Search Results

Search found 3282 results on 132 pages for 'individual'.

Page 130/132 | < Previous Page | 126 127 128 129 130 131 132  | Next Page >

• Parse a text file into multiple text file

  - by Vijay Kumar Singh

  I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

  Read the article

• JSF : How to refresh required field in ajax request

  - by Tama

  Ok, here you are the core problem. The page. I have two required "input text". A command button that changes the bean value and reRenderes the "job" object. <a4j:form id="pervForm"> SURNAME:<h:inputText id="surname" label="Surname" value="#{prevManager.surname}" required="true" /> <br/> JOB:<h:inputText value="#{prevManager.job}" id="job" maxlength="10" size="10" label="#{msg.common_label_job}" required="true" /> <br/> <a4j:commandButton value="Set job to Programmer" ajaxSingle="true" reRender="job"> <a4j:actionparam name="jVal" value="Programmer" assignTo="#{prevManager.job}"/> </a4j:commandButton> <h:commandButton id="save" value="save" action="save" class="HATSBUTTON"/> </a4j:form> Here the simple manager: public class PrevManager { private String surname; private String job; public String getSurname() { return surname; } public void setSurname(String surname) { this.surname = surname; } public String getJob() { return job; } public void setJob(String job) { this.job = job; } public String save() { //do something } } Let's do this: Write something on the Job input text (such as "teacher"). Leave empty the surname. Save. Validation error appears (surname is mandatory). Press "Set job to Programmer": nothing happens. Checking the bean value, I discovered that it is correctly updated, indeed the component on the page is not updated! Well, according to the JBoss Docs I found: Ajax region is a key ajax component. It limits the part of the component tree to be processed on the server side when ajax request comes. Processing means invocation during Decode, Validation and Model Update phase. Most common reasons to use a region are: -avoiding the aborting of the JSF lifecycle processing during the validation of other form input unnecessary for given ajax request; -defining the different strategies when events will be delivered (immediate="true/false") -showing an individual indicator of an ajax status -increasing the performance of the rendering processing (selfRendered="true/false", renderRegionOnly="true/false") The following two examples show the situation when a validation error does not allow to process an ajax input. Type the name. The outputText component should reappear after you. However, in the first case, this activity will be aborted because of the other field with required="true". You will see only the error message while the "Job" field is empty. Here you are the example: <ui:composition xmlns="http://www.w3.org/1999/xhtml" xmlns:ui="http://java.sun.com/jsf/facelets" xmlns:h="http://java.sun.com/jsf/html" xmlns:f="http://java.sun.com/jsf/core" xmlns:a4j="http://richfaces.org/a4j" xmlns:rich="http://richfaces.org/rich"> <style> .outergridvalidationcolumn { padding: 0px 30px 10px 0px; } </style> <a4j:outputPanel ajaxRendered="true"> <h:messages style="color:red" /> </a4j:outputPanel> <h:panelGrid columns="2" columnClasses="outergridvalidationcolumn"> <h:form id="form1"> <h:panelGrid columns="2"> <h:outputText value="Name" /> <h:inputText value="#{userBean.name}"> <a4j:support event="onkeyup" reRender="outname" /> </h:inputText> <h:outputText value="Job" /> <h:inputText required="true" id="job2" value="#{userBean.job}" /> </h:panelGrid> </h:form> <h:form id="form2"> <h:panelGrid columns="2"> <h:outputText value="Name" /> <a4j:region> <h:inputText value="#{userBean.name}"> <a4j:support event="onkeyup" reRender="outname" /> </h:inputText> </a4j:region> <h:outputText value="Job" /> <h:inputText required="true" id="job1" value="#{userBean.job}" /> </h:panelGrid> </h:form> </h:panelGrid> <h:outputText id="outname" style="font-weight:bold" value="Typed Name: #{userBean.name}" /> <br /> </ui:composition> Form1: the behaviour is incorrect. I need to fill the job and then the name. Form2: the behaviour is correct. I do not need to fill the job to see the correct value. Unfortunately using Ajax region does not help (indeed I used it in a bad way ...) because my fields are both REQUIRED. That's the main different. Any idea? Many thanks.

  Read the article

• Content Being Echoed Below Footer in Category Post Template

  - by poindexter

  I have created a category template in Wordpress for all posts that are in the 'blog' category. The file name is single-blog.php. There is some conditional code in single.php that checks whether the post is in the 'blog' category and if it is it redirects it to single-blog.php. That seems to be working fine. The problem is that on all the individual 'blog' categorized posts the post title and content are echoed below the footer of the page. I do not know why they are showing up and I haven't been able to stop it or hide it. The Loop is getting closed on the template page, but I'm wondering if the Loop from single.php is somehow also being sent over. You can view an example of the problem here: http://69.20.59.228/2010/03/test-blog-post/ Please let me know if you have any suggestions. I am posting two sections of code below. The first is the conditional call in single.php. The second is the code from the single-blog.php (the category post template). the conditional call in single.php. <?php $post = $wp_query->post; if (in_category('blog')) { include(TEMPLATEPATH.'/single-blog.php'); }?> code from the single-blog.php (the category post template) <?php get_header(); ?> <?php get_sidebar(); ?> <p><h2>The IQNavigator Blog</h2></p> <em><a href="/category/blog">Blog Home</a></em> | <em><a href="/category/blog/feed/">Subscribe via RSS</a></em><p><br></br></p> <?php if (have_posts()) : while (have_posts()) : the_post(); ?> <div <?php post_class() ?> id="post-<?php the_ID(); ?>"> <h1 class="pagetitle"><?php the_title(); ?></h1> <!-- <p class="details">Posted <?php the_time('l, F jS, Y') ?> at <?php the_time() ?></p> --> <div class="entry"> <?php the_content('<p class="serif">Read the rest of this entry &raquo;</p>'); ?> <?php wp_link_pages(array('before' => '<p><strong>Pages:</strong> ', 'after' => '</p>', 'next_or_number' => 'number')); ?> <?php the_tags( '<p>Tags: ', ', ', '</p>'); ?> <p class="postmetadata alt"> <small> -----<br> Posted <?php /* This is commented, because it requires a little adjusting sometimes. You'll need to download this plugin, and follow the instructions: http://binarybonsai.com/wordpress/time-since/ */ /* $entry_datetime = abs(strtotime($post->post_date) - (60*120)); echo time_since($entry_datetime); echo ' ago'; */ ?> on <?php the_time('l, F jS, Y') ?>, filed under <?php the_category(', ') ?>. Follow any responses to this entry through the <?php post_comments_feed_link('RSS'); ?> feed. <?php if ( comments_open() && pings_open() ) { // Both Comments and Pings are open ?> <a href="#respond">Leave your own comment</a>, or <a href="<?php trackback_url(); ?>" rel="trackback">trackback</a> from your own site. <?php } elseif ( !comments_open() && pings_open() ) { // Only Pings are Open ?> Responses are currently closed, but you can <a href="<?php trackback_url(); ?> " rel="trackback">trackback</a> from your own site. <?php } elseif ( comments_open() && !pings_open() ) { // Comments are open, Pings are not ?> You can skip to the end and leave a response. Pinging is currently not allowed. <?php } elseif ( !comments_open() && !pings_open() ) { // Neither Comments, nor Pings are open ?> Both comments and pings are currently closed. <?php } edit_post_link('Edit this entry','','.'); ?> </small> </p> <?php the_tags( '<p>Tagged: ', ', ', '</p>'); ?> </div> </div> <?php comments_template(); ?> <?php endwhile; else: ?> <p>Sorry, no posts matched your criteria.</p> <?php endif; ?> <?php get_footer(); ?>

  Read the article

• Navbar Dropdown in Bootstrap 3

  - by user2333842

  I recently started learning and using Bootstrap 3. I figured I would start with something simple- a header and a dropdown bar. I used the code from the Bootstrap website. I started out with the basic Bootstrap template, then added the bootstrap navbar. This is my code so far. <!DOCTYPE html> <html> <head> <title>WEBSITE NAME</title> <meta name="viewport" content="width=device-width, initial-scale=1.0"> <!-- Bootstrap --> <link href="css/bootstrap.min.css" rel="stylesheet" media="screen"> <!-- HTML5 shim and Respond.js IE8 support of HTML5 elements and media queries --> <!--[if lt IE 9]> <script src="../../assets/js/html5shiv.js"></script> <script src="../../assets/js/respond.min.js"></script> <![endif]--> </head> <body> <h1>WEBSITE NAME</h1> <nav class="navbar navbar-default" role="navigation"> <!-- Brand and toggle get grouped for better mobile display --> <div class="navbar-header"> <button type="button" class="navbar-toggle" data-toggle="collapse" data-target=".navbar-ex1-collapse"> <span class="sr-only">Toggle navigation</span> <span class="icon-bar"></span> <span class="icon-bar"></span> <span class="icon-bar"></span> </button> </div> <!-- Collect the nav links, forms, and other content for toggling --> <div class="collapse navbar-collapse navbar-ex1-collapse"> <ul class="nav navbar-nav"> <li class="active"><a href="#">Home</a></li> <li><a href="#">Tutorials</a></li> <li><a href="#">Software</a></li> <li class="dropdown"> <a href="#" class="dropdown-toggle" data-toggle="dropdown">Dropdown <b class="caret"></b></a> <ul class="dropdown-menu"> <li><a href="#">Action</a></li> <li><a href="#">Another action</a></li> <li><a href="#">Something else here</a></li> <li><a href="#">Separated link</a></li> <li><a href="#">One more separated link</a></li> </ul> </li> </ul> <form class="navbar-form navbar-left" role="search"> <div class="form-group"> <input type="text" class="form-control" placeholder="Search"> </div> <button type="submit" class="btn btn-default">Submit</button> </form> <ul class="nav navbar-nav navbar-right"> <li><a href="https://twitter.com/"><span class="glyphicon glyphicon-comment"></span> Twitter</a></li> <li><a href="https://youtube.com/"><span class="glyphicon glyphicon-facetime-video"></span> YouTube</a></li> </ul> </li> </ul> </div><!-- /.navbar-collapse --> </nav> <!-- jQuery (necessary for Bootstrap's JavaScript plugins) --> <script src="//code.jquery.com/jquery.js"></script> <!-- Include all compiled plugins (below), or include individual files as needed --> <script src="js/bootstrap.min.js"></script> </body> </html> The dropdown menu is absolutely not working at all- hovering or clicking it. What do I need to do?

  Read the article

• high tweet status IDs causing failed to open stream errors?

  - by escarp

  Erg. Starting in the past few days high tweet IDs (at least, it appears it's ID related, but I suppose it could be some recent change in the api returns) are breaking my code. At first I tried passing the ID as a string instead of an integer to this function, and I thought this worked, but in reality it was just the process of uploading the file from my end. In short, a php script generates these function calls, and when it does so, they fail. If I download the php file the call is generated into, delete the server copy and re-upload the exact same file without changing it, it works fine. Does anyone know what could be causing this behavior? Below is what I suspect to be the most important part of the individual files that are pulling the errors. Each of the files is named for a status ID (e.g. the below file is named 12058543656.php) <?php require "singlePost.php"; SinglePost(12058543656) ?> Here's the code that writes the above files: $postFileName = $single_post_id.".php"; if(!file_exists($postFileName)){ $created_at_full = date("l, F jS, Y", strtotime($postRow[postdate])-(18000)); $postFileHandle = fopen($postFileName, 'w+'); fwrite($postFileHandle, '<html> <head> <title><?php $thisTITLE = "escarp | A brief poem or short story by '.$authorname.' on '.$created_at_full.'"; echo $thisTITLE;?></title><META NAME="Description" CONTENT="This brief poem or short story, by '.$authorname.', was published on '.$created_at_full.'"> <?php include("head.php");?> To receive other poems or short stories like this one from <a href=http://twitter.com/escarp>escarp</a> on your cellphone, <a href=http://twitter.com/signup>create</a> and/or <a href=http://twitter.com/devices>associate</a> a Twitter account with your cellphone</a>, follow <a href=http://twitter.com/escarp>us</a>, and turn device updates on. <pre><?php require "singlePost.php"; SinglePost("'.$single_post_id.'") ?> </div></div></pre><?php include("foot.php");?> </body> </html>'); fclose($postFileHandle);} $postcounter++; } I can post more if you don't see anything here, but there are several files involved and I'm trying to avoid dumping tons of irrelevant code. Error: Warning: include(head.php) [function.include]: failed to open stream: No such file or directory in /f2/escarp/public/12177797583.php on line 4 Warning: include(head.php) [function.include]: failed to open stream: No such file or directory in /f2/escarp/public/12177797583.php on line 4 Warning: include() [function.include]: Failed opening 'head.php' for inclusion (include_path='.:/nfsn/apps/php5/lib/php/:/nfsn/apps/php/lib/php/') in /f2/escarp/public/12177797583.php on line 4 To receive other poems or short stories like this one from escarp on your cellphone, create and/or associate a Twitter account with your cellphone, follow us, and turn device updates on. Warning: require(singlePost.php) [function.require]: failed to open stream: No such file or directory in /f2/escarp/public/12177797583.php on line 7 Warning: require(singlePost.php) [function.require]: failed to open stream: No such file or directory in /f2/escarp/public/12177797583.php on line 7 Fatal error: require() [function.require]: Failed opening required 'singlePost.php' (include_path='.:/nfsn/apps/php5/lib/php/:/nfsn/apps/php/lib/php/') in /f2/escarp/public/12177797583.php on line 7 <?php function SinglePost($statusID) { require "nicetime.php"; $db = sqlite_open("db.escarp"); $updates = sqlite_query($db, "SELECT * FROM posts WHERE postID = '$statusID'"); $row = sqlite_fetch_array($updates, SQLITE_ASSOC); $id = $row[authorID]; $result = sqlite_query($db, "SELECT * FROM authors WHERE authorID = '$id'"); $row5 = sqlite_fetch_array($result, SQLITE_ASSOC); $created_at_full = date("l, F jS, Y", strtotime($row[postdate])-(18000)); $created_at = nicetime($row[postdate]); if($row5[url]==""){ $authorurl = ''; } else{ /*I'm omitting a few pages of output code and associated regex*/ return; } ?>

