStream(zipFile.getInputStream(entry)),Out_File,final_output,search_string,stats); } zipFile.close(); } else { searchString(runner,Source_file.toString(),new BufferedInputStream(new FileInputStream(Source_file)),Out_File,final_output,search_string,stats); } } catch(Exception e){ System.out.println(e); e.printStackTrace(); } } /********* Reads the Input Files and Searches for the String ******************************/ public void searchString(Thread runner,String Source_File,BufferedInputStream in,File output_file,File final_output,String search,String stats) { int count = 0; int countw = 0; int countl=0; String s; String[] str; String newLine = System.getProperty("line.separator"); try { BufferedReader br2 = new BufferedReader(new InputStreamReader(in)); //OutputFile outfile = new OutputFile(); BufferedWriter bufferedWriter = new BufferedWriter(new FileWriter(output_file,true)); Buffer Buf = new Buffer(); //StringBuffer sb = new StringBuffer(); StringBuffer sb1 = new StringBuffer(); while((s = br2.readLine()) != null ) { str = s.split(search); count = str.length-1; countw += count; if(s.contains(search)){ countl++; sb.append(s); sb.append(newLine); } if(countl%100==0) { System.out.println("inside count"); Buf.setBuffers(sb.toString()); sb.delete(0,sb.length()); System.out.println("outside notify"); synchronized(runner) { runner.notify(); } //outfile.WriteFile(sb,bufferedWriter); //sb.delete(0,sb.length()); } } } synchronized(runner) { runner.notify(); } br2.close(); in.close(); if(countw == 0) { System.out.println("Input File : "+Source_File ); System.out.println("Word not found"); System.exit(0); } else { System.out.println("Input File : "+Source_File ); System.out.println("Matched word count : "+countw ); System.out.println("Lines with Search String : "+countl); System.out.println("Output File : "+output_file.toString()); System.out.println(); } } catch(Exception e){ System.out.println(e); e.printStackTrace(); } } }

    Read the article

  • How to append text into text file dynamically

    - by niraj deshmukh
    [12] key1=val1 key2=val2 key3=val3 key4=val4 key5=val5 [13] key1=val1 key2=val2 key3=val3 key4=val4 key5=xyz [14] key1=val1 key2=val2 key3=val3 key4=val4 key5=val5 I want to update key5=val5 where [13]. try { br = new BufferedReader(new FileReader(oldFileName)); bw = new BufferedWriter(new FileWriter(tmpFileName)); String line; while ((line = br.readLine()) != null) { System.out.println(line); if (line.contains("[13]")) { while (line.contains("key5")) { if (line.contains("key5")) { line = line.replace("key5", "key5= Val5"); bw.write(line+"\n"); } } } } } catch (Exception e) { return; } finally { try { if(br != null) br.close(); } catch (IOException e) { // } try { if(bw != null) bw.close(); } catch (IOException e) { // } }

    Read the article

  • What is the fastest way to scrape HTML webpage in Android?

    - by kunjaan
    I need to extract information from an unstructured web page in Android. The information I want is embedded in a table that doesn't have an id. <table> <tr><td>Description</td><td></td><td>I want this field next to the description cell</td></tr> </table> Should I use Pattern Matching? Use BufferedReader to extract the information? Or are there faster way to get that information?

    Read the article

  • Android UnknownHost in asyncTask - loading web page

    - by Sneha
    I followed this tutorial for AsyncTask and getting the following error log: 03-23 11:44:42.936: WARN/System.err(315): java.net.UnknownHostException: www.google.co.in 03-23 11:44:42.936: WARN/System.err(315): at java.net.InetAddress.lookupHostByName(InetAddress.java:513) 03-23 11:44:42.936: WARN/System.err(315): at java.net.InetAddress.getAllByNameImpl(InetAddress.java:278) 03-23 11:44:42.936: WARN/System.err(315): at java.net.InetAddress.getAllByName(InetAddress.java:242) 03-23 11:44:42.936: WARN/System.err(315): at org.apache.http.impl.conn.DefaultClientConnectionOperator.openConnection(DefaultClientConnectionOperator.java:136) 03-23 11:44:42.936: WARN/System.err(315): at org.apache.http.impl.conn.AbstractPoolEntry.open(AbstractPoolEntry.java:164) 03-23 11:44:42.936: WARN/System.err(315): at org.apache.http.impl.conn.AbstractPooledConnAdapter.open(AbstractPooledConnAdapter.java:119) 03-23 11:44:42.936: WARN/System.err(315): at org.apache.http.impl.client.DefaultRequestDirector.execute(DefaultRequestDirector.java:348) 03-23 11:44:42.936: WARN/System.err(315): at org.apache.http.impl.client.AbstractHttpClient.execute(AbstractHttpClient.java:555) 03-23 11:44:42.936: WARN/System.err(315): at org.apache.http.impl.client.AbstractHttpClient.execute(AbstractHttpClient.java:487) 03-23 11:44:42.944: WARN/System.err(315): at org.apache.http.impl.client.AbstractHttpC lient.execute(AbstractHttpClient.java:465) 03-23 11:44:42.944: WARN/System.err(315): at com.test.async.AsyncTaskExampleActivity$DownloadWebPageTask.doInBackground (AsyncTaskExampleActivity.java:36) 03-23 11:44:42.944: WARN/System.err(315): at com.test.async.AsyncTaskExampleActivity$DownloadWebPageTask.doInBackground (AsyncTaskExampleActivity.java:1) 03-23 11:44:42.944: WARN/System.err(315): at android.os.AsyncTask$2.call(AsyncTask.java:185) 03-23 11:44:42.944: WARN/System.err(315): at java.util.concurrent.FutureTask$Sync.innerRun(FutureTask.java:305) 03-23 11:44:42.944: WARN/System.err(315): at java.util.concurrent.FutureTask.run (FutureTask.java:137) 03-23 11:44:42.944: WARN/System.err(315): at java.util.concurrent.ThreadPoolExecutor.runWorker(ThreadPoolExecutor.java:1068) 03-23 11:44:42.944: WARN/System.err(315): at java.util.concurrent.ThreadPoolExecutor$Worker.run(ThreadPoolExecutor.java:561) 03-23 11:44:42.944: WARN/System.err(315): at java.lang.Thread.run(Thread.java:1096) How do i fix it?? My Code: public class AsyncTaskExampleActivity extends Activity { private TextView textView; /** Called when the activity is first created. */ @Override public void onCreate(Bundle savedInstanceState) { super.onCreate(savedInstanceState); setContentView(R.layout.main); textView = (TextView) findViewById(R.id.TextView01); } private class DownloadWebPageTask extends AsyncTask<String, Void, String> { @Override protected String doInBackground(String... urls) { String response = ""; Log.i("", "in doInBackgroundddddddddd.........."); Log.i("", "in readWebpageeeeeeeeeeeee"); /* * try { InetAddress i = * InetAddress.getByName("http://google.co.in"); } catch * (UnknownHostException e1) { e1.printStackTrace(); } */ for (String url : urls) { Log.i("", "in for looooooop doInBackgroundddddddddd.........."); DefaultHttpClient client = new DefaultHttpClient(); HttpGet httpGet = new HttpGet(url); try { Log .i("", "afetr for looooooop try doInBackgroundddddddddd.........."); HttpResponse execute = client.execute(httpGet); Log .i("", "afetr for looooooop try client ..execute doInBackgroundddddddddd.........."); InputStream content = execute.getEntity().getContent(); BufferedReader buffer = new BufferedReader( new InputStreamReader(content)); String s = ""; while ((s = buffer.readLine()) != null) { response += s; Log .i("", "afetr while looooooop try client ..execute doInBackgroundddddddddd.........."); } } catch (Exception e) { e.printStackTrace(); } } Log .i("", "afetr lasttttttttttttt b4 response doInBackgroundddddddddd.........."); return response; } @Override protected void onPostExecute(String result) { Log.i("", "in onPostExecuteeee.........."); textView.setText(result); } } public void readWebpage(View view) { /* * System.setProperty("http.proxyHost", "10.132.116.10"); * System.setProperty("http.proxyPort", "3128"); */ DownloadWebPageTask task = new DownloadWebPageTask(); task.execute(new String[] { "http://google.co.in" }); Log.i("", "in readWebpageeeeeeeeeeeee after execute.........."); } } main.xml: <Button android:id="@+id/readWebpage" android:layout_width="match_parent" android:layout_height="wrap_content" android:onClick="readWebpage" android:text="Load Webpage"> </Button> <TextView android:id="@+id/TextView01" android:layout_width="match_parent" android:layout_height="match_parent" android:text="Example Text"> </TextView> Manifest: <?xml version="1.0" encoding="utf-8"?> <manifest xmlns:android="http://schemas.android.com/apk/res/android" package="com.test.async" android:versionCode="1" android:versionName="1.0"> <uses-sdk android:minSdkVersion="8" /> <uses-permission android:name="android.permission.INTERNET"></uses-permission> <application android:icon="@drawable/icon" android:label="@string/app_name"> <activity android:name=".AsyncTaskExampleActivity" android:label="@string/app_name"> <intent-filter> <action android:name="android.intent.action.MAIN" /> <category android:name="android.intent.category.LAUNCHER" /> </intent-filter> </activity> </application> Thanks Sneha

