Search Results

Search found 6030 results on 242 pages for 'exists'.

Page 130/242 | < Previous Page | 126 127 128 129 130 131 132 133 134 135 136 137  | Next Page >

  • Generate image with Drupal imagecache before using imagecache_create_path & getimagesize

    - by ozke
    Hi guys, I'm using imagecache_create_path() and getimagesize() to get the path of a imagecache-generated image and its dimensions. However, if it's the first time we access the page that image doesn't exist yet and imagecache_create_path doesn't generate it either. Here's the code: // we get the image path from a preset (always return the path even if the file doesn't exist) $small_image_path = imagecache_create_path('gallery_image_small', $image["filepath"]); // I get the image dimensions (only if the file exists already) $data_small = list($width, $height, $type, $image_attributes) = @getimagesize($small_image_path); Is there any API method to get the path AND generate the file? In other words, can I generate the image (using a preset) from PHP without showing it in the browser? Thank you in advance

    Read the article

  • Redoundant code in exception handling

    - by Nicola Leoni
    Hi, I've a recurrent problem, I don't find an elegant solution to avoid the resource cleaning code duplication: resource allocation: try { f() } catch (...) { resource cleaning code; throw; } resource cleaning code; return rc; So, I know I can do a temporary class with cleaning up destructor, but I don't really like it because it breaks the code flow and I need to give the class the reference to the all stack vars to cleanup, the same problem with a function, and I don't figure out how does not exists an elegant solution to this recurring problem.

    Read the article

  • SDL_ttf and Numbers (int)

    - by jack moore
    int score = 0; char* fixedscore=(char*)score; . . . imgTxt = TTF_RenderText_Solid( font, fixedscore, fColor ); ^^ This doesn't work - looks like fixedscore is empty or doesn't exists. int score = 0; char* fixedscore=(char*)score; . . . imgTxt = TTF_RenderText_Solid( font, "Works fine", fColor ); ^^ Works fine, but... I guess converting int to char* doesn't really work. So how do you print scores in SDL? Oh and one more thing: why is the text so ugly? Any help would be appreciated. Thanks.

    Read the article

  • How can I tell if a given hWnd is still valid?

    - by Ian P
    Please forgive my ignorance, I'm completely new when it comes to winforms programming. I'm using a third-party class that spawns an instance of Internet Explorer. This class has a property, hWnd, that returns the hWnd of the process. Later on down the line, I may want to reuse the instance of the application if it still exists, so I need to tell my helper class to attach to it. Prior to doing that, I'd like to know if the given hWnd is still valid, otherwise I'll spawn another instance. How can I do this in C# & .NET 3.5? Thanks for the help and I apologize if my winforms nomenclature is all wacky.. haha Ian

    Read the article

  • PHP: How should I move my code from dev to production?

    - by Teddy
    I have created a PHP web-application. I have 3 environments: DEV, TEST, PROD. What's a good tool / business practice for me to move my PHP web-application code from DEV to TEST to the PROD environment? Realizing that my TEST environment still only connects to my TEST database; whereas, I need to PROD environment to connect to my PROD database. So the code is mostly the same, except that I need to change my TEST code once moved into PROD to connect to the PROD database and not TEST database. I've heard of people taking down Apache in such away that it doesn't allow new connections and once all the existing connections are idle it simply brings down the web server. Then people manually copy the code and then manually update the config files of the PHP application to also point to the PROD instance. That seems terribly dangerous. Does a best practice exists?

    Read the article

  • Compute divergence of vector field using python

    - by nyvltak
    Is there a function that could be used for calculation of the divergence of the vectorial field? (in matlab http://www.mathworks.ch/help/techdoc/ref/divergence.html) I would expect it exists in numpy/scipy but I can not find it using google :(. # I need to calculate div[A * grad(F)], where F = np.array([[1,2,3,4],[5,6,7,8]]) (2D numpy ndarray) A = np.array([[1,2,3,4],[1,2,3,4]]) (2D numpy ndarray) so grad(F) is a set of 2D ndarrays # I know, I can calculate divergence like this: http://en.wikipedia.org/wiki/Divergence#Application_in_Cartesian_coordinates but do not want to reinvent the wheel. (and also I expent there is some optimized function)