  Read the article

• Varnish default.vcl grace period

  - by Vladimir

  These are my settings for a grace period (/etc/varnish/default.vcl) sub vcl_recv { .... set req.grace = 360000s; ... } sub vcl_fetch { ... set beresp.grace = 360000s; ... } I tested Varnish using localhost and nodejs as a server. I started localhost, the site was up. Then I disconnected server and the site got disconnected in less than 2 min. It says: Error 503 Service Unavailable Service Unavailable Guru Meditation: XID: 1890127100 Varnish cache server Could you tell me what could be the problem? sub vcl_fetch { if (beresp.ttl < 120s) { ##std.log("Adjusting TTL"); set beresp.ttl = 36000s; ##120s; } # Do not cache the object if the backend application does not want us to. if (beresp.http.Cache-Control ~ "(no-cache|no-store|private|must-revalidate)") { return(hit_for_pass); } # Do not cache the object if the status is not in the 200s if (beresp.status >= 300) { # Remove the Set-Cookie header #remove beresp.http.Set-Cookie; return(hit_for_pass); } # # Everything below here should be cached # # Remove the Set-Cookie header ####remove beresp.http.Set-Cookie; # Set the grace time ## set beresp.grace = 1s; //change this to minutes in case of app shutdown set beresp.grace = 360000s; ## 10 hour - reduce if it has negative impact # Static assets - browser caches tpiphem for a long time. if (req.url ~ "\.(css|js|.js|jpg|jpeg|gif|ico|png)\??\d*$") { /* Remove Expires from backend, it's not long enough */ unset beresp.http.expires; /* Set the clients TTL on this object */ set beresp.http.cache-control = "public, max-age=31536000"; /* marker for vcl_deliver to reset Age: */ set beresp.http.magicmarker = "1"; } else { set beresp.http.Cache-Control = "private, max-age=0, must-revalidate"; set beresp.http.Pragma = "no-cache"; } if (req.url ~ "\.(css|js|min|)\??\d*$") { set beresp.do_gzip = true; unset beresp.http.expires; set beresp.http.cache-control = "public, max-age=31536000"; set beresp.http.expires = beresp.ttl; set beresp.http.age = "0"; } ##do not duplicate these settings if (req.url ~ ".css") { set beresp.do_gzip = true; unset beresp.http.expires; set beresp.http.cache-control = "public, max-age=31536000"; set beresp.http.expires = beresp.ttl; set beresp.http.age = "0"; } if (req.url ~ ".js") { set beresp.do_gzip = true; unset beresp.http.expires; set beresp.http.cache-control = "public, max-age=31536000"; set beresp.http.expires = beresp.ttl; set beresp.http.age = "0"; } if (req.url ~ ".min") { set beresp.do_gzip = true; unset beresp.http.expires; set beresp.http.cache-control = "public, max-age=31536000"; set beresp.http.expires = beresp.ttl; set beresp.http.age = "0"; } ## If the request to the backend returns a code other than 200, restart the loop ## If the number of restarts reaches the value of the parameter max_restarts, ## the request will be error'ed. max_restarts defaults to 4. This prevents ## an eternal loop in the event that, e.g., the object does not exist at all. if (beresp.status != 200 && beresp.status != 403 && beresp.status != 404) { return(restart); } if (beresp.status == 302) { return(deliver); } # Never cache posts if (req.url ~ "\/post\/" || req.url ~ "\/submit\/" || req.url ~ "\/ask\/" || req.url ~ "\/add\/") { return(hit_for_pass); } ##check this setting to ensure that it does not cause issues for browsers with no gzip if (beresp.http.content-type ~ "text") { set beresp.do_gzip = true; } if (beresp.http.Set-Cookie) { return(deliver); } ##if (req.url == "/index.html") { set beresp.do_esi = true; ##} ## check if this is needed or should be used # return(deliver); the object return(deliver); } sub vcl_recv { ##avoid leeching of images call hot_link; set req.grace = 360000s; ##2m ## if one backend is down - use another if (req.restarts == 0) { set req.backend = cache_director; ##we can specify individual VMs } else if (req.restarts == 1) { set req.backend = cache_director; } ## post calls should not be cached - add cookie for these requests if using micro-caching # Pass requests that are not GET or HEAD if (req.request != "GET" && req.request != "HEAD") { return(pass); ## return(pass) goes to backend - not cache } # Don't cache the result of a redirect if (req.http.Referer ~ "redir" || req.http.Origin ~ "jumpto") { return(pass); } # Don't cache the result of a redirect (asking for logon) if (req.http.Referer ~ "post" || req.http.Referer ~ "submit" || req.http.Referer ~ "add" || req.http.Referer ~ "ask") { return(pass); } # Never cache posts - ensure that we do not use these strings in our URLs' that need to be cached if (req.url ~ "\/post\/" || req.url ~ "\/submit\/" || req.url ~ "\/ask\/" || req.url ~ "\/add\/") { return(pass); } ## if (req.http.Authorization || req.http.Cookie) { if (req.http.Authorization) { /* Not cacheable by default */ return (pass); } # Handle compression correctly. Different browsers send different # "Accept-Encoding" headers, even though they mostly all support the same # compression mechanisms. By consolidating these compression headers into # a consistent format, we can reduce the size of the cache and get more hits. # @see: http:// varnish.projects.linpro.no/wiki/FAQ/Compression if (req.http.Accept-Encoding) { if (req.url ~ "\.(jpg|png|gif|gz|tgz|bz2|tbz|mp3|ogg|ico)$") { # No point in compressing these remove req.http.Accept-Encoding; } else if (req.http.Accept-Encoding ~ "gzip") { # If the browser supports it, we'll use gzip. set req.http.Accept-Encoding = "gzip"; } else if (req.http.Accept-Encoding ~ "deflate") { # Next, try deflate if it is supported. set req.http.Accept-Encoding = "deflate"; } else { # Unknown algorithm. Remove it and send unencoded. unset req.http.Accept-Encoding; } } # lookup graphics, css, js & ico files in the cache if (req.url ~ "\.(png|gif|jpg|jpeg|css|.js|ico)$") { return(lookup); } ##added on 0918 - check if it causes issues with user specific content if (req.request == "GET" && req.http.cookie) { return(lookup); } # Pipe requests that are non-RFC2616 or CONNECT which is weird. if (req.request != "GET" && req.request != "HEAD" && req.request != "PUT" && req.request != "POST" && req.request != "TRACE" && req.request != "OPTIONS" && req.request != "DELETE") { ##closing connection and calling pipe return(pipe); } ##purge content via localhost only if (req.request == "PURGE") { if (!client.ip ~ purge) { error 405 "Not allowed."; } return(lookup); } ## do we need this? ## return(lookup); }

  Read the article

• When spliting MP4s with ffmpeg how do I include metadata?

  - by Josh

  I have a few MP4s that i want to upload to my flickr account but they have a maximum size of 500mb as mine is only about 550 i was planing to simply split them in half then upload them, but i want to make sure all the meta data is included but it does not seem to be. I have tried each of the following with no luck, (at the end of this post i have the original and the new ffprobe outputs): ffmpeg -ss 00:00:00.00 -t 00:04:19.35 -i SANY0069.MP4 -acodec copy -vcodec copy -map_metadata 0:0 SANY0069A.MP4 ffmpeg -ss 00:00:00.00 -t 00:04:19.35 -i SANY0069.MP4 -acodec copy -vcodec copy -map_meta_data SANY0069.MP4:SANY0069A.MP4 SANY0069A.MP4 with the this one I manually produced the individual meta tags that i took from this command ffmpeg -i SANY0069A.MP4 -f ffmetadata meta.txt ffmpeg -ss 00:00:00.00 -t 00:04:19.35 -i SANY0069.MP4 -acodec copy -vcodec copy -metadata major_brand="mp42" -metadata minor_version="1" -metadata compatible_brands="mp42avc1" -metadata creation_time="2012-09-29 09:05:50" -metadata comment="SANYO DIGITAL CAMERA CA9" -metadata comment-eng="SANYO DIGITAL CAMERA CA9" SANY0069A.MP4 using the output of the former command i also tried this: ffmpeg -ss 00:00:00.00 -t 00:04:19.35 -i SANY0069.MP4 -acodec copy -vcodec copy -f ffmetadata -i meta.txt SANY0069A.MP4 Output: sample output from my first command: ffmpeg -ss 00:00:00.00 -t 00:04:19.35 -i SANY0069.MP4 -acodec copy -vcodec copy -map_metadata 0:0 SANY0069A.MP4 ffmpeg version 0.8.12, Copyright (c) 2000-2011 the FFmpeg developers built on Jun 13 2012 09:57:38 with gcc 4.6.3 20120306 (Red Hat 4.6.3-2) configuration: --prefix=/usr --bindir=/usr/bin --datadir=/usr/share/ffmpeg --incdir=/usr/include/ffmpeg --libdir=/usr/lib64 --mandir=/usr/share/man --arch=x86_64 --extra-cflags='-O2 -g -pipe -Wall -Wp,-D_FORTIFY_SOURCE=2 -fexceptions -fstack-protector --param=ssp-buffer-size=4 -m64 -mtune=generic' --enable-bzlib --enable-libcelt --enable-libdc1394 --enable-libdirac --enable-libfreetype --enable-libgsm --enable-libmp3lame --enable-libopenjpeg --enable-librtmp --enable-libschroedinger --enable-libspeex --enable-libtheora --enable-libvorbis --enable-libvpx --enable-libx264 --enable-libxvid --enable-x11grab --enable-avfilter --enable-postproc --enable-pthreads --disable-static --enable-shared --enable-gpl --disable-debug --disable-stripping --shlibdir=/usr/lib64 --enable-runtime-cpudetect libavutil 51. 9. 1 / 51. 9. 1 libavcodec 53. 8. 0 / 53. 8. 0 libavformat 53. 5. 0 / 53. 5. 0 libavdevice 53. 1. 1 / 53. 1. 1 libavfilter 2. 23. 0 / 2. 23. 0 libswscale 2. 0. 0 / 2. 0. 0 libpostproc 51. 2. 0 / 51. 2. 0 Input #0, mov,mp4,m4a,3gp,3g2,mj2, from 'SANY0069.MP4': Metadata: major_brand : mp42 minor_version : 1 compatible_brands: mp42avc1 creation_time : 2012-09-29 09:05:50 comment : SANYO DIGITAL CAMERA CA9 comment-eng : SANYO DIGITAL CAMERA CA9 Duration: 00:08:38.71, start: 0.000000, bitrate: 9142 kb/s Stream #0.0(eng): Video: h264 (Constrained Baseline), yuv420p, 1280x720 [PAR 1:1 DAR 16:9], 9007 kb/s, 29.97 fps, 29.97 tbr, 30k tbn, 59.94 tbc Metadata: creation_time : 2012-09-29 09:05:50 Stream #0.1(eng): Audio: aac, 48000 Hz, stereo, s16, 127 kb/s Metadata: creation_time : 2012-09-29 09:05:50 File 'SANY0069A.MP4' already exists. Overwrite ? [y/N] y Output #0, mp4, to 'SANY0069A.MP4': Metadata: major_brand : mp42 minor_version : 1 compatible_brands: mp42avc1 creation_time : 2012-09-29 09:05:50 comment : SANYO DIGITAL CAMERA CA9 comment-eng : SANYO DIGITAL CAMERA CA9 encoder : Lavf53.5.0 Stream #0.0(eng): Video: libx264, yuv420p, 1280x720 [PAR 1:1 DAR 16:9], q=2-31, 9007 kb/s, 30k tbn, 29.97 tbc Metadata: creation_time : 2012-09-29 09:05:50 Stream #0.1(eng): Audio: aac, 48000 Hz, stereo, 127 kb/s Metadata: creation_time : 2012-09-29 09:05:50 Stream mapping: Stream #0.0 -> #0.0 Stream #0.1 -> #0.1 Press [q] to stop, [?] for help frame= 7773 fps=4644 q=-1.0 Lsize= 289607kB time=00:04:19.35 bitrate=9147.4kbits/s video:285416kB audio:4033kB global headers:0kB muxing overhead 0.054571% and finaly, when i compare the ffprobe of the original and the first split part i get the 2 following outputs: original ffprobe version 0.8.12, Copyright (c) 2007-2011 the FFmpeg developers built on Jun 13 2012 09:57:38 with gcc 4.6.3 20120306 (Red Hat 4.6.3-2) configuration: --prefix=/usr --bindir=/usr/bin --datadir=/usr/share/ffmpeg --incdir=/usr/include/ffmpeg --libdir=/usr/lib64 --mandir=/usr/share/man --arch=x86_64 --extra-cflags='-O2 -g -pipe -Wall -Wp,-D_FORTIFY_SOURCE=2 -fexceptions -fstack-protector --param=ssp-buffer-size=4 -m64 -mtune=generic' --enable-bzlib --enable-libcelt --enable-libdc1394 --enable-libdirac --enable-libfreetype --enable-libgsm --enable-libmp3lame --enable-libopenjpeg --enable-librtmp --enable-libschroedinger --enable-libspeex --enable-libtheora --enable-libvorbis --enable-libvpx --enable-libx264 --enable-libxvid --enable-x11grab --enable-avfilter --enable-postproc --enable-pthreads --disable-static --enable-shared --enable-gpl --disable-debug --disable-stripping --shlibdir=/usr/lib64 --enable-runtime-cpudetect libavutil 51. 9. 1 / 51. 9. 1 libavcodec 53. 8. 0 / 53. 8. 0 libavformat 53. 5. 0 / 53. 5. 0 libavdevice 53. 1. 1 / 53. 1. 1 libavfilter 2. 23. 0 / 2. 23. 0 libswscale 2. 0. 0 / 2. 0. 0 libpostproc 51. 2. 0 / 51. 2. 0 Input #0, mov,mp4,m4a,3gp,3g2,mj2, from 'SANY0069.MP4': Metadata: major_brand : mp42 minor_version : 1 compatible_brands: mp42avc1 creation_time : 2012-09-29 09:05:50 comment : SANYO DIGITAL CAMERA CA9 comment-eng : SANYO DIGITAL CAMERA CA9 Duration: 00:08:38.71, start: 0.000000, bitrate: 9142 kb/s Stream #0.0(eng): Video: h264 (Constrained Baseline), yuv420p, 1280x720 [PAR 1:1 DAR 16:9], 9007 kb/s, 29.97 fps, 29.97 tbr, 30k tbn, 59.94 tbc Metadata: creation_time : 2012-09-29 09:05:50 Stream #0.1(eng): Audio: aac, 48000 Hz, stereo, s16, 127 kb/s Metadata: creation_time : 2012-09-29 09:05:50 Split ffprobe version 0.8.12, Copyright (c) 2007-2011 the FFmpeg developers built on Jun 13 2012 09:57:38 with gcc 4.6.3 20120306 (Red Hat 4.6.3-2) configuration: --prefix=/usr --bindir=/usr/bin --datadir=/usr/share/ffmpeg --incdir=/usr/include/ffmpeg --libdir=/usr/lib64 --mandir=/usr/share/man --arch=x86_64 --extra-cflags='-O2 -g -pipe -Wall -Wp,-D_FORTIFY_SOURCE=2 -fexceptions -fstack-protector --param=ssp-buffer-size=4 -m64 -mtune=generic' --enable-bzlib --enable-libcelt --enable-libdc1394 --enable-libdirac --enable-libfreetype --enable-libgsm --enable-libmp3lame --enable-libopenjpeg --enable-librtmp --enable-libschroedinger --enable-libspeex --enable-libtheora --enable-libvorbis --enable-libvpx --enable-libx264 --enable-libxvid --enable-x11grab --enable-avfilter --enable-postproc --enable-pthreads --disable-static --enable-shared --enable-gpl --disable-debug --disable-stripping --shlibdir=/usr/lib64 --enable-runtime-cpudetect libavutil 51. 9. 1 / 51. 9. 1 libavcodec 53. 8. 0 / 53. 8. 0 libavformat 53. 5. 0 / 53. 5. 0 libavdevice 53. 1. 1 / 53. 1. 1 libavfilter 2. 23. 0 / 2. 23. 0 libswscale 2. 0. 0 / 2. 0. 0 libpostproc 51. 2. 0 / 51. 2. 0 Input #0, mov,mp4,m4a,3gp,3g2,mj2, from 'SANY0069A.MP4': Metadata: major_brand : isom minor_version : 512 compatible_brands: isomiso2avc1mp41 creation_time : 1970-01-01 00:00:00 encoder : Lavf53.5.0 comment : SANYO DIGITAL CAMERA CA9 Duration: 00:04:19.37, start: 0.000000, bitrate: 9146 kb/s Stream #0.0(eng): Video: h264 (Constrained Baseline), yuv420p, 1280x720 [PAR 1:1 DAR 16:9], 9015 kb/s, 29.97 fps, 29.97 tbr, 30k tbn, 59.94 tbc Metadata: creation_time : 1970-01-01 00:00:00 Stream #0.1(eng): Audio: aac, 48000 Hz, stereo, s16, 127 kb/s Metadata: creation_time : 1970-01-01 00:00:00 I know this is incredibly long but its actually a quite simple question. I thought it would be best to provide as much detail as possible. any advice here would be great, Thanks