    Read the article

  • Runtime error on UVa Online Judge on Erdos Number

    - by 2012 - End of the World
    I am solving the Erdos number problem from the programming challenges in JAVA. The code runs perfectly in my machine. However on the online judge it results in a runtime error. Could anyone point out the mistake i made? http://uva.onlinejudge.org/index.php?option=com_onlinejudge&Itemid=8&page=show_problem&problem=985 Here is the code import java.util.*; import java.io.*; class Main { private String inputLines[]; private String namesToBeFound[]; private String namesInEachBook[][]; private String searchItem; private boolean solnfound=false; private static final BufferedReader br =new BufferedReader(new InputStreamReader(System.in)); static String read() throws IOException { String line; while(true) { line=br.readLine(); if(line==null) break; //eof else if(line.length()==0) continue; //blank line else { line=line.trim().replaceAll("\\s+"," "); return line; } } return null; } public static void main(String args[]) throws IOException { Main ob=new Main(); int totalPapers,calcAuthors,totalScenarios; //First input number of scenarios totalScenarios=Integer.parseInt(read()); //Now start a loop for reading total number of scenarios for(int scenario=1;scenario<=totalScenarios;scenario++) { //Now read the line containing the number of papers and authors StringTokenizer line=new StringTokenizer(read()," "); totalPapers=Integer.parseInt(line.nextToken()); calcAuthors=Integer.parseInt(line.nextToken()); //Read a line containing author names along with book names ob.inputLines=new String[totalPapers]; for(int i=0;i<totalPapers;i++) ob.inputLines[i]=read(); //Read a line containing the names to be searched ob.namesToBeFound=new String[calcAuthors]; for(int i=0;i<calcAuthors;i++) ob.namesToBeFound[i]=read(); //Now generate the array ob.buildArray(); //Now search System.out.println("Scenario "+scenario); for(int i=0;i<calcAuthors;i++) { ob.searchItem=ob.namesToBeFound[i]; if(ob.searchItem.equals("Erdos, P.")) { System.out.println("Erdos, P. 0"); continue; } ob.search(ob.namesToBeFound[i],1,new ArrayList()); if(ob.solnfound==false) System.out.println(ob.searchItem+" infinity"); ob.solnfound=false; } } } private void buildArray() { String str; namesInEachBook=new String[inputLines.length][]; for(int i=0;i<inputLines.length;i++) { str=inputLines[i]; str=str.substring(0,str.indexOf(':')); str+=","; namesInEachBook[i]=new String[(countCommas(str)+1)>>1]; for(int j=0;j<namesInEachBook[i].length;j++) { str=str.trim(); namesInEachBook[i][j]=""; namesInEachBook[i][j]+=str.substring(0,str.indexOf(','))+","; str=str.substring(str.indexOf(',')+1); namesInEachBook[i][j]+=str.substring(0,str.indexOf(',')); str=str.substring(str.indexOf(',')+1); } } } private int countCommas(String s) { int num=0; for(int i=0;i<s.length();i++) if(s.charAt(i)==',') num++; return num; } private void search(String searchElem,int ernosDepth,ArrayList searchedElem) { ArrayList searchSpace=new ArrayList(); searchedElem.add(searchElem); for(int i=0;i<namesInEachBook.length;i++) for(int j=0;j<namesInEachBook[i].length;j++) { if(namesInEachBook[i][j].equals(searchElem)) //Add all authors name in this group { for(int k=0;k<namesInEachBook[i].length;k++) { if(namesInEachBook[i][k].equals("Erdos, P.")) //Found { solnfound=true; System.out.println(searchItem+" "+ernosDepth); return; } else if(searchedElem.contains(namesInEachBook[i][k]) || searchSpace.contains(namesInEachBook[i][k])) continue; searchSpace.add(namesInEachBook[i][k]); } break; } } Iterator i=searchSpace.iterator(); while(i.hasNext()) { String cSearchElem=(String)i.next(); search(cSearchElem,ernosDepth+1,searchedElem); } } }

    Read the article

  • String Encoding doesn't ouput all characters

    - by AndroidXTr3meN
    My client uses InputStreamReader/BufferedReader to fetch text from the Internet. However when I save the Text to a *.txt the text shows extra weird special symbols like 'Â'. I've tried Convert the String to ASCII but that mess upp å,ä,ö,Ø which I use. I've tried food = food.replace("Â", ""); and IndexOf(); But string won't find it. But it's there in HEX Editor. So summary: When I use text.setText(Android), the output looks fine with NO weird symbols, but when I save the text to *.txt I get about 4 of 'Â'. I do not want ASCII because I use other Non-ASCII character. The 'Â' is displayed as a Whitespace on my Android and in notepad. Thanks! Have A great Weekend! EDIT* found:   in Wordpad

