Search Results

Search found 6030 results on 242 pages for 'exists'.

Page 129/242 | < Previous Page | 125 126 127 128 129 130 131 132 133 134 135 136  | Next Page >

  • Scala simple dummy project.

    - by Lukasz Lew
    Currently my whole work cycle is: edit foo.scala fsc foo.scala && scala -cp . FooMain But my project is getting bigger and I would like to split files, make unit tests, etc. But I'm too lazy for reading sbt documentation and doing whatever needs to be done to get a sbt's "Makefile". Similarly for unit tests (there are so many frameworks, which to choose?) What would make my day is a simple zipped dummy project with a dummy unit tests using sbt. Do you know whether such thing exists?

    Read the article

  • IIS 6.0 - ASP Error 0126 Include file not found

    - by André
    Hello, I have a Win Sever 2003 running IIS 6.0 which has only my main website on it and now I am trying to setup a test website which currently is an exact duplicate of the main site. When accessing my main site everything works fine, and has done for a long time. If I access the test site (through 'test.' subdomain) I get this error: Active Server Pages error 'ASP 0126' Include file not found /html/shop/asp/admin/inc/incWeeklySpecialswide3.asp, line 71 The include file '/html/asp/quickfindwithSuburbs31.asp' was not found. The file actually exists, and the paths are correct. I have enabled Parent Paths, replaced the include file path to the full path (http://foo.com/html/asp -etc.), removing the ' / ' at the start of the path and changing the code from ' include ' to ' virtual '. Thanks in advance.

    Read the article

  • Is this code well-defined?

    - by Nawaz
    This code is taken from a discussion going on here. someInstance.Fun(++k).Gun(10).Sun(k).Tun(); Is this code well-defined? Is ++k Fun() evaluated before k in Sun()? What if k is user-defined type, not built-in type? And in what ways the above function calls order is different from this: eat(++k);drink(10);sleep(k); As far as I can say, in both situations, there exists a sequence point after each function call. If so, then why can't the first case is also well-defined like the second one? Section 1.9.17 of the C++ ISO standard says this about sequence points and function evaluation: When calling a function (whether or not the function is inline), there is a sequence point after the evaluation of all function arguments (if any) which takes place before execution of any expressions or statements in the function body. There is also a sequence point after the copying of a returned value and before the execution of any expressions outside the function.

    Read the article

  • Compilation error on a user control

    - by MikeP
    I'm stumped! We have a user control for managing account information. We use this particular control on two pages. On one page, everything works perfectly and meets our expectation. On the second page however we receive compilation errors stating that: "C:\WINDOWS\Microsoft.NET\Framework\v2.0.50727\Temporary ASP.NET Files\lrpcentral\0e987bea\6719c8b6\App_Web_PageThatFails.aspx.f3d462c1.oi52bvii.0.cs(172): error CS0433: The type 'xxxx_ascx' exists in both 'c:\WINDOWS\Microsoft.NET\Framework\v2.0.50727\Temporary ASP.NET Files\APPLICATIONNAME\0e987bea\6719c8b6\App_Web_xxxx.ascx.cdcab7d2.xbnvt2za.dll' and 'c:\WINDOWS\Microsoft.NET\Framework\v2.0.50727\Temporary ASP.NET Files\APPLICATIONNAME\0e987bea\6719c8b6\App_Web_eix7xllr.dll' My problem is similar to Cyril's but the "delete everything from Temp" is not an option for me, and Cyril's solution does not apply since the only variable we have is contained in the designer file, which is not deployed to our production environment (we pre-compile). After reading David's answer (here) I examined my directories for circular dependency and was unable to find any. Structure: Top Level Page that works Control Directory A Page that causes the error

    Read the article

  • Test if single linked list is circular by traversing it only once

    - by user1589754
    I am a fresher and I was asked this question in a recent interview I gave. The question was --- By traversing each element of linked list just once find if the single linked list is circular at any point. To this I answered that we will store reference of each node while traversing the list in another linked list and for every node in the list being tested we will find if the reference exists in the list I am storing the references. The interviewer said that he needs a more optimized way to solve this problem. Can anyone please tell me what would be a more optimized method to solve this problem.

    Read the article

  • Alternative design for a synonyms table?