  Read the article

• "Can't Connect to Server" from 2nd virtual host on VPS

  - by chaoskreator

  I'm using Debian 7 Wheezy and Apache 2.2.22, and I'm setting up Virtual Hosts for a number of websites on my VPS. I've successfully configured the VirtualHost directives for one of the sites, but the second one continually gives "Problem Loading Page" in Firefox. I've run configtest and it has verified all my syntax is correct, and I've checked all the permissions. Everything on the 2nd domain is pretty much copy/pasted from the first, so I'm not sure what the issue is, as there are no entries into /var/log/apache2/error.log other than where I have reloaded the configurations: /# cat /var/log/apache2/error.log [Thu May 29 01:19:00 2014] [notice] Graceful restart requested, doing restart [Thu May 29 01:19:00 2014] [info] Init: Seeding PRNG with 656 bytes of entropy [Thu May 29 01:19:00 2014] [info] Init: Generating temporary RSA private keys (512/1024 bits) [Thu May 29 01:19:00 2014] [info] Init: Generating temporary DH parameters (512/1024 bits) [Thu May 29 01:19:00 2014] [debug] ssl_scache_shmcb.c(253): shmcb_init allocated 512000 bytes of shared memory [Thu May 29 01:19:00 2014] [debug] ssl_scache_shmcb.c(272): for 511920 bytes (512000 including header), recommending 32 subcaches, 133 indexes each [Thu May 29 01:19:00 2014] [debug] ssl_scache_shmcb.c(306): shmcb_init_memory choices follow [Thu May 29 01:19:00 2014] [debug] ssl_scache_shmcb.c(308): subcache_num = 32 [Thu May 29 01:19:00 2014] [debug] ssl_scache_shmcb.c(310): subcache_size = 15992 [Thu May 29 01:19:00 2014] [debug] ssl_scache_shmcb.c(312): subcache_data_offset = 3208 [Thu May 29 01:19:00 2014] [debug] ssl_scache_shmcb.c(314): subcache_data_size = 12784 [Thu May 29 01:19:00 2014] [debug] ssl_scache_shmcb.c(316): index_num = 133 [Thu May 29 01:19:00 2014] [info] Shared memory session cache initialised [Thu May 29 01:19:00 2014] [info] Init: Initializing (virtual) servers for SSL [Thu May 29 01:19:00 2014] [info] mod_ssl/2.2.22 compiled against Server: Apache/2.2.22, Library: OpenSSL/1.0.1e [Thu May 29 01:19:00 2014] [notice] Apache/2.2.22 (Debian) PHP/5.4.4-14+deb7u9 mod_ssl/2.2.22 OpenSSL/1.0.1e mod_perl/2.0.7 Perl/v5.14.2 configured -- resuming normal operations [Thu May 29 01:19:00 2014] [info] Server built: Mar 4 2013 22:05:16 [Thu May 29 01:19:00 2014] [debug] prefork.c(1023): AcceptMutex: sysvsem (default: sysvsem) I've ensured to enable each vhost with a2ensite {sitename.conf} with no errors there, either. Below are the contents of the configuration files... /etc/apache2/apache2.conf # Global configuration # LockFile ${APACHE_LOCK_DIR}/accept.lock PidFile ${APACHE_PID_FILE} Timeout 300 KeepAlive On MaxKeepAliveRequests 100 KeepAliveTimeout 5 ## ## Server-Pool Size Regulation (MPM specific) ## # prefork MPM # StartServers: number of server processes to start # MinSpareServers: minimum number of server processes which are kept spare # MaxSpareServers: maximum number of server processes which are kept spare # MaxClients: maximum number of server processes allowed to start # MaxRequestsPerChild: maximum number of requests a server process serves <IfModule mpm_prefork_module> StartServers 5 MinSpareServers 5 MaxSpareServers 10 MaxClients 150 MaxRequestsPerChild 0 </IfModule> # worker MPM # StartServers: initial number of server processes to start # MinSpareThreads: minimum number of worker threads which are kept spare # MaxSpareThreads: maximum number of worker threads which are kept spare # ThreadLimit: ThreadsPerChild can be changed to this maximum value during a # graceful restart. ThreadLimit can only be changed by stopping # and starting Apache. # ThreadsPerChild: constant number of worker threads in each server process # MaxClients: maximum number of simultaneous client connections # MaxRequestsPerChild: maximum number of requests a server process serves <IfModule mpm_worker_module> StartServers 2 MinSpareThreads 25 MaxSpareThreads 75 ThreadLimit 64 ThreadsPerChild 25 MaxClients 150 MaxRequestsPerChild 0 </IfModule> # event MPM # StartServers: initial number of server processes to start # MinSpareThreads: minimum number of worker threads which are kept spare # MaxSpareThreads: maximum number of worker threads which are kept spare # ThreadsPerChild: constant number of worker threads in each server process # MaxClients: maximum number of simultaneous client connections # MaxRequestsPerChild: maximum number of requests a server process serves <IfModule mpm_event_module> StartServers 2 MinSpareThreads 25 MaxSpareThreads 75 ThreadLimit 64 ThreadsPerChild 25 MaxClients 150 MaxRequestsPerChild 0 </IfModule> # These need to be set in /etc/apache2/envvars User ${APACHE_RUN_USER} Group ${APACHE_RUN_GROUP} # # AccessFileName: The name of the file to look for in each directory # for additional configuration directives. See also the AllowOverride # directive. # AccessFileName .htaccess # # The following lines prevent .htaccess and .htpasswd files from being # viewed by Web clients. # <Files ~ "^\.ht"> Order allow,deny Deny from all Satisfy all </Files> DefaultType None HostnameLookups Off ErrorLog ${APACHE_LOG_DIR}/error.log LogLevel debug # Include module configuration: Include mods-enabled/*.load Include mods-enabled/*.conf # Include list of ports to listen on and which to use for name based vhosts Include ports.conf # # The following directives define some format nicknames for use with # a CustomLog directive (see below). # If you are behind a reverse proxy, you might want to change %h into %{X-Forwarded-For}i # # LogFormat "%v:%p %h %l %u %t \"%r\" %>s %O \"%{Referer}i\" \"%{User-Agent}i\"" vhost_combined LogFormat "%h %l %u %t \"%r\" %>s %O \"%{Referer}i\" \"%{User-Agent}i\"" combined LogFormat "%h %l %u %t \"%r\" %>s %O" common LogFormat "%{Referer}i -> %U" referer LogFormat "%{User-agent}i" agent <Directory "/var/www"> Order allow,deny Allow from all Require all granted </Directory> # Include generic snippets of statements Include conf.d/ # Include the virtual host configurations: Include sites-enabled/*.conf NameVirtualHost *:80 /etc/apache2/sites-available/site1.net.conf <VirtualHost *:80> ServerName site1.net ServerAlias site1.net *.site1.net DocumentRoot "/var/www/site1" ErrorLog "/var/www/site1/logs/error.log" CustomLog "/var/www/site1/logs/access.log" vhost_combined <Directory "/var/www/site1"> Options None AllowOverride All Order allow,deny Allow from all Satisfy Any </Directory> </VirtualHost> /etc/apache2/sites-available/site2.com.conf <VirtualHost *:80> ServerName site2.com ServerAlias site2.com *.site2.com DocumentRoot "/var/www/site2" ErrorLog "/var/www/site2/logs/error.log" CustomLog "/var/www/site2/logs/access.log" vhost_combined <Directory "/var/www/site2"> Options None AllowOverride All Order allow,deny Allow from all Satisfy Any </Directory> </VirtualHost> I've also tried setting NameVirtualHost like: Listen 80 NameVirtualHost 23.88.121.82:80 NameVirtualHost 127.0.0.1:80 and the VirtualHost Directives: <VirtualHost 23.88.121.82:80> ... </VirtualHost> for both sites, but that causes the first site to fail, as well. I'm wondering if I need to set up individual IPs for each site, possibly? I have 2 more IPv4 and 3 IPv6 addresses available, if that would make a difference. Also, in the grand scheme of things, I will need to enable SSL for the first site. I've been reading that I'll need to basically just mimic the directives for listening on port 80, only on port 443, and make sure mod_ssl is enabled? EDIT: I just ran apache2 -t to test the config files that way, and got the error: apache2: bad user name ${APACHE_RUN_USER}. However, apachectl configtest returns Syntax OK. There are no other mentions of errors with the mutex anywhere else, however. I was pretty sure if there was an error with the user apache was supposed to run under, the server wouldn't start at all... EDIT 2: Restarting apache fixed the bad user name error.

  Read the article

• Why is Java EE 6 better than Spring ?