    Read the article

  • connecting clients to server with emulator on different computers

    - by prolink007
    I am writing an application that communicates using sockets. I have a server running on one android emulator on a computer, then i have 2 other clients running on android emulators on 2 other computers. I am trying to get the 2 clients to connect to the server. This works when i run the server and clients on the same computer, but when i attempt to do this on the same wifi network and on separate computers it gives me the following error. The client and server code is posted below. A lot is stripped out just to show the important stuff. Also, after the server starts i telnet into the server and run these commands redir add tcp:5000:6000 (i have also tried without doing the redir but it still says the same thing). Then i start the clients and get the error. Thanks for the help! Both the 5000 port and 6000 port are open on my router. And i have windows firewall disabled on the computer hosting the server. 11-27 18:54:02.274: W/ActivityManager(60): Activity idle timeout for HistoryRecord{44cf0a30 school.cpe434.ClassAidClient/school.cpe434.ClassAid.ClassAidClient4Activity} 11-27 18:57:02.424: W/System.err(205): java.net.SocketException: The operation timed out 11-27 18:57:02.454: W/System.err(205): at org.apache.harmony.luni.platform.OSNetworkSystem.connectSocketImpl(Native Method) 11-27 18:57:02.454: W/System.err(205): at org.apache.harmony.luni.platform.OSNetworkSystem.connect(OSNetworkSystem.java:114) 11-27 18:57:02.465: W/System.err(205): at org.apache.harmony.luni.net.PlainSocketImpl.connect(PlainSocketImpl.java:245) 11-27 18:57:02.465: W/System.err(205): at org.apache.harmony.luni.net.PlainSocketImpl.connect(PlainSocketImpl.java:220) 11-27 18:57:02.465: W/System.err(205): at java.net.Socket.startupSocket(Socket.java:780) 11-27 18:57:02.465: W/System.err(205): at java.net.Socket.<init>(Socket.java:314) 11-27 18:57:02.465: W/System.err(205): at school.cpe434.ClassAid.ClassAidClient4Activity.onCreate(ClassAidClient4Activity.java:102) 11-27 18:57:02.474: W/System.err(205): at android.app.Instrumentation.callActivityOnCreate(Instrumentation.java:1047) 11-27 18:57:02.474: W/System.err(205): at android.app.ActivityThread.performLaunchActivity(ActivityThread.java:2459) 11-27 18:57:02.474: W/System.err(205): at android.app.ActivityThread.handleLaunchActivity(ActivityThread.java:2512) 11-27 18:57:02.474: W/System.err(205): at android.app.ActivityThread.access$2200(ActivityThread.java:119) 11-27 18:57:02.474: W/System.err(205): at android.app.ActivityThread$H.handleMessage(ActivityThread.java:1863) 11-27 18:57:02.474: W/System.err(205): at android.os.Handler.dispatchMessage(Handler.java:99) 11-27 18:57:02.474: W/System.err(205): at android.os.Looper.loop(Looper.java:123) 11-27 18:57:02.486: W/System.err(205): at android.app.ActivityThread.main(ActivityThread.java:4363) 11-27 18:57:02.486: W/System.err(205): at java.lang.reflect.Method.invokeNative(Native Method) 11-27 18:57:02.486: W/System.err(205): at java.lang.reflect.Method.invoke(Method.java:521) 11-27 18:57:02.486: W/System.err(205): at com.android.internal.os.ZygoteInit$MethodAndArgsCaller.run(ZygoteInit.java:860) 11-27 18:57:02.486: W/System.err(205): at com.android.internal.os.ZygoteInit.main(ZygoteInit.java:618) 11-27 18:57:02.486: W/System.err(205): at dalvik.system.NativeStart.main(Native Method) The server code public class ClassAidServer4Activity extends Activity { ServerSocket ss = null; String mClientMsg = ""; String mClientExtraMsg = ""; Thread myCommsThread = null; public static final int SERVERPORT = 6000; @Override public void onCreate(Bundle savedInstanceState) { super.onCreate(savedInstanceState); setContentView(R.layout.main); TextView tv = (TextView) findViewById(R.id.textView1); tv.setText("Nothing from client yet"); this.myCommsThread = new Thread(new CommsThread()); this.myCommsThread.start(); } class CommsThread implements Runnable { public void run() { // Socket s = null; try { ss = new ServerSocket(SERVERPORT ); } catch (IOException e1) { // TODO Auto-generated catch block e1.printStackTrace(); } while(true) { try { Socket socket = ss.accept(); connectedDeviceCount++; Thread lThread = new Thread(new ListeningThread(socket)); lThread.start(); } catch (IOException e) { e.printStackTrace(); } } } } class ListeningThread implements Runnable { private Socket s = null; public ListeningThread(Socket socket) { // TODO Auto-generated constructor stub this.s = socket; } @Override public void run() { // TODO Auto-generated method stub while (!Thread.currentThread().isInterrupted()) { Message m = new Message(); // m.what = QUESTION_ID; try { if (s == null) s = ss.accept(); BufferedReader input = new BufferedReader( new InputStreamReader(s.getInputStream())); String st = null; st = input.readLine(); String[] temp = parseReadMessage(st); mClientMsg = temp[1]; if(temp.length > 2) { mClientExtraMsg = temp[2]; } m.what = Integer.parseInt(temp[0]); myUpdateHandler.sendMessage(m); } catch (IOException e) { e.printStackTrace(); } } } } } The client code public class ClassAidClient4Activity extends Activity { //telnet localhost 5554 //redir add tcp:5000:6000 private Socket socket; private String serverIpAddress = "192.168.1.102"; private static final int REDIRECTED_SERVERPORT = 5000; @Override public void onCreate(Bundle savedInstanceState) { super.onCreate(savedInstanceState); setContentView(R.layout.main); try { InetAddress serverAddr = InetAddress.getByName(serverIpAddress); socket = new Socket(serverAddr, REDIRECTED_SERVERPORT); } catch (UnknownHostException e1) { mQuestionAdapter.add("UnknownHostException"); e1.printStackTrace(); } catch (IOException e1) { mQuestionAdapter.add("IOException"); e1.printStackTrace(); } } }

    Read the article

  • How to search for duplicate values in a huge text file having around Half Million records

    - by Shibu
    I have an input txt file which has data in the form of records (each row is a record and represents more or less like a DB table) and I need to find for duplicate values. For example: Rec1: ACCOUNT_NBR_1*NAME_1*VALUE_1 Rec2: ACCOUNT_NBR_2*NAME_2*VALUE_2 Rec3: ACCOUNT_NBR_1*NAME_3*VALUE_3 In the above set, the Rec1 and Rec2 are considered to be duplicates as the ACCOUNT NUMBERS are same(ACCOUNT_NBR1). Note: The input file shown above is a delimiter type file (the delimiter being *) however the file type can also be a fixed length file where each column starts and ends with a specified positions. I am currently doing this with the following logic: Loop thru each ACCOUNT NUMBER Loop thru each line of the txt file and record and check if this is repeated. If repeated record the same in a hashtable. End End And I am using 'Pattern' & 'BufferedReader' java API's to perform the above task. But since it is taking a long time, I would like to know a better way of handling it. Thanks, Shibu

    Read the article

  • check whether fgets would block

    - by lv
    Hi, I was just wondering whether in C is it possible to peek in the input buffer or perform similar trickery to know whether a call to fgets would block at a later time. Java allows to do something like that by calling BufferedReader.ready(), this way I can implement console input something like this: while (on && in.ready()) { line = in.readLine(); /* do something with line */ if (!in.ready()) Thread.sleep(100); } this allows an external thread to gracefully shutdown the input loop by setting on to false; I'd like to perform a similar implementation in C without resorting to non portable tricks, I already know I can make a "timed out fgets" under unix by resorting to signals or (better, even though requering to take care of buffering) reimplement it on top of recv/select, but I'd prefer something that would work on windows too. TIA

    Read the article

  • Multiple things at once (Threads?)