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • WCF Service method syncronous/async

    - by Rafal
    Hi I have a problem withi calling WCF Service methods vs Silverlight 3. ` private bool usr_OK = false; clientService.CheckUserMailAsync(this.mailTF.Text); if (usr_OK == true) { isValidationOK = true; } else { isValidationOK = false; MessageBox.Show("User already exists.", "User registered succes!", MessageBoxButton.OK); } ` CheckUserMail should change usr_OK parameter. However it runs in other thread and it does not change the usr_OK param before IF block begins. I've tried thread.join byt the application freezed and i do not know what to do else. Please help me...how can i wait for WCF method to return param usr_OK.

    Read the article

  • Reverse a singly linked list

    - by Madhan
    I would be wondered if there exists some logic to reverse the linked list using only two pointers. The following is used to reverse the single linked list using three pointers namely p, q, r: struct node { int data; struct node *link; }; void reverse() { struct node *p = first, *q = NULL, *r; while (p != NULL) { r = q; q = p; p = p->link; q->link = r; } q = first; } Is there any other alternate to reverse the linked list? what would be the best logic to reverse a singly linked list, in terms of time complexity?

    Read the article

  • Random Number on SQL without using NewID()

    - by Angel Escobedo
    Hello I want to generate a Unique Random number with out using the follow statement : Convert(int, (CHECKSUM(NEWID()))*100000) AS [ITEM] Cause when I use joins clauses on "from" it generates double registers by using NEWID() Im using SQL Server 2000 *PD : When I use Rand() it probably repeat on probability 1 of 100000000 but this is so criticall so it have to be 0% of probability to repeat a random value generated My Query with NewID() and result on SELECT statement is duplicated (x2) My QUery without NewID() and using Rand() on SELECT statement is single (x1) but the probability of repeat the random value generated is uncertainly but exists! Thanks!

    Read the article

  • serial port close hangs in compact frame work 3.5

    - by ananda
    I have developed the application for windows mobile 5.0 and .net compact framework 2.0 sp2. This application communicates to the hardware device using serial port. This application works fine in windows mobile 5.0 based PDAs. I have handled data received event to get the data from serial port. But when I run my application on windows mobile 6.1 and .net compact framework 3.5, my application hangs on serial port close API call. There are many workarounds mentioned in the .net compact framework blog like (closing the com port on different thread, opening the port in the beginning of the application and close once application exists, polling for data instead of event handling), but nothing is working consistently.

    Read the article

  • Using a Cross Thread Boolean to Abort Thread

    - by Jon
    Possible Duplicate: Can a C# thread really cache a value and ignore changes to that value on other threads? Lets say we have this code: bool KeepGoing = true; DataInThread = new Thread(new ThreadStart(DataInThreadMethod)); DataInThread.Start(); //bla bla time goes on KeepGoing = false; private void DataInThreadMethod() { while (KeepGoing) { //Do stuff } } } Now the idea is that using the boolean is a safe way to terminate the thread however because that boolean exists on the calling thread does that cause any issue? That boolean is only used on the calling thread to stop the thread so its not like its being used elsewhere

    Read the article

  • What can I do about a SQL Server ghost FK constraint?

    - by rcook8601
    I'm having some trouble with a SQL Server 2005 database that seems like it's keeping a ghost constraint around. I've got a script that drops the constraint in question, does some work, and then re-adds the same constraint. Normally, it works fine. Now, however, it can't re-add the constraint because the database says that it already exists, even though the drop worked fine! Here are the queries I'm working with: alter table individual drop constraint INDIVIDUAL_EMP_FK ALTER TABLE INDIVIDUAL ADD CONSTRAINT INDIVIDUAL_EMP_FK FOREIGN KEY (EMPLOYEE_ID) REFERENCES EMPLOYEE After the constraint is dropped, I've made sure that the object really is gone by using the following queries: select object_id('INDIVIDUAL_EMP_FK') select * from sys.foreign_keys where name like 'individual%' Both return no results (or null), but when I try to add the query again, I get: The ALTER TABLE statement conflicted with the FOREIGN KEY constraint "INDIVIDUAL_EMP_FK". Trying to drop it gets me a message that it doesn't exist. Any ideas?