  - by arungupta

  Java EE 6 was released over 2 years ago and now there are 14 compliant application servers. In all my talks around the world, a question that is frequently asked is Why should I use Java EE 6 instead of Spring ? There are already several blogs covering that topic: Java EE wins over Spring by Bill Burke Why will I use Java EE instead of Spring in new Enterprise Java projects in 2012 ? by Kai Waehner (more discussion on TSS) Spring to Java EE migration (Part 1 and 2, 3 and 4 coming as well) by David Heffelfinger Spring to Java EE - A Migration Experience by Lincoln Baxter Migrating Spring to Java EE 6 by Bert Ertman and Paul Bakker at NLJUG Moving from Spring to Java EE 6 - The Age of Frameworks is Over at TSS Java EE vs Spring Shootout by Rohit Kelapure and Reza Rehman at JavaOne 2011 Java EE 6 and the Ewoks by Murat Yener Definite excuse to avoid Spring forever - Bert Ertman and Arun Gupta I will try to share my perspective in this blog. First of all, I'd like to start with a note: Thank you Spring framework for filling the interim gap and providing functionality that is now included in the mainstream Java EE 6 application servers. The Java EE platform has evolved over the years learning from frameworks like Spring and provides all the functionality to build an enterprise application. Thank you very much Spring framework! While Spring was revolutionary in its time and is still very popular and quite main stream in the same way Struts was circa 2003, it really is last generation's framework - some people are even calling it legacy. However my theory is "code is king". So my approach is to build/take a simple Hello World CRUD application in Java EE 6 and Spring and compare the deployable artifacts. I started looking at the official tutorial Developing a Spring Framework MVC Application Step-by-Step but it is using the older version 2.5. I wasn't able to find any updated version in the current 3.1 release. Next, I downloaded Spring Tool Suite and thought that would provide some template samples to get started. A least a quick search did not show any handy tutorials - either video or text-based. So I searched and found a link to their SVN repository at src.springframework.org/svn/spring-samples/. I tried the "mvc-basic" sample and the generated WAR file was 4.43 MB. While it was named a "basic" sample it seemed to come with 19 different libraries bundled but it was what I could find: ./WEB-INF/lib/aopalliance-1.0.jar./WEB-INF/lib/hibernate-validator-4.1.0.Final.jar./WEB-INF/lib/jcl-over-slf4j-1.6.1.jar./WEB-INF/lib/joda-time-1.6.2.jar./WEB-INF/lib/joda-time-jsptags-1.0.2.jar./WEB-INF/lib/jstl-1.2.jar./WEB-INF/lib/log4j-1.2.16.jar./WEB-INF/lib/slf4j-api-1.6.1.jar./WEB-INF/lib/slf4j-log4j12-1.6.1.jar./WEB-INF/lib/spring-aop-3.0.5.RELEASE.jar./WEB-INF/lib/spring-asm-3.0.5.RELEASE.jar./WEB-INF/lib/spring-beans-3.0.5.RELEASE.jar./WEB-INF/lib/spring-context-3.0.5.RELEASE.jar./WEB-INF/lib/spring-context-support-3.0.5.RELEASE.jar./WEB-INF/lib/spring-core-3.0.5.RELEASE.jar./WEB-INF/lib/spring-expression-3.0.5.RELEASE.jar./WEB-INF/lib/spring-web-3.0.5.RELEASE.jar./WEB-INF/lib/spring-webmvc-3.0.5.RELEASE.jar./WEB-INF/lib/validation-api-1.0.0.GA.jar And it is not even using any database! The app deployed fine on GlassFish 3.1.2 but the "@Controller Example" link did not work as it was missing the context root. With a bit of tweaking I could deploy the application and assume that the account got created because no error was displayed in the browser or server log. Next I generated the WAR for "mvc-ajax" and the 5.1 MB WAR had 20 JARs (1 removed, 2 added): ./WEB-INF/lib/aopalliance-1.0.jar./WEB-INF/lib/hibernate-validator-4.1.0.Final.jar./WEB-INF/lib/jackson-core-asl-1.6.4.jar./WEB-INF/lib/jackson-mapper-asl-1.6.4.jar./WEB-INF/lib/jcl-over-slf4j-1.6.1.jar./WEB-INF/lib/joda-time-1.6.2.jar./WEB-INF/lib/jstl-1.2.jar./WEB-INF/lib/log4j-1.2.16.jar./WEB-INF/lib/slf4j-api-1.6.1.jar./WEB-INF/lib/slf4j-log4j12-1.6.1.jar./WEB-INF/lib/spring-aop-3.0.5.RELEASE.jar./WEB-INF/lib/spring-asm-3.0.5.RELEASE.jar./WEB-INF/lib/spring-beans-3.0.5.RELEASE.jar./WEB-INF/lib/spring-context-3.0.5.RELEASE.jar./WEB-INF/lib/spring-context-support-3.0.5.RELEASE.jar./WEB-INF/lib/spring-core-3.0.5.RELEASE.jar./WEB-INF/lib/spring-expression-3.0.5.RELEASE.jar./WEB-INF/lib/spring-web-3.0.5.RELEASE.jar./WEB-INF/lib/spring-webmvc-3.0.5.RELEASE.jar./WEB-INF/lib/validation-api-1.0.0.GA.jar 2 more JARs for just doing Ajax. Anyway, deploying this application gave the following error: Caused by: java.lang.NoSuchMethodError: org.codehaus.jackson.map.SerializationConfig.<init>(Lorg/codehaus/jackson/map/ClassIntrospector;Lorg/codehaus/jackson/map/AnnotationIntrospector;Lorg/codehaus/jackson/map/introspect/VisibilityChecker;Lorg/codehaus/jackson/map/jsontype/SubtypeResolver;)V    at org.springframework.samples.mvc.ajax.json.ConversionServiceAwareObjectMapper.<init>(ConversionServiceAwareObjectMapper.java:20)    at org.springframework.samples.mvc.ajax.json.JacksonConversionServiceConfigurer.postProcessAfterInitialization(JacksonConversionServiceConfigurer.java:40)    at org.springframework.beans.factory.support.AbstractAutowireCapableBeanFactory.applyBeanPostProcessorsAfterInitialization(AbstractAutowireCapableBeanFactory.java:407) Seems like some incorrect repos in the "pom.xml". Next one is "mvc-showcase" and the 6.49 MB WAR now has 28 JARs as shown below: ./WEB-INF/lib/aopalliance-1.0.jar./WEB-INF/lib/aspectjrt-1.6.10.jar./WEB-INF/lib/commons-fileupload-1.2.2.jar./WEB-INF/lib/commons-io-2.0.1.jar./WEB-INF/lib/el-api-2.2.jar./WEB-INF/lib/hibernate-validator-4.1.0.Final.jar./WEB-INF/lib/jackson-core-asl-1.8.1.jar./WEB-INF/lib/jackson-mapper-asl-1.8.1.jar./WEB-INF/lib/javax.inject-1.jar./WEB-INF/lib/jcl-over-slf4j-1.6.1.jar./WEB-INF/lib/jdom-1.0.jar./WEB-INF/lib/joda-time-1.6.2.jar./WEB-INF/lib/jstl-api-1.2.jar./WEB-INF/lib/jstl-impl-1.2.jar./WEB-INF/lib/log4j-1.2.16.jar./WEB-INF/lib/rome-1.0.0.jar./WEB-INF/lib/slf4j-api-1.6.1.jar./WEB-INF/lib/slf4j-log4j12-1.6.1.jar./WEB-INF/lib/spring-aop-3.1.0.RELEASE.jar./WEB-INF/lib/spring-asm-3.1.0.RELEASE.jar./WEB-INF/lib/spring-beans-3.1.0.RELEASE.jar./WEB-INF/lib/spring-context-3.1.0.RELEASE.jar./WEB-INF/lib/spring-context-support-3.1.0.RELEASE.jar./WEB-INF/lib/spring-core-3.1.0.RELEASE.jar./WEB-INF/lib/spring-expression-3.1.0.RELEASE.jar./WEB-INF/lib/spring-web-3.1.0.RELEASE.jar./WEB-INF/lib/spring-webmvc-3.1.0.RELEASE.jar./WEB-INF/lib/validation-api-1.0.0.GA.jar The app at least deployed and showed results this time. But still no database! Next I tried building "jpetstore" and got the error: [ERROR] Failed to execute goal on project org.springframework.samples.jpetstore:Could not resolve dependencies for project org.springframework.samples:org.springframework.samples.jpetstore:war:1.0.0-SNAPSHOT: Failed to collect dependencies for [commons-fileupload:commons-fileupload:jar:1.2.1 (compile), org.apache.struts:com.springsource.org.apache.struts:jar:1.2.9 (compile), javax.xml.rpc:com.springsource.javax.xml.rpc:jar:1.1.0 (compile), org.apache.commons:com.springsource.org.apache.commons.dbcp:jar:1.2.2.osgi (compile), commons-io:commons-io:jar:1.3.2 (compile), hsqldb:hsqldb:jar:1.8.0.7 (compile), org.apache.tiles:tiles-core:jar:2.2.0 (compile), org.apache.tiles:tiles-jsp:jar:2.2.0 (compile), org.tuckey:urlrewritefilter:jar:3.1.0 (compile), org.springframework:spring-webmvc:jar:3.0.0.BUILD-SNAPSHOT (compile), org.springframework:spring-orm:jar:3.0.0.BUILD-SNAPSHOT (compile), org.springframework:spring-context-support:jar:3.0.0.BUILD-SNAPSHOT (compile), org.springframework.webflow:spring-js:jar:2.0.7.RELEASE (compile), org.apache.ibatis:com.springsource.com.ibatis:jar:2.3.4.726 (runtime), com.caucho:com.springsource.com.caucho:jar:3.2.1 (compile), org.apache.axis:com.springsource.org.apache.axis:jar:1.4.0 (compile), javax.wsdl:com.springsource.javax.wsdl:jar:1.6.1 (compile), javax.servlet:jstl:jar:1.2 (runtime), org.aspectj:aspectjweaver:jar:1.6.5 (compile), javax.servlet:servlet-api:jar:2.5 (provided), javax.servlet.jsp:jsp-api:jar:2.1 (provided), junit:junit:jar:4.6 (test)]: Failed to read artifact descriptor for org.springframework:spring-webmvc:jar:3.0.0.BUILD-SNAPSHOT: Could not transfer artifact org.springframework:spring-webmvc:pom:3.0.0.BUILD-SNAPSHOT from/to JBoss repository (http://repository.jboss.com/maven2): Access denied to: http://repository.jboss.com/maven2/org/springframework/spring-webmvc/3.0.0.BUILD-SNAPSHOT/spring-webmvc-3.0.0.BUILD-SNAPSHOT.pom It appears the sample is broken - maybe I was pulling from the wrong repository - would be great if someone were to point me at a good target to use here. With a 50% hit on samples in this repository, I started searching through numerous blogs, most of which have either outdated information (using XML-heavy Spring 2.5), some piece of configuration (which is a typical "feature" of Spring) is missing, or too much complexity in the sample. I finally found this blog that worked like a charm. This blog creates a trivial Spring MVC 3 application using Hibernate and MySQL. This application performs CRUD operations on a single table in a database using typical Spring technologies.  I downloaded the sample code from the blog, deployed it on GlassFish 3.1.2 and could CRUD the "person" entity. The source code for this application can be downloaded here. More details on the application statistics below. And then I built a similar CRUD application in Java EE 6 using NetBeans wizards in a couple of minutes. The source code for the application can be downloaded here and the WAR here. The Spring Source Tool Suite may also offer similar wizard-driven capabilities but this blog focus primarily on comparing the runtimes. The lack of STS tutorials was slightly disappointing as well. NetBeans however has tons of text-based and video tutorials and tons of material even by the community. One more bit on the download size of tools bundle ... NetBeans 7.1.1 "All" is 211 MB (which includes GlassFish and Tomcat) Spring Tool Suite  2.9.0 is 347 MB (~ 65% bigger) This blog is not about the tooling comparison so back to the Java EE 6 version of the application .... In order to run the Java EE version on GlassFish, copy the MySQL Connector/J to glassfish3/glassfish/domains/domain1/lib/ext directory and create a JDBC connection pool and JDBC resource as: ./bin/asadmin create-jdbc-connection-pool --datasourceclassname \\ com.mysql.jdbc.jdbc2.optional.MysqlDataSource --restype \\ javax.sql.DataSource --property \\ portNumber=3306:user=mysql:password=mysql:databaseName=mydatabase \\ myConnectionPool ./bin/asadmin create-jdbc-resource --connectionpoolid myConnectionPool jdbc/myDataSource I generated WARs for the two projects and the table below highlights some differences between them: Java EE 6 Spring WAR File Size 0.021030 MB 10.87 MB (~516x) Number of files 20 53 (> 2.5x) Bundled libraries 0 36 Total size of libraries 0 12.1 MB XML files 3 5 LoC in XML files 50 (11 + 15 + 24) 129 (27 + 46 + 16 + 11 + 19) (~ 2.5x) Total .properties files 1 Bundle.properties 2 spring.properties, log4j.properties Cold Deploy 5,339 ms 11,724 ms Second Deploy 481 ms 6,261 ms Third Deploy 528 ms 5,484 ms Fourth Deploy 484 ms 5,576 ms Runtime memory ~73 MB ~101 MB Some points worth highlighting from the table ... 516x WAR file, 10x deployment time - With 12.1 MB of libraries (for a very basic application) bundled in your application, the WAR file size and the deployment time will naturally go higher. The WAR file for Spring-based application is 516x bigger and the deployment time is double during the first deployment and ~ 10x during subsequent deployments. The Java EE 6 application is fully portable and will run on any Java EE 6 compliant application server. 36 libraries in the WAR - There are 14 Java EE 6 compliant application servers today. Each of those servers provide all the functionality like transactions, dependency injection, security, persistence, etc typically required of an enterprise or web application. There is no need to bundle 36 libraries worth 12.1 MB for a trivial CRUD application. These 14 compliant application servers provide all the functionality baked in. Now you can also deploy these libraries in the container but then you don't get the "portability" offered by Spring in that case. Does your typical Spring deployment actually do that ? 