    - by Jonathan
    All, What is a really simple way of having a program do more than one thing at once, even if the computer does not necessarily have multiple 'cores'. Can I do this by creating more than one Thread? My goal is to be able to have two computers networked (through Sockets) to respond to each-other's requests, while my program will at the same time be able to be managing a UI. I want the server to potentially handle more than one client at the same time as well. My understanding is that the communication is done with BufferedReader.readLine() and PrintWriter.println(). My problem is that I want the server to be waiting on multiple readLine() requests, and also be doing other things. How do I handle this? Many thanks, Jonathan

    Read the article

  • Scanner's Read Line returning NoSuchElementException

    - by Brian
    This is my first time using StackOverflow. I am trying to read a text file which consists of a single number one the first line. try { Scanner s = new Scanner(new File("HighScores.txt")); int temp =Integer.parseInt(s.nextLine()); s.close(); return temp; } catch (FileNotFoundException e) { // TODO Auto-generated catch block e.printStackTrace(); } However, I get an error: java.util.NoSuchElementException: No line found at java.util.Scanner.nextLine(Unknown Source) at GameStart.getHighScore(GameStart.java:334) at GameStart.init(GameStart.java:82) at sun.applet.AppletPanel.run(Unknown Source) at java.lang.Thread.run(Unknown Source) I know that HighScores.txt is not empty, so why is this problem occuring? I tried using BufferedReader, and BufferReader.readLine() return null.

    Read the article

  • Parsing csv line to Java objects

    - by Noobling
    I was wondering if someone here could help me, I can't find a solution for my problem and I have tried everything. What I am trying to do is read and parse lines in a csv file into java objects and I have succeeded in doing that but after it reads all the lines it should insert the lines into the database but it only inserts the 1st line the entire time and I don't no why. When I do a print it shows that it is reading all the lines and placing them in the objects but as soon as I do the insert it wants to insert only the 1st line. Please see my code below: public boolean lineReader(File file){ BufferedReader br = null; String line= ""; String splitBy = ","; storeList = new ArrayList<StoreFile>(); try { br = new BufferedReader(new FileReader(file)); while((line = br.readLine())!=null){ line = line.replace('|', ','); //split on pipe ( | ) String[] array = line.split(splitBy, 14); //Add values from csv to store object //Add values from csv to storeF objects StoreFile StoreF = new StoreFile(); if (array[0].equals("H") || array[0].equals("T")) { return false; } else { StoreF.setRetailID(array[1].replaceAll("/", "")); StoreF.setChain(array[2].replaceAll("/","")); StoreF.setStoreID(array[3].replaceAll("/", "")); StoreF.setStoreName(array[4].replaceAll("/", "")); StoreF.setAddress1(array[5].replaceAll("/", "")); StoreF.setAddress2(array[6].replaceAll("/", "")); StoreF.setAddress3(array[7].replaceAll("/", "")); StoreF.setProvince(array[8].replaceAll("/", "")); StoreF.setAddress4(array[9].replaceAll("/", "")); StoreF.setCountry(array[10].replaceAll("/", "")); StoreF.setCurrency(array[11].replaceAll("/", "")); StoreF.setAddress5(array[12].replaceAll("/", "")); StoreF.setTelNo(array[13].replaceAll("/", "")); //Add stores to list storeList.add(StoreF); } } //print list stores in file printStoreList(storeList); executeStoredPro(storeList); } catch (Exception ex) { nmtbatchservice.NMTBatchService2.LOG.error("An exception accoured: " + ex.getMessage(), ex); //copy to error folder //email } return false; } public void printStoreList(List<StoreFile> storeListToPrint) { for(int i = 0; i <storeListToPrint.size();i++){ System.out.println( storeListToPrint.get(i).getRetailID() + storeListToPrint.get(i).getChain() + storeListToPrint.get(i).getStoreID() + storeListToPrint.get(i).getStoreName() + storeListToPrint.get(i).getAddress1() + storeListToPrint.get(i).getAddress2() + storeListToPrint.get(i).getAddress3() + storeListToPrint.get(i).getProvince() + storeListToPrint.get(i).getAddress4() + storeListToPrint.get(i).getCountry() + storeListToPrint.get(i).getCurrency() + storeListToPrint.get(i).getAddress5() + storeListToPrint.get(i).getTelNo()); } } public void unzip(String source, String destination) { try { ZipFile zipFile = new ZipFile(source); zipFile.extractAll(destination); deleteStoreFile(source); } catch (ZipException ex) { nmtbatchservice.NMTBatchService2.LOG.error("Error unzipping file : " + ex.getMessage(), ex); } } public void deleteStoreFile(String directory) { try { File file = new File(directory); file.delete(); } catch (Exception ex) { nmtbatchservice.NMTBatchService2.LOG.error("An exception accoured when trying to delete file " + directory + " : " + ex.getMessage(), ex); } } public void executeStoredPro(List<StoreFile> storeListToInsert) { Connection con = null; CallableStatement st = null; try { String connectionURL = MSSQLConnectionURL; Class.forName("com.microsoft.sqlserver.jdbc.SQLServerDriver").newInstance(); con = DriverManager.getConnection(connectionURL, MSSQLUsername, MSSQLPassword); for(int i = 0; i <storeListToInsert.size();i++){ st = con.prepareCall( "IF EXISTS (SELECT * FROM tblPay@RetailStores WHERE StoreID = " + storeListToInsert.get(i).getStoreID() + " AND RetailID = "+ storeListToInsert.get(i).getRetailID() + ")" + " UPDATE tblPay@RetailStores " + " SET RetailID = '" + storeListToInsert.get(i).getRetailID() + "'," + " StoreID = '" + storeListToInsert.get(i).getStoreID() + "'," + " StoreName = '" + storeListToInsert.get(i).getStoreName() + "'," + " TestStore = 0," + " Address1 = '" + storeListToInsert.get(i).getAddress1() + "'," + " Address2 = '" + storeListToInsert.get(i).getAddress2() + "'," + " Address3 = '" + storeListToInsert.get(i).getAddress3() + "'," + " Address4 = '" + storeListToInsert.get(i).getAddress4() + "'," + " Address5 = '" + storeListToInsert.get(i).getAddress5() + "'," + " Province = '" + storeListToInsert.get(i).getProvince() + "'," + " TelNo = '" + storeListToInsert.get(i).getTelNo() + "'," + " Enabled = 1" + " ELSE " + " INSERT INTO tblPay@RetailStores ( [RetailID], [StoreID], [StoreName], [TestStore], [Address1], [Address2], [Address3], [Address4], [Address5], [Province], [TelNo] , [Enabled] ) " + " VALUES " + "('" + storeListToInsert.get(i).getRetailID() + "'," + "'" + storeListToInsert.get(i).getStoreID() + "'," + "'" + storeListToInsert.get(i).getStoreName() + "'," + "0," + "'" + storeListToInsert.get(i).getAddress1() + "'," + "'" + storeListToInsert.get(i).getAddress2() + "'," + "'" + storeListToInsert.get(i).getAddress3() + "'," + "'" + storeListToInsert.get(i).getAddress4() + "'," + "'" + storeListToInsert.get(i).getAddress5() + "'," + "'" + storeListToInsert.get(i).getProvince() + "'," + "'" + storeListToInsert.get(i).getTelNo() + "'," + "1)"); st.executeUpdate(); } con.close(); } catch (Exception ex) { nmtbatchservice.NMTBatchService2.LOG.error("Error executing Stored proc with error : " + ex.getMessage(), ex); nmtbatchservice.NMTBatchService2.mailingQueue.addToQueue(new Mail("[email protected]", "Service Email Error", "An error occurred during Store Import failed with error : " + ex.getMessage())); } } Any advise would be appreciated. Thanks