    - by Majid
    I am working on an app which is to suggest alternative words/phrases for input text. I have doubts about what might be a good design for the synonyms table. Design considerations: number of synonyms is variable, i.e. football has one synonym (soccer), but in particular has two (particularly, specifically) if football is a synonym to soccer, the relation exists in the opposite direction as well. our goal is to query a word and find its synonyms we want to keep the table small and make adding new words easy What comes to my mind is a two column design with col a = word and col b = delimited list of synonyms Is there any better alternative? What about using two tables, one for words and the other for relations?

    Read the article

  • (N)Hibernate: deleting orphaned ternary association rows when either associated row is deleted.

    - by anthony
    I have a ternary association table created using the following mapping: <map name="Associations" table="FooToBar"> <key column="Foo_id"/> <index-many-to-many class="Bar" column="Bar_id"/> <element column="AssociationValue" /> </map> I have 3 tables, Foo, Bar, and FooToBar. When I delete a row from the Foo table, the associated row (or rows) in FooToBar is automatically deleted. This is good. When I delete a row from the Bar table, the associated row (or rows) in FooToBar remain, with a stale reference to a Bar id that no longer exists. This is bad. How can I modify my hbm.xml to remove stale FooToBar rows when deleting from the Bar table?

    Read the article

  • How can I Export a Table in Access using VBA into a specific sheet in an Excel spreadsheet?

    - by Bryan
    I have a some tables, we will call them Table1,Table2.... and I need them to be Exported into specific spreadsheets in a macro enabled Excel File (.xlsm) that already exists. So I would need to put Table1 into Sheet2, Table2 into Sheet3... and so on. I had been doing this manually by going to the export menu in Access but it is getting monotonous so I would like to automate the process. The Excel file will already have code in each spreadsheet which would need to still be intact.

    Read the article

  • g++ How to get warning on ignoring function return value

    - by ArunSaha
    lint produces some warning like: foo.c XXX Warning 534: Ignoring return value of function bar() From the lint manual 534 Ignoring return value of function 'Symbol' (compare with Location) A function that returns a value is called just for side effects as, for example, in a statement by itself or the left-hand side of a comma operator. Try: (void) function(); to call a function and ignore its return value. See also the fvr, fvo and fdr flags in §5.5 "Flag Options". I want to get this warning, if there exists any, during compilation. Is there any option in gcc/g++ to achieve this? I had turned on -Wall but that apparently did not detect this.

    Read the article

  • Generate image with Drupal imagecache before using imagecache_create_path & getimagesize

    - by ozke
    Hi guys, I'm using imagecache_create_path() and getimagesize() to get the path of a imagecache-generated image and its dimensions. However, if it's the first time we access the page that image doesn't exist yet and imagecache_create_path doesn't generate it either. Here's the code: // we get the image path from a preset (always return the path even if the file doesn't exist) $small_image_path = imagecache_create_path('gallery_image_small', $image["filepath"]); // I get the image dimensions (only if the file exists already) $data_small = list($width, $height, $type, $image_attributes) = @getimagesize($small_image_path); Is there any API method to get the path AND generate the file? In other words, can I generate the image (using a preset) from PHP without showing it in the browser? Thank you in advance

    Read the article

  • Cannot implicitly convert type System.Collection.Generic.IEnumberable

    - by Cen
    I'm receiving this error in my Linq statement --- Cannot implicitly convert type 'System.Collections.Generic.IEnumerable' to 'hcgames.ObjectClasses.ShoppingCart.ShoppingCartCartAddon'. An explicit conversion exists (are you missing a cast?) From this query ShoppingCartItems items = Cart.GetAllItems(); ShoppingCartCartAddons addons = Cart.GetAllAddons(); var stuff = from x in items select new ShoppingCartItem() { ProductID = x.ProductID, Quantity = x.Quantity, Name = x.Name, Price = x.Price, Weight = x.Weight, Addons = (from y in addons where y.ShoppingCartItemID == x.ID select y) }; I can not figure out how to cast this properly. Any suggestions? Thanks for your help!

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • [PHP.ini] Can't load mcrypt.dll dynamic library.