3x LoC in XML - The number of XML files is about 1.6x and the LoC is ~ 2.5x. So much XML seems circa 2003 when the Java language had no annotations. The XML files can be further reduced, e.g. faces-config.xml can be replaced without providing i18n, but I just want to compare stock applications. Memory usage - Both the applications were deployed on default GlassFish 3.1.2 installation and any additional memory consumed as part of deployment/access was attributed to the application. This is by no means scientific but at least provides an initial ballpark. This area definitely needs more investigation. Another table that compares typical Java EE 6 compliant application servers and the custom-stack created for a Spring application ... Java EE 6 Spring Web Container ? 53 MB (tcServer 2.6.3 Developer Edition) Security ? 12 MB (Spring Security 3.1.0) Persistence ? 6.3 MB (Hibernate 4.1.0, required) Dependency Injection ? 5.3 MB (Framework) Web Services ? 796 KB (Spring WS 2.0.4) Messaging ? 3.4 MB (RabbitMQ Server 2.7.1) 936 KB (Java client 936) OSGi ? 1.3 MB (Spring OSGi 1.2.1) GlassFish and WebLogic (starting at 33 MB) 83.3 MB There are differentiating factors on both the stacks. But most of the functionality like security, persistence, and dependency injection is baked in a Java EE 6 compliant application server but needs to be individually managed and patched for a Spring application. This very quickly leads to a "stack explosion". The Java EE 6 servers are tested extensively on a variety of platforms in different combinations whereas a Spring application developer is responsible for testing with different JDKs, Operating Systems, Versions, Patches, etc. Oracle has both the leading OSS lightweight server with GlassFish and the leading enterprise Java server with WebLogic Server, both Java EE 6 and both with lightweight deployment options. The Web Container offered as part of a Java EE 6 application server not only deploys your enterprise Java applications but also provide operational management, diagnostics, and mission-critical capabilities required by your applications. The Java EE 6 platform also introduced the Web Profile which is a subset of the specifications from the entire platform. It is targeted at developers of modern web applications offering a reasonably complete stack, composed of standard APIs, and is capable out-of-the-box of addressing the needs of a large class of Web applications. As your applications grow, the stack can grow to the full Java EE 6 platform. The GlassFish Server Web Profile starting at 33MB (smaller than just the non-standard tcServer) provides most of the functionality typically required by a web application. WebLogic provides battle-tested functionality for a high throughput, low latency, and enterprise grade web application. No individual managing or patching, all tested and commercially supported for you! Note that VMWare does have a server, tcServer, but it is non-standard and not even certified to the level of the standard Web Profile most customers expect these days. Customers who choose this risk proprietary lock-in since VMWare does not seem to want to formally certify with either Java EE 6 Enterprise Platform or with Java EE 6 Web Profile but of course it would be great if they were to join the community and help their customers reduce the risk of deploying on VMWare software. Some more points to help you decide choose between Java EE 6 and Spring ... Freedom to choose container - There are 14 Java EE 6 compliant application servers today, with a variety of open source and commercial offerings. A Java EE 6 application can be deployed on any of those containers. So if you deployed your application on GlassFish today and would like to scale up with your demands then you can deploy the same application to WebLogic. And because of the portability of a Java EE 6 application, you can even take it a different vendor altogether. Spring requires a runtime which could be any of these app servers as well. But why use Spring when all the required functionality is already baked into the application server itself ? Spring also has a different definition of portability where they claim to bundle all the libraries in the WAR file and move to any application server. But we saw earlier how bloated that archive could be. The equivalent features in Spring runtime offerings (mainly tcServer) are not all open source, not as mature, and often require manual assembly.  Vendor choice - The Java EE 6 platform is created using the Java Community Process where all the big players like Oracle, IBM, RedHat, and Apache are conritbuting to make the platform successful. Each application server provides the basic Java EE 6 platform compliance and has its own competitive offerings. This allows you to choose an application server for deploying your Java EE 6 applications. If you are not happy with the support or feature of one vendor then you can move your application to a different vendor because of the portability promise offered by the platform. Spring is a set of products from a single company, one price book, one support organization, one sustaining organization, one sales organization, etc. If any of those cause a customer headache, where do you go ? Java EE, backed by multiple vendors, is a safer bet for those that are risk averse. Production support - With Spring, typically you need to get support from two vendors - VMWare and the container provider. With Java EE 6, all of this is typically provided by one vendor. For example, Oracle offers commercial support from systems, operating systems, JDK, application server, and applications on top of them. VMWare certainly offers complete production support but do you really want to put all your eggs in one basket ? Do you really use tcServer ? ;-) Maintainability - With Spring, you are likely building your own distribution with multiple JAR files, integrating, patching, versioning, etc of all those components. Spring's claim is that multiple JAR files allow you to go à la carte and pick the latest versions of different components. But who is responsible for testing whether all these versions work together ? Yep, you got it, its YOU! If something does not work, who patches and maintains the JARs ? Of course, you! Commercial support for such a configuration ? On your own! The Java EE application servers manage all of this for you and provide a well-tested and commercially supported bundle. While it is always good to realize that there is something new and improved that updates and replaces older frameworks like Spring, the good news is not only does a Java EE 6 container offer what is described here, most also will let you deploy and run your Spring applications on them while you go through an upgrade to a more modern architecture. End result, you get the best of both worlds - keeping your legacy investment but moving to a more agile, lightweight world of Java EE 6. A message to the Spring lovers ... The complexity in J2EE 1.2, 1.3, and 1.4 led to the genesis of Spring but that was in 2004. This is 2012 and the name has changed to "Java EE 6" :-) There are tons of improvements in the Java EE platform to make it easy-to-use and powerful. Some examples: Adding @Stateless on a POJO makes it an EJB EJBs can be packaged in a WAR with no special packaging or deployment descriptors "web.xml" and "faces-config.xml" are optional in most of the common cases Typesafe dependency injection is now part of the Java EE platform Add @Path on a POJO allows you to publish it as a RESTful resource EJBs can be used as backing beans for Facelets-driven JSF pages providing full MVC Java EE 6 WARs are known to be kilobytes in size and deployed in milliseconds Tons of other simplifications in the platform and application servers So if you moved away from J2EE to Spring many years ago and have not looked at Java EE 6 (which has been out since Dec 2009) then you should definitely try it out. Just be at least aware of what other alternatives are available instead of restricting yourself to one stack. Here are some workshops and screencasts worth trying: screencast #37 shows how to build an end-to-end application using NetBeans screencast #36 builds the same application using Eclipse javaee-lab-feb2012.pdf is a 3-4 hours self-paced hands-on workshop that guides you to build a comprehensive Java EE 6 application using NetBeans Each city generally has a "spring cleanup" program every year. It allows you to clean up the mess from your house. For your software projects, you don't need to wait for an annual event, just get started and reduce the technical debt now! Move away from your legacy Spring-based applications to a lighter and more modern approach of building enterprise Java applications using Java EE 6. Watch this beautiful presentation that explains how to migrate from Spring -> Java EE 6: List of files in the Java EE 6 project: ./index.xhtml./META-INF./person./person/Create.xhtml./person/Edit.xhtml./person/List.xhtml./person/View.xhtml./resources./resources/css./resources/css/jsfcrud.css./template.xhtml./WEB-INF./WEB-INF/classes./WEB-INF/classes/Bundle.properties./WEB-INF/classes/META-INF./WEB-INF/classes/META-INF/persistence.xml./WEB-INF/classes/org./WEB-INF/classes/org/javaee./WEB-INF/classes/org/javaee/javaeemysql./WEB-INF/classes/org/javaee/javaeemysql/AbstractFacade.class./WEB-INF/classes/org/javaee/javaeemysql/Person.class./WEB-INF/classes/org/javaee/javaeemysql/Person_.class./WEB-INF/classes/org/javaee/javaeemysql/PersonController$1.class./WEB-INF/classes/org/javaee/javaeemysql/PersonController$PersonControllerConverter.class./WEB-INF/classes/org/javaee/javaeemysql/PersonController.class./WEB-INF/classes/org/javaee/javaeemysql/PersonFacade.class./WEB-INF/classes/org/javaee/javaeemysql/util./WEB-INF/classes/org/javaee/javaeemysql/util/JsfUtil.class./WEB-INF/classes/org/javaee/javaeemysql/util/PaginationHelper.class./WEB-INF/faces-config.xml./WEB-INF/web.xml List of files in the Spring 3.x project: ./META-INF ./META-INF/MANIFEST.MF./WEB-INF./WEB-INF/applicationContext.xml./WEB-INF/classes./WEB-INF/classes/log4j.properties./WEB-INF/classes/org./WEB-INF/classes/org/krams ./WEB-INF/classes/org/krams/tutorial ./WEB-INF/classes/org/krams/tutorial/controller ./WEB-INF/classes/org/krams/tutorial/controller/MainController.class ./WEB-INF/classes/org/krams/tutorial/domain ./WEB-INF/classes/org/krams/tutorial/domain/Person.class ./WEB-INF/classes/org/krams/tutorial/service ./WEB-INF/classes/org/krams/tutorial/service/PersonService.class ./WEB-INF/hibernate-context.xml ./WEB-INF/hibernate.cfg.xml ./WEB-INF/jsp ./WEB-INF/jsp/addedpage.jsp ./WEB-INF/jsp/addpage.jsp ./WEB-INF/jsp/deletedpage.jsp ./WEB-INF/jsp/editedpage.jsp ./WEB-INF/jsp/editpage.jsp ./WEB-INF/jsp/personspage.jsp ./WEB-INF/lib ./WEB-INF/lib/antlr-2.7.6.jar ./WEB-INF/lib/aopalliance-1.0.jar ./WEB-INF/lib/c3p0-0.9.1.2.jar ./WEB-INF/lib/cglib-nodep-2.2.jar ./WEB-INF/lib/commons-beanutils-1.8.3.jar ./WEB-INF/lib/commons-collections-3.2.1.jar ./WEB-INF/lib/commons-digester-2.1.jar ./WEB-INF/lib/commons-logging-1.1.1.jar ./WEB-INF/lib/dom4j-1.6.1.jar ./WEB-INF/lib/ejb3-persistence-1.0.2.GA.jar ./WEB-INF/lib/hibernate-annotations-3.4.0.GA.jar ./WEB-INF/lib/hibernate-commons-annotations-3.1.0.GA.jar ./WEB-INF/lib/hibernate-core-3.3.2.GA.jar ./WEB-INF/lib/javassist-3.7.ga.jar ./WEB-INF/lib/jstl-1.1.2.jar ./WEB-INF/lib/jta-1.1.jar ./WEB-INF/lib/junit-4.8.1.jar ./WEB-INF/lib/log4j-1.2.14.jar ./WEB-INF/lib/mysql-connector-java-5.1.14.jar ./WEB-INF/lib/persistence-api-1.0.jar ./WEB-INF/lib/slf4j-api-1.6.1.jar ./WEB-INF/lib/slf4j-log4j12-1.6.1.jar ./WEB-INF/lib/spring-aop-3.0.5.RELEASE.jar ./WEB-INF/lib/spring-asm-3.0.5.RELEASE.jar ./WEB-INF/lib/spring-beans-3.0.5.RELEASE.jar ./WEB-INF/lib/spring-context-3.0.5.RELEASE.jar ./WEB-INF/lib/spring-context-support-3.0.5.RELEASE.jar ./WEB-INF/lib/spring-core-3.0.5.RELEASE.jar ./WEB-INF/lib/spring-expression-3.0.5.RELEASE.jar ./WEB-INF/lib/spring-jdbc-3.0.5.RELEASE.jar ./WEB-INF/lib/spring-orm-3.0.5.RELEASE.jar ./WEB-INF/lib/spring-tx-3.0.5.RELEASE.jar ./WEB-INF/lib/spring-web-3.0.5.RELEASE.jar ./WEB-INF/lib/spring-webmvc-3.0.5.RELEASE.jar ./WEB-INF/lib/standard-1.1.2.jar ./WEB-INF/lib/xml-apis-1.0.b2.jar ./WEB-INF/spring-servlet.xml ./WEB-INF/spring.properties ./WEB-INF/web.xml So, are you excited about Java EE 6 ? Want to get started now ? Here are some resources: Java EE 6 SDK (including runtime, samples, tutorials etc) GlassFish Server Open Source Edition 3.1.2 (Community) Oracle GlassFish Server 3.1.2 (Commercial) Java EE 6 using WebLogic 12c and NetBeans (Video) Java EE 6 with NetBeans and GlassFish (Video) Java EE with Eclipse and GlassFish (Video)