    Read the article

  • retrieving 'nulls' from website using Java URL input stream

    - by Roio
    hi all, i'm trying to read the text from a website using the Java URL input stream as follows - URL u = new URL(str); br3 = new BufferedReader(new InputStreamReader(u.openStream())); while(true) System.out.println(br3.readLine()); this seems to work fine for most websites, but for some url shortening services like linkbee, the object draws a blank. e.g. http://linkbee.com/FUAKF, i can view the source code using an explorer, however i repeatedly get nulls when i use the above code.

    Read the article

  • Cant communicate with server in java

    - by cerq
    i m trying to write server to client program but i cant communicate with server in java. Below there is code block in my main. InetAddress addr = InetAddress.getLocalHost(); ipAddress = "78.162.206.164"; ServerSocket serverSocket = new ServerSocket(0); String randomStringForPlayerName = RandomStringGenerator.generateRandomString(); baseForReqOpp += ipAddress + " " + serverSocket + " " + randomStringForPlayerName; Socket socket = new Socket(host,2050); socket.setSoTimeout(100); in = new BufferedReader(new InputStreamReader(socket.getInputStream())); out = new PrintWriter(socket.getOutputStream()); out.write(baseForReqOpp); out.flush(); System.out.println(in.read()); i know there is no problem in server code and all the ports in communication are ok. But i cant read anything from server. What can be the problem?

    Read the article

  • OBJ model loaded in LWJGL has a black area with no texture

    - by gambiting
    I have a problem with loading an .obj file in LWJGL and its textures. The object is a tree(it's a paid model from TurboSquid, so I can't post it here,but here's the link if you want to see how it should look like): http://www.turbosquid.com/FullPreview/Index.cfm/ID/701294 I wrote a custom OBJ loader using the LWJGL tutorial from their wiki. It looks like this: public class OBJLoader { public static Model loadModel(File f) throws FileNotFoundException, IOException { BufferedReader reader = new BufferedReader(new FileReader(f)); Model m = new Model(); String line; Texture currentTexture = null; while((line=reader.readLine()) != null) { if(line.startsWith("v ")) { float x = Float.valueOf(line.split(" ")[1]); float y = Float.valueOf(line.split(" ")[2]); float z = Float.valueOf(line.split(" ")[3]); m.verticies.add(new Vector3f(x,y,z)); }else if(line.startsWith("vn ")) { float x = Float.valueOf(line.split(" ")[1]); float y = Float.valueOf(line.split(" ")[2]); float z = Float.valueOf(line.split(" ")[3]); m.normals.add(new Vector3f(x,y,z)); }else if(line.startsWith("vt ")) { float x = Float.valueOf(line.split(" ")[1]); float y = Float.valueOf(line.split(" ")[2]); m.texVerticies.add(new Vector2f(x,y)); }else if(line.startsWith("f ")) { Vector3f vertexIndicies = new Vector3f(Float.valueOf(line.split(" ")[1].split("/")[0]), Float.valueOf(line.split(" ")[2].split("/")[0]), Float.valueOf(line.split(" ")[3].split("/")[0])); Vector3f textureIndicies = new Vector3f(Float.valueOf(line.split(" ")[1].split("/")[1]), Float.valueOf(line.split(" ")[2].split("/")[1]), Float.valueOf(line.split(" ")[3].split("/")[1])); Vector3f normalIndicies = new Vector3f(Float.valueOf(line.split(" ")[1].split("/")[2]), Float.valueOf(line.split(" ")[2].split("/")[2]), Float.valueOf(line.split(" ")[3].split("/")[2])); m.faces.add(new Face(vertexIndicies,textureIndicies,normalIndicies,currentTexture.getTextureID())); }else if(line.startsWith("g ")) { if(line.length()>2) { String name = line.split(" ")[1]; currentTexture = TextureLoader.getTexture("PNG", ResourceLoader.getResourceAsStream("res/" + name + ".png")); System.out.println(currentTexture.getTextureID()); } } } reader.close(); System.out.println(m.verticies.size() + " verticies"); System.out.println(m.normals.size() + " normals"); System.out.println(m.texVerticies.size() + " texture coordinates"); System.out.println(m.faces.size() + " faces"); return m; } } Then I create a display list for my model using this code: objectDisplayList = GL11.glGenLists(1); GL11.glNewList(objectDisplayList, GL11.GL_COMPILE); Model m = null; try { m = OBJLoader.loadModel(new File("res/untitled4.obj")); } catch (Exception e1) { e1.printStackTrace(); } int currentTexture=0; for(Face face: m.faces) { if(face.texture!=currentTexture) { currentTexture = face.texture; GL11.glBindTexture(GL11.GL_TEXTURE_2D, currentTexture); } GL11.glColor3f(1f, 1f, 1f); GL11.glBegin(GL11.GL_TRIANGLES); Vector3f n1 = m.normals.get((int) face.normal.x - 1); GL11.glNormal3f(n1.x, n1.y, n1.z); Vector2f t1 = m.texVerticies.get((int) face.textures.x -1); GL11.glTexCoord2f(t1.x, t1.y); Vector3f v1 = m.verticies.get((int) face.vertex.x - 1); GL11.glVertex3f(v1.x, v1.y, v1.z); Vector3f n2 = m.normals.get((int) face.normal.y - 1); GL11.glNormal3f(n2.x, n2.y, n2.z); Vector2f t2 = m.texVerticies.get((int) face.textures.y -1); GL11.glTexCoord2f(t2.x, t2.y); Vector3f v2 = m.verticies.get((int) face.vertex.y - 1); GL11.glVertex3f(v2.x, v2.y, v2.z); Vector3f n3 = m.normals.get((int) face.normal.z - 1); GL11.glNormal3f(n3.x, n3.y, n3.z); Vector2f t3 = m.texVerticies.get((int) face.textures.z -1); GL11.glTexCoord2f(t3.x, t3.y); Vector3f v3 = m.verticies.get((int) face.vertex.z - 1); GL11.glVertex3f(v3.x, v3.y, v3.z); GL11.glEnd(); } GL11.glEndList(); The currentTexture is an int - it contains the ID of the currently used texture. So my model looks absolutely fine without textures: (sorry I cannot post hyperlinks since I am a new user) i.imgur.com/VtoK0.png But look what happens if I enable GL_TEXTURE_2D: i.imgur.com/z8Kli.png i.imgur.com/5e9nn.png i.imgur.com/FAHM9.png As you can see an entire side of the tree appears to be missing - and it's not transparent, since it's not in the colour of the background - it's rendered black. It's not a problem with the model - if I load it using Kanji's OBJ loader it works fine(but the thing is,that I need to write my own OBJ loader) i.imgur.com/YDATo.png this is my OpenGL init section: //init display try { Display.setDisplayMode(new DisplayMode(Support.SCREEN_WIDTH, Support.SCREEN_HEIGHT)); Display.create(); Display.setVSyncEnabled(true); } catch (LWJGLException e) { e.printStackTrace(); System.exit(0); } GL11.glLoadIdentity(); GL11.glEnable(GL11.GL_TEXTURE_2D); GL11.glClearColor(1.0f, 0.0f, 0.0f, 1.0f); GL11.glShadeModel(GL11.GL_SMOOTH); GL11.glEnable(GL11.GL_DEPTH_TEST); GL11.glDepthFunc(GL11.GL_LESS); GL11.glDepthMask(true); GL11.glEnable(GL11.GL_NORMALIZE); GL11.glMatrixMode(GL11.GL_PROJECTION); GLU.gluPerspective (90.0f,800f/600f, 1f, 500.0f); GL11.glMatrixMode(GL11.GL_MODELVIEW); GL11.glEnable(GL11.GL_CULL_FACE); GL11.glCullFace(GL11.GL_BACK); //enable lighting GL11.glEnable(GL11.GL_LIGHTING); ByteBuffer temp = ByteBuffer.allocateDirect(16); temp.order(ByteOrder.nativeOrder()); GL11.glMaterial(GL11.GL_FRONT, GL11.GL_DIFFUSE, (FloatBuffer)temp.asFloatBuffer().put(lightDiffuse).flip()); GL11.glMaterialf(GL11.GL_FRONT, GL11.GL_SHININESS,(int)material_shinyness); GL11.glLight(GL11.GL_LIGHT2, GL11.GL_DIFFUSE, (FloatBuffer)temp.asFloatBuffer().put(lightDiffuse2).flip()); // Setup The Diffuse Light GL11.glLight(GL11.GL_LIGHT2, GL11.GL_POSITION,(FloatBuffer)temp.asFloatBuffer().put(lightPosition2).flip()); GL11.glLight(GL11.GL_LIGHT2, GL11.GL_AMBIENT,(FloatBuffer)temp.asFloatBuffer().put(lightAmbient).flip()); GL11.glLight(GL11.GL_LIGHT2, GL11.GL_SPECULAR,(FloatBuffer)temp.asFloatBuffer().put(lightDiffuse2).flip()); GL11.glLightf(GL11.GL_LIGHT2, GL11.GL_CONSTANT_ATTENUATION, 0.1f); GL11.glLightf(GL11.GL_LIGHT2, GL11.GL_LINEAR_ATTENUATION, 0.0f); GL11.glLightf(GL11.GL_LIGHT2, GL11.GL_QUADRATIC_ATTENUATION, 0.0f); GL11.glEnable(GL11.GL_LIGHT2); Could somebody please help me?