    - by Kel
    Hey guys, I'm trying to load this module: php_mcrypt.dll' Everything in the php.ini file is correct, see for yourself: extension_dir = "C:/PHP/5.2.13/ext" extension=php_mcrypt.dll The file exists in this path. And other modules are in there as well and are loaded successfully. It only has a problem with this particular module. I have a 64bit Windows XP, Apache 2.2, PHP 5.2.13... But i get this warning (error.log of Apache): PHP Warning: PHP Startup: Unable to load dynamic library 'C:/PHP/5.2.13/ext\php_mcrypt1.dll' - The specified module could not be found.\r\n in Unknown on line 0 PHP itself is working fine. But one of our applications needs this module and it throws me this ugly error. Why on earth does it show me two backslashes in the log file?

    Read the article

  • Design for tagging system in GAE-J

    - by tempy
    I need a simple tagging system in GAE-J. As I see it, the entity that is being tagged should have a collection of keys referring to the tags with which it's associated. A tag entity should simply contain the tag string itself, and a collection of keys pointing to the entities associated with the tag. When an entity's list of tags is altered, the system will create a new tag if the tag is unknown, and then append the entity's key to that tag's key collection. If the tag already exists, then the entity's key is simply appended to the tag's key collection. This seems relatively straight-forward and uncontroversial to me, but I would like some feedback on this design, just to be sure.

    Read the article

  • CMIS explorer webapp

    - by Nicolas Raoul
    CMIS is a recently approved standard for accessing ECM repositories. My idea is to create a repository explorer using CMIS, under the form of an open source Java/JEE Web Application. The main interest would probably be for integrators, using it as a framework on which to quickly build repository access intranet/extranet applications. Of course, if such an open source project already exists, I would rather contribute to it rather than start a competing effort. So, does such an application/framework already exist? As open source? The only one I have found so far is chemistry-opencmis-test-browser, which is intended for tests and seems really inconvenient to extend for business use (no MVC, no IoC).

    Read the article

  • Find a name in a list if the name is spelt wrong

    - by Matt
    I've got a list of names which some code checks against to see if the person exists, and if so do some stuff.. My issue is that I want to handle the case of the name being entered incorrectly.. I.e. I have a list of names Bob Frank Tom Tim John If I type in Joohn, I want it to ask me if I meant John. If I type Tm, I get asked if I meant Tim, if I say no, it asks if i meant Tom.. Etc.. Has anyone done something like this before?

    Read the article

  • Stored Procedure with ALTER TABLE

    - by psayre23
    I have a need to sync auto_increment fields between two tables in different databases on the same MySQL server. The hope was to create a stored procedure where the permissions of the admin would let the web user run ALTER TABLE [db1].[table] AUTO_INCREMENT = [num]; without giving it permissions (That just smells of SQL injection). My problem is I'm receiving errors when creating the store procedure. Is this something that is not allowed by MySQL? DROP PROCEDURE IF EXISTS sync_auto_increment; CREATE PROCEDURE set_auto_increment (tableName VARCHAR(64), inc INT) BEGIN ALTER TABLE tableName AUTO_INCREMENT = inc; END;

    Read the article

  • Cakephp - detect if unable to connect to database and recover gracefully

    - by Phantz
    I have a few sites built with Cakephp. If any of these sites lose their connection to the database for whatever reason it does not handle it well. Basically it renders itself inside itself trying to display an error over and over until the browser crashes. The rendering itself inside itself is caused by the use of requestAction from elements. What I want to know is how can I check if the database connection exists I tried this in the app_controller before filter: if(!ConnectionManager::getDataSource('default')) { die(); //this will be a message instead } but it does not seem to work. Thanks

    Read the article

  • NullReferenceException in EntityFramework, how come?