  Read the article

• E-Business Suite Technology Sessions at OpenWorld 2012

  - by Max Arderius

  Oracle OpenWorld 2012 is almost here! We're looking forward to updating you on our products, strategy, and roadmaps. This year, the E-Business Suite Applications Technology Group (ATG) will participate in 25 speaker sessions, two Meet the Experts round-table discussions, five demoground booths and seven Special Interest Group meetings as guest speakers. We hope to see you at our sessions.  Please join us to hear the latest news and connect with senior ATG development staff. Here's a downloadable listing of all Applications Technology Group-related sessions with times and locations: FOCUS ON Oracle E-Business Suite - Applications Tools and Technology (PDF) General Sessions GEN8474 - Oracle E-Business Suite - Strategy, Update, and RoadmapCliff Godwin, SVP, Oracle Monday, Oct 1, 12:15 PM - 1:15 PM - Moscone West 2002/2004 In this session, hear Oracle E-Business Suite General Manager Cliff Godwin deliver an update on the Oracle E-Business Suite product line. This session covers the value delivered by the current release of Oracle E-Business Suite, the momentum, and how Oracle E-Business Suite applications integrate into Oracle’s overall applications strategy. You’ll come away with an understanding of the value Oracle E-Business Suite applications deliver now and will deliver in the future. GEN9173 - Optimize and Extend Oracle Applications - The Path to Oracle Fusion ApplicationsNadia Bendjedou, Oracle; Corre Curtice, Bhavish Madurai (CSC) Tuesday, Oct 2, 10:15 AM - 11:15 AM - Moscone West 3002/3004 One of the main objectives of this session is to help organizations build their IT roadmap for the next five years and be aligned with the Oracle Applications strategy in general and the Oracle Fusion Applications strategy in particular. Come hear about some of the common sense, practical steps you can take to optimize the performance of your Oracle Applications today and prepare your path to Oracle Fusion Applications for when your organization is ready to embrace them. Each step you take in adopting Oracle Fusion technology gets you partway to Oracle Fusion Applications. Conference Sessions CON9024 - Oracle E-Business Suite Technology: Latest Features and Roadmap Lisa Parekh, Oracle Monday, Oct 1, 10:45 AM - 11:45 AM - Moscone West 2016 This Oracle development session provides a comprehensive overview of Oracle’s product strategy for Oracle E-Business Suite technology, the capabilities and associated business benefits of recent releases, and a review of capabilities on the product roadmap. This is the cornerstone session for the Oracle E-Business Suite technology stack. Come hear about the latest new usability enhancements of the user interface; systems administration and configuration management tools; security-related updates; and tools and options for extending, customizing, and integrating Oracle E-Business Suite with other applications. CON9021 - Oracle E-Business Suite Future Directions: Deployment and System AdministrationMax Arderius, Oracle Monday, Oct 1, 3:15 PM - 4:15 PM - Moscone West 2016  What’s coming in the next major version of Oracle E-Business Suite 12? This Oracle Development session covers the latest technology stack, including the use of Oracle WebLogic Server (Oracle Fusion Middleware 11g) and Oracle Database 11g Release 2 (11.2). Topics include an architectural overview of the latest updates, installation and upgrade options, new configuration options, and new tools for hot cloning and automated “lights-out” cloning. Come learn how online patching (based on the Oracle Database 11g Release 2 Edition-Based Redefinition feature) will reduce your database patching downtimes to however long it takes to bounce your database server. CON9017 - Desktop Integration in Oracle E-Business Suite 12.1 Padmaprabodh Ambale, Gustavo Jimenez, Oracle Monday, Oct 1, 4:45 PM - 5:45 PM - Moscone West 2016 This presentation covers the latest functional enhancements in Oracle Web Applications Desktop Integrator and Oracle Report Manager, enhanced Microsoft Office support, and greater support for building custom desktop integration solutions. The session also presents tips and tricks for upgrading from Oracle Applications Desktop Integrator to Oracle Web Applications Desktop Integrator and Oracle Report Manager. CON9023 - Oracle E-Business Suite Technology Certification Primer and Roadmap Steven Chan, Oracle Tuesday, Oct 2, 10:15 AM - 11:15 AM - Moscone West 2016  Is your Oracle E-Business Suite technology stack up to date? Are you taking advantage of all the latest options and capabilities? This Oracle development session summarizes the latest certifications and roadmap for the Oracle E-Business Suite technology stack, including elements such as database releases and options, Java, Oracle Forms, Oracle Containers for J2EE, desktop operating systems, browsers, JRE releases, development and Web authoring tools, user authentication and management, business intelligence, Oracle Application Management Packs, security options, clouds, Oracle VM, and virtualization. The session also covers the most commonly asked questions about tech stack component support dates and upgrade implications. CON9028 - Minimizing Oracle E-Business Suite Maintenance DowntimesSantiago Bastidas, Elke Phelps, Oracle Tuesday, Oct 2, 11:45 AM - 12:45 PM - Moscone West 2016 This Oracle development session features a survey of the best techniques sysadmins can use to minimize patching downtimes. It starts with an architectural-level review of Oracle E-Business Suite fundamentals and then moves to a practical view of the various tools and approaches for downtimes. Topics include patching shortcuts, merging patches, distributing worker processes across multiple servers, running ADPatch in noninteractive mode, staged APPL_TOPs, shared file systems, deferring systemwide database tasks, avoiding resource bottlenecks, and more. An added bonus: hear about the upcoming Oracle E-Business Suite 12 online patching capabilities based on the groundbreaking Oracle Database 11g Release 2 Edition-Based Redefinition feature. CON9116 - Extending the Use of Oracle E-Business Suite with the Oracle Endeca PlatformOsama Elkady, Muhannad Obeidat, Oracle Tuesday, Oct 2, 11:45 AM - 12:45 PM - Moscone West 2018 The Oracle Endeca platform includes a leading unstructured data correlation and analytics engine, together with a best-in class catalog search and guided navigation solution, to improve the productivity of all types of users in your enterprise. This development session focuses on the details behind the Oracle Endeca platform’s integration into Oracle E-Business Suite. It demonstrates how easily you can extend the use of the Oracle Endeca platform into other areas of Oracle E-Business Suite and how you can bring in your own data and build new Oracle Endeca applications for Oracle E-Business Suite. CON9005 - Oracle E-Business Suite Integration Best PracticesVeshaal Singh, Oracle, Jeffrey Hand, Zebra Technologies Tuesday, Oct 2, 1:15 PM - 2:15 PM - Moscone West 2018 Oracle is investing across applications and technologies to make the application integration experience easier for customers. Today Oracle has certified Oracle E-Business Suite on Oracle Fusion Middleware 11g and provides a comprehensive set of integration technologies. Learn about Oracle’s integration offering across data- and process-centric integrations. These technologies can be used to address various application integration challenges and styles. In this session, you will get an understanding of how, when, and where you can leverage Oracle’s integration technologies to connect end-to-end business processes across your enterprise, including your Oracle Applications portfolio.  CON9026 - Latest Oracle E-Business Suite 12.1 User Interface and Usability EnhancementsPadmaprabodh Ambale, Oracle Tuesday, Oct 2, 1:15 PM - 2:15 PM - Moscone West 2016 This Oracle development session details the latest UI enhancements to Oracle Application Framework in Oracle E-Business Suite 12.1. Developers will get a detailed look at new features to enhance usability, offer more capabilities for personalization and extensions, and support the development and use of dashboards and Web services. Topics include new rich UI capabilities such as new home page features, Navigator and Favorites pull-down menus, REST interface, embedded widgets for analytics content, Oracle Application Development Framework (Oracle ADF) task flows, third-party widgets, a look-ahead list of values, inline attachments, pop-ups, personalization and extensibility enhancements, business layer extensions, Oracle ADF integration, and mobile devices. CON8805 - Planning Your Oracle E-Business Suite Upgrade from 11i to Release 12.1 and BeyondAnne Carlson, Oracle Tuesday, Oct 2, 5:00 PM - 6:00 PM - Moscone West 3002/3004 Attend this session to hear the latest Oracle E-Business Suite 12.1 upgrade planning tips from Oracle’s support, consulting, development, and IT organizations. You’ll get specific cross-product advice on how to understand the factors that affect your project’s duration, decide on your project’s scope, develop a robust testing strategy, leverage Oracle Support resources, and more. In a nutshell, this session tells you things you need to know before embarking upon your Release 12.1 upgrade project. CON9053 - Advanced Management of Oracle E-Business Suite with Oracle Enterprise ManagerAngelo Rosado, Oracle Tuesday, Oct 2, 5:00 PM - 6:00 PM - Moscone West 2016 The task of managing and monitoring Oracle E-Business Suite environments can be very challenging. Oracle Enterprise Manager is the only product on the market that is designed to monitor and manage all the different technologies that constitute Oracle E-Business Suite applications, including end user, midtier, configuration, host, and database management—to name just a few. Customers that have implemented Oracle Enterprise Manager have experienced dramatic improvements in system visibility and diagnostic capability as well as administrator productivity. The purpose of this session is to highlight the key features and benefits of Oracle Enterprise Manager and Oracle Application Management Suite for Oracle E-Business Suite. CON8809 - Oracle E-Business Suite 12.1 Upgrade Best Practices: Technical InsightIsam Alyousfi, Udayan Parvate, Oracle Wednesday, Oct 3, 10:15 AM - 11:15 AM - Moscone West 3011 This session is ideal for organizations thinking about upgrading to Oracle E-Business Suite 12.1. It covers the fundamentals of upgrading to Release 12.1, including the technology stack components and supported upgrade paths. Hear from Oracle Development about the set of best practices for patching in general and executing the Release 12.1 technical upgrade, with special considerations for minimizing your downtime. Also get to know about relatively recent upgrade resources. CON9032 - Upgrading Your Customizations of Oracle E-Business Suite 12.1Sara Woodhull, Oracle Wednesday, Oct 3, 10:15 AM - 11:15 AM - Moscone West 2016 Have you personalized Oracle Forms or Oracle Application Framework screens in Oracle E-Business Suite? Have you used mod_plsql in Release 11i? Have you extended or customized your Release 11i environment with other tools? The technical options for upgrading these customizations as part of your Oracle E-Business Suite Release 12.1 upgrade can be bewildering. Come to this Oracle development session to learn about selecting the best upgrade approach for your existing customizations. The session will help you understand customization scenarios and use cases, tools, and technologies to ensure that your Oracle E-Business Suite Release 12.1 environment fits your users’ needs closely and that any future customizations will be easy to upgrade. CON9259 - Oracle E-Business Suite Internationalization and Multilingual FeaturesMaher Al-Nubani, Oracle Wednesday, Oct 3, 10:15 AM - 11:15 AM - Moscone West 2018 Oracle E-Business Suite supports more countries, languages, and regions than ever. Come to this Oracle development session to get an overview of internationalization features and capabilities and see new Release 12 features such as calendar support for Hijra and Thai, new group separators, lightweight multilingual support (MLS) setup, new character sets such as AL32UTF, newly supported languages, Mac certifications, Oracle iSetup support for moving MLS setups, new file export options for Unicode, new MLS number spelling options, and more. CON7188 - Mobile Apps for Oracle E-Business Suite with Oracle ADF Mobile and Oracle SOA SuiteSrikant Subramaniam, Joe Huang, Veshaal Singh, Oracle Wednesday, Oct 3, 10:15 AM - 11:15 AM - Moscone West 3001 Follow your mobile customers, employees, and partners with Oracle Fusion Middleware. See how native iPhone and iPad applications can easily be built for Oracle E-Business Suite with the new Oracle ADF Mobile and Oracle SOA Suite. Using Oracle ADF Mobile, developers can quickly develop native applications for Apple iOS and other mobile platforms. The Oracle SOA Suite/Oracle ADF Mobile combination can execute business transactions on Oracle E-Business Suite. This session includes a demo in which a mobile user approves a business transaction in Oracle E-Business Suite and a demo of the tools used to build a native on-device solution. These concepts for mobile applications also apply to other Oracle applications.CON9029 - Oracle E-Business Suite Directions: Slashing Downtimes with Online PatchingKevin Hudson, Oracle Wednesday, Oct 3, 11:45 AM - 12:45 PM - Moscone West 2016 Oracle E-Business Suite will soon include online patching (based on the Oracle Database 11g Release 2 Edition-Based Redefinition feature), which will reduce your database patching downtimes to however long it takes to bounce your database server. This Oracle development session details how online patching works, with special attention to what’s happening at a database object level when database patches are applied to an Oracle E-Business Suite environment that’s still running. Come learn about the operational and system management implications for minimizing maintenance downtimes when applying database patches with this new technology and the related impact on customizations you might have built on top of Oracle E-Business Suite. CON8806 - Upgrading to Oracle E-Business Suite 12.1: Technical and Functional PanelAndrew Katz, Komori America Corporation; Sandra Vucinic, VLAD Group, Inc. ;Srini Chavali, Cummins Inc.; Amrita Mehrok, Nadia Bendjedou, Anne Carlson Oracle Wednesday, Oct 3, 1:15 PM - 2:15 PM - Moscone West 2018 In this panel discussion, Oracle experts, customers, and partners share their experiences in upgrading to the latest release of Oracle E-Business Suite, Release 12.1. The panelists cover aspects of a typical Release 12 upgrade, technical (upgrading the technical infrastructure) as well as functional (upgrading to the new financial infrastructure). Hear directly from the experts who either develop the product or support, implement, or upgrade it, and find out how to apply their lessons learned to your