    Read the article

  • Java, server client TCP communication ends with RST

    - by Senne
    I'm trying to figure out if this is normal. Because without errors, a connection should be terminated by: FIN -> <- ACK <- FIN ACK -> I get this at the end of a TCP connection (over SSL, but i also get it with non-encrypted): From To 1494 server client TCP search-agent > 59185 [PSH, ACK] Seq=25974 Ack=49460 Win=63784 Len=50 1495 client server TCP 59185 > search-agent [ACK] Seq=49460 Ack=26024 Win=63565 Len=0 1496 client server TCP 59185 > search-agent [PSH, ACK] Seq=49460 Ack=26024 Win=63565 Len=23 1497 client server TCP 59185 > search-agent [FIN, ACK] Seq=49483 Ack=26024 Win=63565 Len=0 1498 server client TCP search-agent > 59185 [PSH, ACK] Seq=26024 Ack=49484 Win=63784 Len=23 1499 client server TCP 59185 > search-agent [RST, ACK] Seq=49484 Ack=26047 Win=0 Len=0 The client exits normally and reaches socket.close, shouldn't then the connection be shut down normally, without a reset? I can't find anything about the TCP streams of java on google... Here is my code: Server: package Security; import java.io.*; import java.net.*; import javax.net.ServerSocketFactory; import javax.net.ssl.*; import java.util.*; public class SSLDemoServer { private static ServerSocket serverSocket; private static final int PORT = 1234; public static void main(String[] args) throws IOException { int received = 0; String returned; ObjectInputStream input = null; PrintWriter output = null; Socket client; System.setProperty("javax.net.ssl.keyStore", "key.keystore"); System.setProperty("javax.net.ssl.keyStorePassword", "vwpolo"); System.setProperty("javax.net.ssl.trustStore", "key.keystore"); System.setProperty("javax.net.ssl.trustStorePassword", "vwpolo"); try { System.out.println("Trying to set up server ..."); ServerSocketFactory factory = SSLServerSocketFactory.getDefault(); serverSocket = factory.createServerSocket(PORT); System.out.println("Server started!\n"); } catch (IOException ioEx) { System.out.println("Unable to set up port!"); ioEx.printStackTrace(); System.exit(1); } while(true) { client = serverSocket.accept(); System.out.println("Client trying to connect..."); try { System.out.println("Trying to create inputstream..."); input = new ObjectInputStream(client.getInputStream()); System.out.println("Trying to create outputstream..."); output = new PrintWriter(client.getOutputStream(), true); System.out.println("Client successfully connected!"); while( true ) { received = input.readInt(); returned = Integer.toHexString(received); System.out.print(" " + received); output.println(returned.toUpperCase()); } } catch(SSLException sslEx) { System.out.println("Connection failed! (non-SSL connection?)\n"); client.close(); continue; } catch(EOFException eofEx) { System.out.println("\nEnd of client data.\n"); } catch(IOException ioEx) { System.out.println("I/O problem! (correct inputstream?)"); } try { input.close(); output.close(); } catch (Exception e) { } client.close(); System.out.println("Client closed.\n"); } } } Client: package Security; import java.io.*; import java.net.*; import javax.net.ssl.*; import java.util.*; public class SSLDemoClient { private static InetAddress host; private static final int PORT = 1234; public static void main(String[] args) { System.setProperty("javax.net.ssl.keyStore", "key.keystore"); System.setProperty("javax.net.ssl.keyStorePassword", "vwpolo"); System.setProperty("javax.net.ssl.trustStore", "key.keystore"); System.setProperty("javax.net.ssl.trustStorePassword", "vwpolo"); System.out.println("\nCreating SSL socket ..."); SSLSocket socket = null; try { host = InetAddress.getByName("192.168.56.101"); SSLSocketFactory factory = (SSLSocketFactory) SSLSocketFactory.getDefault(); socket = (SSLSocket) factory.createSocket(host, PORT); socket.startHandshake(); } catch(UnknownHostException uhEx) { System.out.println("\nHost ID not found!\n"); System.exit(1); } catch(SSLException sslEx) { System.out.println("\nHandshaking unsuccessful ..."); System.exit(1); } catch (IOException e) { e.printStackTrace(); } System.out.println("\nHandshaking succeeded ...\n"); SSLClientThread client = new SSLClientThread(socket); SSLReceiverThread receiver = new SSLReceiverThread(socket); client.start(); receiver.start(); try { client.join(); receiver.join(); System.out.println("Trying to close..."); socket.close(); } catch(InterruptedException iEx) { iEx.printStackTrace(); } catch(IOException ioEx) { ioEx.printStackTrace(); } System.out.println("\nClient finished."); } } class SSLClientThread extends Thread { private SSLSocket socket; public SSLClientThread(SSLSocket s) { socket = s; } public void run() { try { ObjectOutputStream output = new ObjectOutputStream(socket.getOutputStream()); for( int i = 1; i < 1025; i++) { output.writeInt(i); sleep(10); output.flush(); } output.flush(); sleep(1000); output.close(); } catch(IOException ioEx) { System.out.println("Socket closed or unable to open socket."); } catch(InterruptedException iEx) { iEx.printStackTrace(); } } } class SSLReceiverThread extends Thread { private SSLSocket socket; public SSLReceiverThread(SSLSocket s) { socket = s; } public void run() { String response = null; BufferedReader input = null; try { input = new BufferedReader( new InputStreamReader(socket.getInputStream())); try { response = input.readLine(); while(!response.equals(null)) { System.out.print(response + " "); response = input.readLine(); } } catch(Exception e) { System.out.println("\nEnd of server data.\n"); } input.close(); } catch(IOException ioEx) { ioEx.printStackTrace(); } } }