    - by Mickel
    Take a look at this query: var user = GetUser(userId); var sessionInvites = ctx.SessionInvites .Include("InvitingUser") .Include("InvitedUser") .Where(e => e.InvitedUser.UserId == user.UserId) .ToList(); var invites = sessionInvites; // Commenting out the two lines below, and it works as expected. foreach (var invite in sessionInvites) ctx.DeleteObject(invite); ctx.SaveChanges(); return invites; Now, everything here executes without any errors. The invites that exists for the user are being deleted and the invites are being returned with success. However, when I then try to navigate to either InvitingUser or InvitedUser on any of the returned invites, I get NullReferenceException. All other properties of the SessionIvites returned, works fine. How come? [EDIT] Now the weird thing is, if I comment out the lines with delete it works as expected. (Except that the entities will not get deleted :S)

    Read the article

  • C# - Problem while listing directories - DirectoryNotFoundException

    - by HoNgOuRu
    I'm getting a "DirectoryNotFoundException" error, here is the code: string directorio = "D:\MUSICA\La Trampa - El Mísero Espiral De Encanto"; DirectoryInfo dir = new DirectoryInfo(directorio); DirectoryInfo[] dirs = dir.GetDirectories(); <------------This is the line I'm having this problem. I believe it's caused when it tries to parse the tilde part of that string "Mísero". the directory "D:\MUSICA\La Trampa - El Mísero Espiral De Encanto" exists because I can see it and also have some files in it. Is there any way to send this string in correct way? Thanks

    Read the article

  • Is there a FSRef in iPhone SDK or is there something that can be FSRef's alternative?

    - by unknownthreat
    The question may sound stupid, but the thing is this: I am learning how to use a Audio Queue, and the example I've taken (aqtest) has been a nice guide for me until I recently found out that aqtest is not for iPhone. (stupid me) I served around the Internet and found out that there is no FSRef for iPhone. If possible, I want to find a way to work around FSRef thinggie. So here comes the question: can I use something else instead of FSRef that exists on the iPhone SDK? Or am I missing something?

    Read the article

  • How can I tell if a given hWnd is still valid?

    - by Ian P
    Please forgive my ignorance, I'm completely new when it comes to winforms programming. I'm using a third-party class that spawns an instance of Internet Explorer. This class has a property, hWnd, that returns the hWnd of the process. Later on down the line, I may want to reuse the instance of the application if it still exists, so I need to tell my helper class to attach to it. Prior to doing that, I'd like to know if the given hWnd is still valid, otherwise I'll spawn another instance. How can I do this in C# & .NET 3.5? Thanks for the help and I apologize if my winforms nomenclature is all wacky.. haha Ian

    Read the article

  • Useful ways for multilanguage navigation and static content on your site?

    - by vitto
    Hi, I have a big site running under Apache and PHP and in few mounths I should consider to add some different language version of it, but I'm not sure about the right way (or ways). My problem it isn't the user data, because I can use db tables with different languages (en, de, it, etc.) so I want concentrate my answer on navigation and static content. For now I can't use gettext because I don't have a dedicated server and I can't reboot it every time I want, but surely will be a future choice. So my main problems are these: In the site, I have classical XHTML elements like the menus, lists, div and various static texts in various pages (should be perferct for gettext, but I need a alternative) The other part of the sites has XHTML elements which are dynamically created via AJAX and jQuery, and here I haven't any idea of what can I do... So does exists some example I can see in some link to solve it (or some useful tecnique)?

    Read the article

  • Is it possible to programmatically talk to MSN messenger / Live messenger?

    - by Ceilingfish
    Hi chaps, I've been researching how to interact with the MSN messenger / Live messenger service programmatically and I can't find any real documentation on this. The documentation for the Live services only seem to implement in Javascript (they're here: http://dev.live.com/Messenger/) It would be possible to reverse engineer this API to obtain the web services that it is actually using, but I am guessing that they didn't provide the sources for a reason (which means that those web services aren't meant for direct access). However I can't find any other official APIs that allow programmatic access (more specifically no APIs that mention sockets, web services, or a proper programming language like Java or .Net). Does anyone know if an API like that exists?

    Read the article

  • What is the best method to write user "log files" of an android application to a file in a remote server or a table in a remote database?

    - by Samitha Chathuranga
    I am creating a multi user android application and it is connected to a php web service in a remote server and to a remote database via that web service. I want to keep a track of all the important activities done by the users. For an example if a user logged in to the app and changed his profile details and then logged out, a brief description of what he has done should be recorded(with time) somewhere. So then the admin of the system can see what the users are doing. So I think it is better to use log cat files and then flush all those data to a unique file in the server or a table in the database, when the user logs out or exists from his account. If it is appropriate How to do it?

    Read the article

< Previous Page | 125 126 127 128 129 130 131 132 133 134 135 136  | Next Page >