    Read the article

  • Include all imports in Air application Bundle?

    - by Carlos Barbosa
    How can I import all files and classes into my AIR bundle... it must take a note that I created first a flex project, and set it's main class as Actionscript (.as) . When I build a release all my imports (org) etc.. are not included in the .AIR installer... i have checked this by installing the app and then after show package contents, notice that the diretory structure exists but it doesn't include any of other .as used as imports... import org.papervision3d.cameras.Camera3D; import org.papervision3d.materials.BitmapFileMaterial; import org.papervision3d.materials.utils.MaterialsList; import org.papervision3d.objects.DisplayObject3D;

    Read the article

  • How do I get accurev to find a moved workspace?

    - by eric f
    I created a workspace in AccuRev under M:\EclipseWorkspaces\. The project checked out fine. Then I moved the project to C:\EclipseWorkspaces\. Now AccuRev thinks the project does not exists. This is probably because AccuRev is looking for the project on my M drive. How do I get AccuRev to find my project? I am using version 5.3. This computer is slow so I'd like to do this using the CLI. Update: I deleted the workspace in the AccuRev client.... Can I add the workspace on my C drive into my stream in AccuRev?

    Read the article

  • Routing zend request through a default controller when controller not found.

    - by Brett Pontarelli
    Below is a function defined in my Bootstrap class. I must be missing something fundamental in the way Zend does routing and dispatching. What I am trying to accomplish is simple: For any request /foo/bar/* that is not dispatchable for any reason try /index/foo/bar/. The problem I'm having is when the FooController exists I get Action "foo" does not exist. Basically, the isDispatchable is always false. public function run() { $front = Zend_Controller_Front::getInstance(); $request = $front->getRequest(); $dispatcher = $front->getDispatcher(); //$controller = $dispatcher->getControllerClass($request); if (!$dispatcher->isDispatchable($request)) { $route = new Zend_Controller_Router_Route( ':action/*', array('controller' => 'index') ); $router = $front->getRouter(); $router->addRoute('FallBack', $route); } $front->dispatch(); }

    Read the article

  • Datastore query outputting for Django form instance

    - by Jelle
    Hello! I'm using google appengine and Django. I'm using de djangoforms module and wanted to specify the form instance with the information that comes from the query below. userquery = db.GqlQuery("SELECT * FROM User WHERE googleaccount = :1", users.get_current_user()) form = forms.AccountForm(data=request.POST or None,instance=?????) I've found a snippet in a sample app that does this trick, but I can't modify it to work with the query I need. gift = User.get(db.Key.from_path(User.kind(), int(gift_id))) if gift is None: return http.HttpResponseNotFound('No gift exists with that key (%r)' % gift_id) form = RegisterForm(data=request.POST or None, instance=gift) Could anyone help me?

    Read the article

  • ruby on rails: How do I access variable data in a url parameter passed to a model?

    - by bandhunt
    I have a variable called "account_type" passed from a rails form and need to access the value in the corresponding model. I can check if :account_type exists as a symbol, but where does the stored data come into play? Is there something I need to do in the controller? This code gives an undefined method 'account_type' error. validates_format_of :name, :with => /^[a-z0-9_]+$/i, :on => :create if account_type == 2 If I use a symbol then it doesn't give an error, but a symbol will never equal 2 validates_format_of :name, :with => /^[a-z0-9_]+$/i, :on => :create if :account_type == 2 It's confusing that you can validate the format of a symbol (like :name above) when :name only seems to be a reference with nothing stored in it. Thanks!

    Read the article

  • Any form autofill for 'Developers'?