    Read the article

  • How to send audio data from Java Applet to Rails controller

    - by cooldude
    Hi, I have to send the audio data in byte array obtain by recording from java applet at the client side to rails server at the controller in order to save. So, what encoding parameters at the applet side be used and in what form the audio data be converted like String or byte array so that rails correctly recieve data and then I can save that data at the rails in the file. As currently the audio file made by rails controller is not playing. It is the following ERROR : LAVF_header: av_open_input_stream() failed while playing with the mplayer. Here is the Java Code: package networksocket; import java.util.logging.Level; import java.util.logging.Logger; import javax.swing.JApplet; import java.net.*; import java.io.*; import java.awt.event.*; import java.awt.*; import java.sql.*; import javax.swing.*; import javax.swing.border.*; import java.awt.*; import java.util.Properties; import javax.swing.plaf.basic.BasicSplitPaneUI.BasicHorizontalLayoutManager; import sun.awt.HorizBagLayout; import sun.awt.VerticalBagLayout; import sun.misc.BASE64Encoder; /** * * @author mukand */ public class Urlconnection extends JApplet implements ActionListener { /** * Initialization method that will be called after the applet is loaded * into the browser. */ public BufferedInputStream in; public BufferedOutputStream out; public String line; public FileOutputStream file; public int bytesread; public int toread=1024; byte b[]= new byte[toread]; public String f="FINISH"; public String match; public File fileopen; public JTextArea jTextArea; public Button refreshButton; public HttpURLConnection urlConn; public URL url; OutputStreamWriter wr; BufferedReader rd; @Override public void init() { // TODO start asynchronous download of heavy resources //textField= new TextField("START"); //getContentPane().add(textField); JPanel p = new JPanel(); jTextArea= new JTextArea(1500,1500); p.setLayout(new GridLayout(1,1, 1,1)); p.add(new JLabel("Server Details")); p.add(jTextArea); Container content = getContentPane(); content.setLayout(new GridBagLayout()); // Used to center the panel content.add(p); jTextArea.setLineWrap(true); refreshButton = new java.awt.Button("Refresh"); refreshButton.reshape(287,49,71,23); refreshButton.setFont(new Font("Dialog", Font.PLAIN, 12)); refreshButton.addActionListener(this); add(refreshButton); Properties properties = System.getProperties(); properties.put("http.proxyHost", "netmon.iitb.ac.in"); properties.put("http.proxyPort", "80"); } @Override public void actionPerformed(ActionEvent e) { try { url = new URL("http://localhost:3000/audio/audiorecieve"); urlConn = (HttpURLConnection)url.openConnection(); //String login = "mukandagarwal:rammstein$"; //String encodedLogin = new BASE64Encoder().encodeBuffer(login.getBytes()); //urlConn.setRequestProperty("Proxy-Authorization",login); urlConn.setRequestMethod("POST"); // urlConn.setRequestProperty("Content-Type", //"application/octet-stream"); //urlConn.setRequestProperty("Content-Type","audio/mpeg");//"application/x-www- form-urlencoded"); //urlConn.setRequestProperty("Content-Type","application/x-www- form-urlencoded"); //urlConn.setRequestProperty("Content-Length", "" + // Integer.toString(urlParameters.getBytes().length)); urlConn.setRequestProperty("Content-Language", "UTF-8"); urlConn.setDoOutput(true); urlConn.setDoInput(true); byte bread[]=new byte[2048]; int iread; char c; String data=URLEncoder.encode("key1", "UTF-8")+ "="; //String data="key1="; FileInputStream fileread= new FileInputStream("//home//mukand//Hellion.ogg");//Dogs.mp3");//Desktop//mausam1.mp3"); while((iread=fileread.read(bread))!=-1) { //data+=(new String()); /*for(int i=0;i<iread;i++) { //c=(char)bread[i]; System.out.println(bread[i]); }*/ data+= URLEncoder.encode(new String(bread,iread), "UTF-8");//new String(new String(bread));// // data+=new String(bread,iread); } //urlConn.setRequestProperty("Content-Length",Integer.toString(data.getBytes().length)); System.out.println(data); //data+=URLEncoder.encode("mukand", "UTF-8"); //data += "&" + URLEncoder.encode("key2", "UTF-8") + "=" + URLEncoder.encode("value2", "UTF-8"); //data="key1="; wr = new OutputStreamWriter(urlConn.getOutputStream());//urlConn.getOutputStream(); //if((iread=fileread.read(bread))!=-1) // wr.write(bread,0,iread); wr.write(data); wr.flush(); fileread.close(); jTextArea.append("Send"); // Get the response rd = new BufferedReader(new InputStreamReader(urlConn.getInputStream())); while ((line = rd.readLine()) != null) { jTextArea.append(line); } wr.close(); rd.close(); //jTextArea.append("click"); } catch (MalformedURLException ex) { Logger.getLogger(Urlconnection.class.getName()).log(Level.SEVERE, null, ex); } catch (IOException ex) { Logger.getLogger(Urlconnection.class.getName()).log(Level.SEVERE, null, ex); } } @Override public void start() { } @Override public void stop() { } @Override public void destroy() { } // TODO overwrite start(), stop() and destroy() methods } Here is the Rails controller function for recieving: def audiorecieve puts "///////////////////////////////////////******RECIEVED*******////" puts params[:key1]#+" "+params[:key2] data=params[:key1] #request.env('RAW_POST_DATA') file=File.new("audiodata.ogg", 'w') file.write(data) file.flush file.close puts "////**************DONE***********//////////////////////" end Please reply quickly

    Read the article

  • Why Java servlet can't get Paypal IPN messages everytime ?