organization. CON9027 - Personalize and Extend Oracle E-Business Suite Applications with Rich MashupsGustavo Jimenez, Padmaprabodh Ambale, Oracle Wednesday, Oct 3, 1:15 PM - 2:15 PM - Moscone West 2016 This session covers the use of several Oracle Fusion Middleware technologies to personalize and extend your existing Oracle E-Business Suite applications. The Oracle Fusion Middleware technologies covered include Oracle Application Development Framework (Oracle ADF), Oracle WebCenter, Oracle Endeca applications, and Oracle Business Intelligence Enterprise Edition with Oracle E-Business Suite Oracle Application Framework applications. CON9036 - Advanced Oracle E-Business Suite Architectures: Maximum Availability, Security, and MoreElke Phelps, Oracle Wednesday, Oct 3, 3:30 PM - 4:30 PM - Moscone West 2016 This session includes architecture diagrams and configuration instructions for building a maximum availability architecture (MAA) that will help you design a disaster recovery solution that fits the needs of your business. Database and application high-availability features it describes include Oracle Data Guard, Oracle Real Application Clusters (Oracle RAC), Oracle Active Data Guard, load-balancing Web and forms services, parallel concurrent processing, and the use of Oracle Exalogic and Oracle Exadata to provide a highly available environment. The session also covers the latest updates to systems management tools, AutoConfig, cloud computing, virtualization, and Oracle WebLogic Server and provides sneak previews of upcoming functionality. CON9047 - Efficiently Scaling Oracle E-Business Suite on Oracle Exadata and Oracle ExalogicIsam Alyousfi, Nishit Rao, Oracle Wednesday, Oct 3, 5:00 PM - 6:00 PM - Moscone West 2016 Oracle Exadata and Oracle Exalogic are designed from the ground up with optimizations in software and hardware to deliver superfast performance for mission-critical applications such as Oracle E-Business Suite. Oracle E-Business Suite applications run three to eight times as fast on the Oracle Exadata/Oracle Exalogic platform in standard benchmark tests. Besides performance, customers benefit from simplified support, enhanced manageability, and the ability to consolidate multiple Oracle E-Business Suite instances. Attend this session to understand best practices for Oracle E-Business Suite deployment on Oracle Exalogic and Oracle Exadata through customer case studies. Learn how adopting the Exa* platform increases efficiency, simplifies scaling, and boosts performance for peak loads. CON8716 - Web Services and SOA Integration Options for Oracle E-Business SuiteRekha Ayothi, Veshaal Singh, Oracle Thursday, Oct 4, 11:15 AM - 12:15 PM - Moscone West 2016 This Oracle development session provides a deep dive into a subset of the Web services and SOA-related integration options available to Oracle E-Business Suite systems integrators. It offers a technical look at Oracle E-Business Suite Integrated SOA Gateway, Oracle SOA Suite, Oracle Application Adapters for Data Integration for Oracle E-Business Suite, and other Web services options for integrating Oracle E-Business Suite with other applications. Systems integrators and developers will get an overview of the latest integration capabilities and technologies available out of the box with Oracle E-Business Suite and possibly a sneak preview of upcoming functionality and features. CON9030 - Recommendations for Oracle E-Business Suite Performance TuningIsam Alyousfi, Samer Barakat, Oracle Thursday, Oct 4, 11:15 AM - 12:15 PM - Moscone West 2018 Need to squeeze more performance out of your existing servers? This packed Oracle development session summarizes practical tips and lessons learned from performance-tuning and benchmarking the world’s largest Oracle E-Business Suite environments. Apps sysadmins will learn concrete tips and techniques for identifying and resolving performance bottlenecks on all layers, with special attention to application- and database-tier servers. Learn about tuning Oracle Forms, Oracle Concurrent Manager, Apache, and Oracle Discoverer. Track down memory leaks and other issues at the Java and JVM layers. The session also covers Oracle E-Business Suite product-level tuning, including Oracle Workflow, Oracle Order Management, Oracle Payroll, and other modules. CON3429 - Using Oracle ADF with Oracle E-Business Suite: The Full Integration ViewSiva Puthurkattil, Lake County; Juan Camilo Ruiz, Sara Woodhull, Oracle Thursday, Oct 4, 11:15 AM - 12:15 PM - Moscone West 3003 Oracle E-Business Suite delivers functionality for handling the core business of your organization. However, user requirements and new technologies are driving an emerging need to implement new types of user interfaces for these applications. This session provides an overview of how to use Oracle Application Development Framework (Oracle ADF) to deliver cutting-edge Web 2.0 and mobile rich user interfaces that front existing Oracle E-Business Suite processes, and it also explores all the existing types of integration between the two worlds. CON9020 - Integrating Oracle E-Business Suite with Oracle Identity Management SolutionsSunil Ghosh, Elke Phelps, Oracle Thursday, Oct 4, 12:45 PM - 1:45 PM - Moscone West 2016 Need to integrate Oracle E-Business Suite with Microsoft Windows Kerberos, Active Directory, CA Netegrity SiteMinder, or other third-party authentication systems? Want to understand your options when Oracle Premier Support for Oracle Single Sign-On ends in December 2011? This Oracle Development session covers the latest certified integrations with Oracle Access Manager 11g and Oracle Internet Directory 11g, which can be used individually or as bridges for integrating with third-party authentication solutions. The session presents an architectural overview of how Oracle Access Manager, its WebGate and AccessGate components, and Oracle Internet Directory work together, with implications for Oracle Discoverer, Oracle Portal, and other Oracle Fusion identity management products. CON9019 - Troubleshooting, Diagnosing, and Optimizing Oracle E-Business Suite TechnologyGustavo Jimenez, Oracle Thursday, Oct 4, 2:15 PM - 3:15 PM - Moscone West 2016 This session covers how you can proactively diagnose Oracle E-Business Suite applications, including extensions built with Oracle Fusion Middleware technologies such as Oracle Application Development Framework (Oracle ADF) and Oracle WebCenter to catch potential issues in the middle tier before they become more serious. Topics include debugging, logging infrastructure, warning signs, performance tuning, information required when logging service requests, general JVM optimization, and an overall picture of all the moving parts that make it possible for Oracle E-Business Suite to isolate and fix problems. Also learn how Oracle Diagnostics Framework will help prevent downtime caused by failures. CON9031 - The Top 10 Things You Can Do to Secure Your Oracle E-Business Suite InstanceEric Bing, Erik Graversen, Oracle Thursday, Oct 4, 2:15 PM - 3:15 PM - Moscone West 2018 Learn the top 10 things you can do to secure your applications and your sensitive data. This Oracle development session for system administrators and security professionals explores some of the most important and overlooked things you can do to secure your Oracle E-Business Suite instance. It also covers data masking and other mechanisms for protecting sensitive data. Special Interest Groups (SIG) Some of our most senior staff have been invited to participate on the following SIG meetings as guest speakers: SIG10525 - OAUG - Archive & Purge SIGBrian Bent - Pre-Sales Engineer, TierData, Inc. Sunday, Sep 30, 10:30 AM - 12:00 PM - Moscone West 3011 The Archive and Purge SIG is an organization in which users can share their experiences and solicit functional and technical advice on archiving and purging data in Oracle E-Business Suite. This session provides an opportunity for users to network and share best practices, tips, and tricks. Guest: Oracle E-Business Suite Database Performance, Archive & Purging - Q&A SessionIsam Alyousfi, Senior Director, Applications Performance, Oracle SIG10547 - OAUG - Oracle E-Business (EBS) Applications Technology SIGSrini Chavali - IT Director, Cummins Inc Sunday, Sep 30, 10:30 AM - 12:00 PM - Moscone West 3018 The general purpose of the EBS Applications Technology SIG is to inform and educate its members about current and future components of the tech stack as they relate to Oracle E-Business Suite. Attend this meeting for networking and education and to share best practices. Guest: Oracle E-Business Suite Technology Certification Roadmap - Presentation and Q&ASteven Chan, Sr. Director, Applications Technology Group, Oracle SIG10559 - OAUG - User Management SIGSusan Behn - VP of Oracle Delivery, Infosemantics, Inc. Sunday, Sep 30, 10:30 AM - 12:00 PM - Moscone West 3024 The E-Business Suite User Management SIG focuses on the components of user management that enable Oracle E-Business Suite users to define administrative functions and manage users’ access to functions and data based on roles within an organization—rather than the user’s individual identity—which is referred to as role-based access control (RBAC). This meeting includes an introduction to Oracle User Management that covers the Oracle User Management building blocks and presents an example of creating a security policy.Guest: Security and User Management - Q&A SessionEric Bing, Sr. Director, EBS Security, OracleSara Woodhull, Principal Product Manager, Applications Technology Group, Oracle SIG10515 - OAUG – Upgrade SIGBarbara Matthews - Consultant, On Call DBASandra Vucinic, VLAD Group, Inc. Sunday, Sep 30, 12:00 PM - 2:00 PM - Moscone West 3009 This Upgrade SIG session starts with a business meeting and then features a Q&A panel discussion on Oracle E-Business Suite upgrade topics. The session• Reviews Upgrade SIG goals and objectives• Provides answers, during the Q&A session, to questions related to Oracle E-Business Suite upgrades• Shares “real world” experiences, tips, and techniques for Oracle E-Business Suite upgrades to Release 12.1. Guest: Oracle E-Business Suite Upgrade - Q&A SessionAnne Carlson - Sr. Director, Oracle E-Business Suite Product Strategy, OracleUdayan Parvate - Director, EBS Release Engineering, OracleSuzana Ferrari, Sr. Principal Consultant, OracleIsam Alyousfi, Sr. Director, Applications Performance, Oracle SIG10552 - OAUG - Oracle E-Business Suite SIGDonna Rosentrater - Manager, Global Sourcing & Procurement Systems, TJX Sunday, Sep 30, 12:15 PM - 1:45 PM - Moscone West 3020 The E-Business Suite SIG, affiliated with OAUG, supports Oracle E-Business Suite users through networking, education, and sharing of best practices. This SIG meeting will feature a general discussion of Oracle E-Business Suite product strategies in Release 12 and migration to Oracle Fusion Applications. Guest: Oracle E-Business Suite - Q&A SessionJeanne Lowell, Vice President, EBS Product Strategy, OracleNadia Bendjedou, Sr. Director, Product Strategy, Oracle SIG10556 - OAUG - SysAdmin SIGRandy Giefer - Sr Systems and Security Architect, Solution Beacon, LLC Sunday, Sep 30, 12:15 PM - 1:45 PM - Moscone West 3022 The SysAdmin SIG provides a forum in which OAUG members and participants can share updates, tips, and successful practices relating to system administration in an Oracle applications environment. The SysAdmin SIG strives to enable system administrators to become more effective and efficient in their jobs by providing them with access to people and information that can increase their system administration knowledge and experience. Attend this meeting to network, share best practices, and benefit from educational content. Guest: Oracle E-Business Suite 12.2 Online Patching- Presentation and Q&AKevin Hudson, Sr. Director, Applications Technology Group, Oracle SIG10553 - OAUG - Database SIGMichael Brown - Senior DBA, COLIBRI LTD LC Sunday, Sep 30, 2:00 PM - 3:15 PM - Moscone West 3020 The OAUG Database SIG provides an opportunity for applications database administrators to learn from and share their experiences with supporting the various Oracle applications environments. This session will include a brief business meeting followed by a short presentation. It will end with an open discussion among the attendees about items of interest to those present. Guest: Oracle E-Business Suite Database Performance - Presentation and Q&AIsam Alyousfi, Sr. Director, Applications Performance, Oracle Meet the Experts We're planning two round-table discussions where you can review your questions with senior E-Business Suite ATG staff: MTE9648 - Meet the Experts for Oracle E-Business Suite: Planning Your Upgrade Jeanne Lowell - VP, EBS Product Strategy, Oracle John Abraham - Sr. Principal Product Manager, Oracle Nadia Bendjedou - Sr. Director - Product Strategy, Oracle Anne Carlson - Sr. Director, Applications Technology Group, Oracle Udayan Parvate - Director, EBS Release Engineering, Oracle Isam Alyousfi, Sr. Director, Applications Performance, Oracle Monday, Oct 1, 3:15 PM - 4:15 PM - Moscone West 2001A Don’t miss this Oracle Applications Meet the Experts session with experts who specialize in Oracle E-Business Suite upgrade best practices. This is the place where attendees can have informal and semistructured but open one-on-one discussions with Strategy and Development regarding Oracle Applications strategy and your specific business and IT strategy. The experts will be available to discuss the value of the latest releases and share insights into the best path for your enterprise, so come ready with your questions. Space is limited, so make sure you register. MTE9649 - Meet the Oracle E-Business Suite Tools and Technology Experts Lisa Parekh - Vice President, Technology Integration, Oracle Steven Chan - Sr. Director, Oracle Elke Phelps - Sr. Principal Product Manager, Applications Technology Group, Oracle Max Arderius - Manager, Applications Technology Group, Oracle Tuesday, Oct 2, 1:15 PM - 2:15 PM - Moscone West 2001A Don’t miss this Oracle Applications Meet the Experts session with experts who specialize in Oracle E-Business Suite technology. This is the place where attendees can have informal and semistructured but open one-on-one discussions with Strategy and Development regarding Oracle Applications strategy and your specific business and IT strategy. The experts will be available to discuss the value of the latest releases and share insights into the best path for your enterprise, so come ready with your questions. Space is limited, so make sure you register. Demos We have five booths in the exhibition demogrounds this year, where you can try ATG technologies firsthand and get your questions answered. Please stop by and meet our staff at the following locations: Advanced Architecture and Technology Stack for Oracle E-Business Suite (W-067) New User Productivity Capabilities in Oracle E-Business Suite (W-065) End-to-End Management of Oracle E-Business Suite (W-063) Oracle E-Business Suite 12.1 Technical Upgrade Best Practices (W-066) SOA-Based Integration for Oracle E-Business Suite (W-064)