    - by Majid
    Hi all, I have looked at some autofills for Firefox. But they are not designed with the developers' needs in mind. General internet surfers will need a tool to fill in many different forms with constant values for each form. Developers need exactly the opposite, when you want to test a part of your app you'll need to fill a single (or a couple of) forms many times with different (but valid and sensible) data. So, does such a thing exist? An autofill to fill form inputs based on perhaps a class name (email, password, address, url, ...)? I strongly feel if it doesn't exist someone should roll up their sleeves and make one! I for one will put in my share if some others want to team up. But right now, I am desperately in need of one if it exists

    Read the article

  • Trying to test space in filesystem on Unix

    - by Buzkie
    I need to check if I Filesystem exists, and if it does exist there is 300 MB of space in it. What I have so far: if [ "$(df -m /opt/IBM | grep -vE '^Filesystem' | awk '{print ($3)}')" < "300" ] then echo "not enough space in the target filesystem" exit 1 fi This throws an error. I don't really know what I'm doing in shell. My highest priority is AIX but I'm trying to get it to work for HP and Sun too. Please help. -Alex

    Read the article

  • are there any tree libraries/widgets for (n)curses

    - by phatmanace
    Hi - I wondered if there were any tree libraries available for (n)curses. I'm trying to write a component that shows a tree of folders & was curious if there was a prebuilt curses component that could do this. I've checked 'core' curses as well as libraries like CDK - and I can't seem to find anything. If none exists, I'm not averse to building my own - but I can't seem to locate any decent tutorials on doing this, so any help in this regard would also be much appreciated. Thanks, Ace

    Read the article

  • Jquery - Forms Plugin, Dynamic Tabs

    - by user177874
    Hi guys, I am using JQuery UI tabs. When i create a tab using the "$("#" + target).tabs('add', url, title);" method it opens a tab and calls an ajax form correctly.. Now the problem exists when i open an identical tab containing the identical form. When the form is submitted using the forms plugin, things mess up. I am presuming this is due to multiple areas having the same div id and so the form plugin does not know which to update.. Is there a work around for this at all ??

    Read the article

  • What is the best method to write user "log files" of an android application to a file in a remote server or a table in a remote database?

    - by Samitha Chathuranga
    I am creating a multi user android application and it is connected to a php web service in a remote server and to a remote database via that web service. I want to keep a track of all the important activities done by the users. For an example if a user logged in to the app and changed his profile details and then logged out, a brief description of what he has done should be recorded(with time) somewhere. So then the admin of the system can see what the users are doing. So I think it is better to use log cat files and then flush all those data to a unique file in the server or a table in the database, when the user logs out or exists from his account. If it is appropriate How to do it?

    Read the article

  • Why is my image being displayed larger?

    - by bsh152s
    I'm trying to display an image on a splash screen and it's being stretched upon display. The image I'm trying to display is a simple bmp file. Any ideas why? In SplashWindow.xaml: <Window ... SizeToContent="WidthAndHeight"> <Grid> ... <Image Grid.Row="0" Source="{Binding SplashImage}"></Image> </Grid> </Window> In SplashViewModel.cs public ImageSource SplashImage { get { return ImageUtilities.GetImageSource(_splashImageFilenameString); } } From ImageUtilities.cs public static ImageSource GetImageSource(string imageFilename) { BitmapFrame bitmapFrame = null; if(!string.IsNullOrEmpty(imageFilename)) { if(File.Exists(imageFilename)) { bitmapFrame = BitmapFrame.Create(new Uri(imageFilename)); } else { Debug.Assert(false, "File " + imageFilename + " does not exist."); } } return bitmapFrame; }

    Read the article

  • Team Foundation Server vs. SVN and other source control systems

    - by micha12
    We are currently looking for a version control system to use in our projects. Up to now we have been using VSS, but nowadays more powerful source control systems exists like TFS, SVN, etc. We are planning to migrate our projects to Visual Studio 2010, so the first idea coming to mind is to start using TFS 2010. I have never worked with SVN and other version control systems. My question is: how good is TFS compared to other source control systems? Is it a good idea using it, or should we rather use SVN (or any other system)? Thank you.

    Read the article

< Previous Page | 126 127 128 129 130 131 132 133 134 135 136 137  | Next Page >