    - by Frank
    I have a Java servlet running on my notebook with Windows Vista, I set up a static IP, did port forwarding and registered for a free DDNS service, now my servlet is running, I gave the url to Paypal to send me IPN messages, I went on to it's sandbox site got to the test tools page, tried to send test messages by clicking the "Send IPN" button, most of the time it would fail, the error is : "IPN delivery failed. Unable to connect to the specified URL. Please verify the URL and try again." But maybe 1 in 10 times, it might be successful and my servlet would get the message, and I looked at the messages I got, they are in correct format. So I called Paypal asking why, he said I shouldn't run the servlet on my notebook, in stead I should run it on the web server, but I told him my ISP doesn't support Java on their server, and since I did all the above steps, shouldn't it be the same to run the servlet on my notebook ? He said his test showed he couldn't get to my servlet, but I asked why maybe 1 in 10 times it could get through ? If there is something wrong with running it on my notebook, then 100% times it should fail, am I correct on this point ? But anyway he said that's all he could do, and I should troubleshoot it myself. The servlet looks like this : import java.io.*; import java.net.*; import javax.servlet.*; import javax.servlet.http.*; import java.util.*; public class PayPal_Servlet extends HttpServlet { static boolean Debug=true; static String PayPal_Url="https://www.paypal.com/cgi-bin/webscr",Sandbox_Url="https://www.sandbox.paypal.com/cgi-bin/webscr", Dir_License_Messages="C:/Dir_License_Messages/"; static TransparencyExample Transparency_Example; static PayPal_Message_To_License_File_Worker PayPal_message_to_license_file_worker; // Initializes the servlet. public void init(ServletConfig config) throws ServletException { super.init(config); if (!new File(Dir_License_Messages).exists()) new File(Dir_License_Messages).mkdirs(); System.gc(); } /** Processes requests for both HTTP <code>GET</code> and <code>POST</code> methods. * @param request servlet request * @param response servlet response */ protected void processRequest(HttpServletRequest request,HttpServletResponse response) throws ServletException,IOException { // Read post from PayPal system and add 'cmd' Enumeration en=request.getParameterNames(); String str="cmd=_notify-validate"; while (en.hasMoreElements()) { String paramName=(String)en.nextElement(); String paramValue=request.getParameter(paramName); str=str+"&"+paramName+"="+URLEncoder.encode(paramValue); } // Post back to PayPal system to validate // NOTE: change http: to https: in the following URL to verify using SSL (for increased security). // using HTTPS requires either Java 1.4 or greater, or Java Secure Socket Extension (JSSE) and configured for older versions. URL u=new URL(Debug?Sandbox_Url:PayPal_Url); URLConnection uc=u.openConnection(); uc.setDoOutput(true); uc.setRequestProperty("Content-Type","application/x-www-form-urlencoded"); PrintWriter pw=new PrintWriter(uc.getOutputStream()); pw.println(str); pw.close(); BufferedReader in=new BufferedReader(new InputStreamReader(uc.getInputStream())); String res=in.readLine(); in.close(); // Assign posted variables to local variables String itemName=request.getParameter("item_name"); String itemNumber=request.getParameter("item_number"); String paymentStatus=request.getParameter("payment_status"); String paymentAmount=request.getParameter("mc_gross"); String paymentCurrency=request.getParameter("mc_currency"); String txnId=request.getParameter("txn_id"); String receiverEmail=request.getParameter("receiver_email"); String payerEmail=request.getParameter("payer_email"); if (res.equals("VERIFIED")) // Check notification validation { // check that paymentStatus=Completed // check that txnId has not been previously processed // check that receiverEmail is your Primary PayPal email // check that paymentAmount/paymentCurrency are correct // process payment } else if (res.equals("INVALID")) // Log for investigation { } else // Log for error { } // =========================================================================== if (txnId!=null) { Write_File_Safe_Fast(Dir_License_Messages+txnId+".txt",new StringBuffer(str.replace("&","\n")),false); } // =========================================================================== String Message_File_List[]=Tool_Lib.Get_File_List_From_Dir(Dir_License_Messages); response.setContentType("text/html"); PrintWriter out=response.getWriter(); String title="Reading All Request Parameters",Name="",Value; out.println("<Html><Head><Title>"+title+"</Title></Head>\n<Body Bgcolor=\"#FDF5E6\">\n<H1 Align=Center>"+title+"</H1>\n"+ "<Table Border=1 Align=Center>\n"+"<Tr Bgcolor=\"#FFAD00\"><Th>Parameter Name</Th><Th>Parameter Value(s) Messages = "+Message_File_List.length+"</Th></Tr>"); Enumeration paramNames=request.getParameterNames(); while(paramNames.hasMoreElements()) { String paramName=(String)paramNames.nextElement(); out.print("<Tr><Td>"+paramName+"</Td><Td>"); String[] paramValues=request.getParameterValues(paramName); if (paramValues.length == 1) { String paramValue=paramValues[0]; if (paramValue.length() == 0) out.print("<I>No Value</I>"); else { out.println(paramValue+"</Td></Tr>"); // Out("paramName = "+paramName+" paramValue = "+paramValue); // if (paramName.startsWith("Name")) Name=paramValue; // else if (paramName.startsWith("Value")) Write_File_Safe_Fast("C:/Dir_Data/"+Name,new StringBuffer(paramValue),false); } } else { out.println("<Ul>"); for (int i=0;i<paramValues.length;i++) out.println("<Li>"+paramValues[i]); out.println("</Ul></Td</Tr>"); } } out.println("</Table>\n</Body></Html>"); } /** Handles the HTTP <code>GET</code> method. * @param request servlet request * @param response servlet response */ protected void doGet(HttpServletRequest request,HttpServletResponse response) throws ServletException,IOException { processRequest(request,response); } /** Handles the HTTP <code>POST</code> method. * @param request servlet request * @param response servlet response */ protected void doPost(HttpServletRequest request,HttpServletResponse response) throws ServletException,IOException { processRequest(request,response); } // Returns a short description of the servlet. public String getServletInfo() { return "Short description"; } // Destroys the servlet. public void destroy() { System.gc(); } public static void Write_File_Safe_Fast(String File_Path,StringBuffer Str_Buf,boolean Append) { FileOutputStream fos=null; BufferedOutputStream bos=null; try { fos=new FileOutputStream(File_Path,Append); bos=new BufferedOutputStream(fos); for (int j=0;j<Str_Buf.length();j++) bos.write(Str_Buf.charAt(j)); } catch (Exception e) { e.printStackTrace(); } finally { try { if (bos!=null) { bos.close(); bos=null; } if (fos!=null) { fos.close(); fos=null; } } catch (Exception ex) { ex.printStackTrace(); } } System.gc(); } } I use Netbean6.7 to develop the servlet, and the code was from Paypal's JSP sample code, what can I do to debug the problem ?

    Read the article

< Previous Page | 9 10 11 12 13 14 15  | Next Page >