  Read the article

• Top things web developers should know about the Visual Studio 2013 release

  - by Jon Galloway

  ASP.NET and Web Tools for Visual Studio 2013 Release NotesASP.NET and Web Tools for Visual Studio 2013 Release NotesSummary for lazy readers: Visual Studio 2013 is now available for download on the Visual Studio site and on MSDN subscriber downloads) Visual Studio 2013 installs side by side with Visual Studio 2012 and supports round-tripping between Visual Studio versions, so you can try it out without committing to a switch Visual Studio 2013 ships with the new version of ASP.NET, which includes ASP.NET MVC 5, ASP.NET Web API 2, Razor 3, Entity Framework 6 and SignalR 2.0 The new releases ASP.NET focuses on One ASP.NET, so core features and web tools work the same across the platform (e.g. adding ASP.NET MVC controllers to a Web Forms application) New core features include new templates based on Bootstrap, a new scaffolding system, and a new identity system Visual Studio 2013 is an incredible editor for web files, including HTML, CSS, JavaScript, Markdown, LESS, Coffeescript, Handlebars, Angular, Ember, Knockdown, etc. Top links: Visual Studio 2013 content on the ASP.NET site are in the standard new releases area: http://www.asp.net/vnext ASP.NET and Web Tools for Visual Studio 2013 Release Notes Short intro videos on the new Visual Studio web editor features from Scott Hanselman and Mads Kristensen Announcing release of ASP.NET and Web Tools for Visual Studio 2013 post on the official .NET Web Development and Tools Blog Scott Guthrie's post: Announcing the Release of Visual Studio 2013 and Great Improvements to ASP.NET and Entity Framework Okay, for those of you who are still with me, let's dig in a bit. Quick web dev notes on downloading and installing Visual Studio 2013 I found Visual Studio 2013 to be a pretty fast install. According to Brian Harry's release post, installing over pre-release versions of Visual Studio is supported.  I've installed the release version over pre-release versions, and it worked fine. If you're only going to be doing web development, you can speed up the install if you just select Web Developer tools. Of course, as a good Microsoft employee, I'll mention that you might also want to install some of those other features, like the Store apps for Windows 8 and the Windows Phone 8.0 SDK, but they do download and install a lot of other stuff (e.g. the Windows Phone SDK sets up Hyper-V and downloads several GB's of VM's). So if you're planning just to do web development for now, you can pick just the Web Developer Tools and install the other stuff later. If you've got a fast internet connection, I recommend using the web installer instead of downloading the ISO. The ISO includes all the features, whereas the web installer just downloads what you're installing. Visual Studio 2013 development settings and color theme When you start up Visual Studio, it'll prompt you to pick some defaults. These are totally up to you -whatever suits your development style - and you can change them later. As I said, these are completely up to you. I recommend either the Web Development or Web Development (Code Only) settings. The only real difference is that Code Only hides the toolbars, and you can switch between them using Tools / Import and Export Settings / Reset. Web Development settings Web Development (code only) settings Usually I've just gone with Web Development (code only) in the past because I just want to focus on the code, although the Standard toolbar does make it easier to switch default web browsers. More on that later. Color theme Sigh. Okay, everyone's got their favorite colors. I alternate between Light and Dark depending on my mood, and I personally like how the low contrast on the window chrome in those themes puts the emphasis on my code rather than the tabs and toolbars. I know some people got pretty worked up over that, though, and wanted the blue theme back. I personally don't like it - it reminds me of ancient versions of Visual Studio that I don't want to think about anymore. So here's the thing: if you install Visual Studio Ultimate, it defaults to Blue. The other versions default to Light. If you use Blue, I won't criticize you - out loud, that is. You can change themes really easily - either Tools / Options / Environment / General, or the smart way: ctrl+q for quick launch, then type Theme and hit enter. Signing in During the first run, you'll be prompted to sign in. You don't have to - you can click the "Not now, maybe later" link at the bottom of that dialog. I recommend signing in, though. It's not hooked in with licensing or tracking the kind of code you write to sell you components. It is doing good things, like  syncing your Visual Studio settings between computers. More about that here. So, you don't have to, but I sure do. Overview of shiny new things in ASP.NET land There are a lot of good new things in ASP.NET. I'll list some of my favorite here, but you can read more on the ASP.NET site. One ASP.NET You've heard us talk about this for a while. The idea is that options are good, but choice can be a burden. When you start a new ASP.NET project, why should you have to make a tough decision - with long-term consequences - about how your application will work? If you want to use ASP.NET Web Forms, but have the option of adding in ASP.NET MVC later, why should that be hard? It's all ASP.NET, right? Ideally, you'd just decide that you want to use ASP.NET to build sites and services, and you could use the appropriate tools (the green blocks below) as you needed them. So, here it is. When you create a new ASP.NET application, you just create an ASP.NET application. Next, you can pick from some templates to get you started... but these are different. They're not "painful decision" templates, they're just some starting pieces. And, most importantly, you can mix and match. I can pick a "mostly" Web Forms template, but include MVC and Web API folders and core references. If you've tried to mix and match in the past, you're probably aware that it was possible, but not pleasant. ASP.NET MVC project files contained special project type GUIDs, so you'd only get controller scaffolding support in a Web Forms project if you manually edited the csproj file. Features in one stack didn't work in others. Project templates were painful choices. That's no longer the case. Hooray! I just did a demo in a presentation last week where I created a new Web Forms + MVC + Web API site, built a model, scaffolded MVC and Web API controllers with EF Code First, add data in the MVC view, viewed it in Web API, then added a GridView to the Web Forms Default.aspx page and bound it to the Model. In about 5 minutes. Sure, it's a simple example, but it's great to be able to share code and features across the whole ASP.NET family. Authentication In the past, authentication was built into the templates. So, for instance, there was an ASP.NET MVC 4 Intranet Project template which created a new ASP.NET MVC 4 application that was preconfigured for Windows Authentication. All of that authentication stuff was built into each template, so they varied between the stacks, and you couldn't reuse them. You didn't see a lot of changes to the authentication options, since they required big changes to a bunch of project templates. Now, the new project dialog includes a common authentication experience. When you hit the Change Authentication button, you get some common options that work the same way regardless of the template or reference settings you've made. These options work on all ASP.NET frameworks, and all hosting environments (IIS, IIS Express, or OWIN for self-host) The default is Individual User Accounts: This is the standard "create a local account, using username / password or OAuth" thing; however, it's all built on the new Identity system. More on that in a second. The one setting that has some configuration to it is Organizational Accounts, which lets you configure authentication using Active Directory, Windows Azure Active Directory, or Office 365. Identity There's a new identity system. We've taken the best parts of the previous ASP.NET Membership and Simple Identity systems, rolled in a lot of feedback and made big enhancements to support important developer concerns like unit testing and extensiblity. I've written long posts about ASP.NET identity, and I'll do it again. Soon. This is not that post. The short version is that I think we've finally got just the right Identity system. Some of my favorite features: There are simple, sensible defaults that work well - you can File / New / Run / Register / Login, and everything works. It supports standard username / password as well as external authentication (OAuth, etc.). It's easy to customize without having to re-implement an entire provider. It's built using pluggable pieces, rather than one large monolithic system. It's built using interfaces like IUser and IRole that allow for unit testing, dependency injection, etc. You can easily add user profile data (e.g. URL, twitter handle, birthday). You just add properties to your ApplicationUser model and they'll automatically be persisted. Complete control over how the identity data is persisted. By default, everything works with Entity Framework Code First, but it's built to support changes from small (modify the schema) to big (use another ORM, store your data in a document database or in the cloud or in XML or in the EXIF data of your desktop background or whatever). It's configured via OWIN. More on OWIN and Katana later, but the fact that it's built using OWIN means it's portable. You can find out more in the Authentication and Identity section of the ASP.NET site (and lots more content will be going up there soon). New Bootstrap based project templates The new project templates are built using Bootstrap 3. Bootstrap (formerly Twitter Bootstrap) is a front-end framework that brings a lot of nice benefits: It's responsive, so your projects will automatically scale to device width using CSS media queries. For example, menus are full size on a desktop browser, but on narrower screens you automatically get a mobile-friendly menu. The built-in Bootstrap styles make your standard page elements (headers, footers, buttons, form inputs, tables etc.) look nice and modern. Bootstrap is themeable, so you can reskin your whole site by dropping in a new Bootstrap theme. Since Bootstrap is pretty popular across the web development community, this gives you a large and rapidly growing variety of templates (free and paid) to choose from. Bootstrap also includes a lot of very useful things: components (like progress bars and badges), useful glyphicons, and some jQuery plugins for tooltips, dropdowns, carousels, etc.). Here's a look at how the responsive part works. When the page is full screen, the menu and header are optimized for a wide screen display: When I shrink the page down (this is all based on page width, not useragent sniffing) the menu turns into a nice mobile-friendly dropdown: For a quick example, I grabbed a new free theme off bootswatch.com. For simple themes, you just need to download the boostrap.css file and replace the /content/bootstrap.css file in your project. Now when I refresh the page, I've got a new theme: Scaffolding The big change in scaffolding is that it's one system that works across ASP.NET. You can create a new Empty Web project or Web Forms project and you'll get the Scaffold context menus. For release, we've got MVC 5 and Web API 2 controllers. We had a preview of Web Forms scaffolding in the preview releases, but they weren't fully baked for RTM. Look for them in a future update, expected pretty soon. This scaffolding system wasn't just changed to work across the ASP.NET frameworks, it's also built to enable future extensibility. That's not in this release, but should also hopefully be out soon. Project Readme page This is a small thing, but I really like it. When you create a new project, you get a Project_Readme.html page that's added to the root of your project and opens in the Visual Studio built-in browser. I love it. A long time ago, when you created a new project we just dumped it on you and left you scratching your head about what to do next. Not ideal. Then we started adding a bunch of Getting Started information to the new project templates. That told you what to do next, but you had to delete all of that stuff out of your website. It doesn't belong there. Not ideal. This is a simple HTML file that's not integrated into your project code at all. You can delete it if you want. But, it shows a lot of helpful links that are current for the project you just created. In the future, if we add new wacky project types, they can create readme docs with specific information on how to do appropriately wacky things. Side note: I really like that they used the internal browser in Visual Studio to show this content rather than popping open an HTML page in the default browser. I hate that. It's annoying. If you're doing that, I hope you'll stop. What if some unnamed person has 40 or 90 tabs saved in their browser session? When you pop open your "Thanks for installing my Visual Studio extension!" page, all eleventy billion tabs start up and I wish I'd never installed your thing. Be like these guys and pop stuff Visual Studio specific HTML docs in the Visual Studio browser. ASP.NET MVC 5 The biggest change with ASP.NET MVC 5 is that it's no longer a separate project type. It integrates well with the rest of ASP.NET. In addition to that and the other common features we've already looked at (Bootstrap templates, Identity, authentication), here's what's new for ASP.NET MVC. Attribute routing ASP.NET MVC now supports attribute routing, thanks to a contribution by Tim McCall, the author of http://attributerouting.net. With attribute routing you can specify your routes by annotating your actions and controllers. This supports some pretty complex, customized routing scenarios, and it allows you to keep your route information right with your controller actions if you'd like. Here's a controller that includes an action whose method name is Hiding, but I've used AttributeRouting to configure it to /spaghetti/with-nesting/where-is-waldo public class SampleController : Controller { [Route("spaghetti/with-nesting/where-is-waldo")] public string Hiding() { return "You found me!"; } } I enable that in my RouteConfig.cs, and I can use that in conjunction with my other MVC routes like this: public class RouteConfig { public static void RegisterRoutes(RouteCollection routes) { routes.IgnoreRoute("{resource}.axd/{*pathInfo}"); routes.MapMvcAttributeRoutes(); routes.MapRoute( name: "Default", url: "{controller}/{action}/{id}", defaults: new { controller = "Home", action = "Index", id = UrlParameter.Optional } ); } } You can read more about Attribute Routing in ASP.NET MVC 5 here. Filter enhancements There are two new additions to filters: Authentication Filters and Filter Overrides. Authentication filters are a new kind of filter in ASP.NET MVC that run prior to authorization filters in the ASP.NET MVC pipeline and allow you to specify authentication logic per-action, per-controller, or globally for all controllers. Authentication filters process credentials in the request and provide a corresponding principal. Authentication filters can also add authentication challenges in response to unauthorized requests. Override filters let you change which filters apply to a given action method or controller. Override filters specify a set of filter types that should not be run for a given scope (action or controller). This allows you to configure filters that apply globally but then exclude certain global filters from applying to specific actions or controllers. ASP.NET Web API 2 ASP.NET Web API 2 includes a lot of new features. Attribute Routing ASP.NET Web API supports the same attribute routing system that's in ASP.NET MVC 5. You can read more about the Attribute Routing features in Web API in this article. OAuth 2.0 ASP.NET Web API picks up OAuth 2.0 support, using security middleware running on OWIN (discussed below). This is great for features like authenticated Single Page Applications. OData Improvements ASP.NET Web API now has full OData support. That required adding in some of the most powerful operators: $select, $expand, $batch and $value. You can read more about OData operator support in this article by Mike Wasson. Lots more There's a huge list of other features, including CORS (cross-origin request sharing), IHttpActionResult, IHttpRequestContext, and more. I think the best overview is in the release notes. OWIN and Katana I've written about OWIN and Katana recently. I'm a big fan. OWIN is the Open Web Interfaces for .NET. It's a spec, like HTML or HTTP, so you can't install OWIN. The benefit of OWIN is that it's a community specification, so anyone who implements it can plug into the ASP.NET stack, either as middleware or as a host. Katana is the Microsoft implementation of OWIN. It leverages OWIN to wire up things like authentication, handlers, modules, IIS hosting, etc., so ASP.NET can host OWIN components and Katana components can run in someone else's OWIN implementation. Howard Dierking just wrote a cool article in MSDN magazine describing Katana in depth: Getting Started with the Katana Project. He had an interesting example showing an OWIN based pipeline which leveraged SignalR, ASP.NET Web API and NancyFx components in the same stack. If this kind of thing makes sense to you, that's great. If it doesn't, don't worry, but keep an eye on it. You're going to see some cool things happen as a result of ASP.NET becoming more and more pluggable. Visual Studio Web Tools Okay, this stuff's just crazy. Visual Studio has been adding some nice web dev features over the past few years, but they've really cranked it up for this release. Visual Studio is by far my favorite code editor for all web files: CSS, HTML, JavaScript, and lots of popular libraries. Stop thinking of Visual Studio as a big editor that you only use to write back-end code. Stop editing HTML and CSS in Notepad (or Sublime, Notepad++, etc.). Visual Studio starts up in under 2 seconds on a modern computer with an SSD. Misspelling HTML attributes or your CSS classes or jQuery or Angular syntax is stupid. It doesn't make you a better developer, it makes you a silly person who wastes time. Browser Link Browser Link is a real-time, two-way connection between Visual Studio and all connected browsers. It's only attached when you're running locally, in debug, but it applies to any and all connected browser, including emulators. You may have seen demos that showed the browsers refreshing based on changes in the editor, and I'll agree that's pretty cool. But it's really just the start. It's a two-way connection, and it's built for extensiblity. That means you can write extensions that push information from your running application (in IE, Chrome, a mobile emulator, etc.) back to Visual Studio. Mads and team have showed off some demonstrations where they enabled edit mode in the browser which updated the source HTML back on the browser. It's also possible to look at how the rendered HTML performs, check for compatibility issues, watch for unused CSS classes, the sky's the limit. New HTML editor The previous HTML editor had a lot of old code that didn't allow for improvements. The team rewrote the HTML editor to take advantage of the new(ish) extensibility features in Visual Studio, which then allowed them to add in all kinds of features - things like CSS Class and ID IntelliSense (so you type style="" and get a list of classes and ID's for your project), smart indent based on how your document is formatted, JavaScript reference auto-sync, etc. Here's a 3 minute tour from Mads Kristensen. The previous HTML editor had a lot of old code that didn't allow for improvements. The team rewrote the HTML editor to take advantage of the new(ish) extensibility features in Visual Studio, which then allowed them to add in all kinds of features - things like CSS Class and ID IntelliSense (so you type style="" and get a list of classes and ID's for your project), smart indent based on how your document is formatted, JavaScript reference auto-sync, etc. Lots more Visual Studio web dev features That's just a sampling - there's a ton of great features for JavaScript editing, CSS editing, publishing, and Page Inspector (which shows real-time rendering of your page inside Visual Studio). Here are some more short videos showing those features. Lots, lots more Okay, that's just a summary, and it's still quite a bit. Head on over to http://asp.net/vnext for more information, and download Visual Studio 2013 now to get started!

  Read the article

• Using jQuery to POST Form Data to an ASP.NET ASMX AJAX Web Service

  - by Rick Strahl

  The other day I got a question about how to call an ASP.NET ASMX Web Service or PageMethods with the POST data from a Web Form (or any HTML form for that matter). The idea is that you should be able to call an endpoint URL, send it regular urlencoded POST data and then use Request.Form[] to retrieve the posted data as needed. My first reaction was that you can’t do it, because ASP.NET ASMX AJAX services (as well as Page Methods and WCF REST AJAX Services) require that the content POSTed to the server is posted as JSON and sent with an application/json or application/x-javascript content type. IOW, you can’t directly call an ASP.NET AJAX service with regular urlencoded data. Note that there are other ways to accomplish this. You can use ASP.NET MVC and a custom route, an HTTP Handler or separate ASPX page, or even a WCF REST service that’s configured to use non-JSON inputs. However if you want to use an ASP.NET AJAX service (or Page Methods) with a little bit of setup work it’s actually quite easy to capture all the form variables on the client and ship them up to the server. The basic steps needed to make this happen are: Capture form variables into an array on the client with jQuery’s .serializeArray() function Use $.ajax() or my ServiceProxy class to make an AJAX call to the server to send this array On the server create a custom type that matches the .serializeArray() name/value structure Create extension methods on NameValue[] to easily extract form variables Create a [WebMethod] that accepts this name/value type as an array (NameValue[]) This seems like a lot of work but realize that steps 3 and 4 are a one time setup step that can be reused in your entire site or multiple applications. Let’s look at a short example that looks like this as a base form of fields to ship to the server: The HTML for this form looks something like this: <div id="divMessage" class="errordisplay" style="display: none"> </div> <div> <div class="label">Name:</div> <div><asp:TextBox runat="server" ID="txtName" /></div> </div> <div> <div class="label">Company:</div> <div><asp:TextBox runat="server" ID="txtCompany"/></div> </div> <div> <div class="label" ></div> <div> <asp:DropDownList runat="server" ID="lstAttending"> <asp:ListItem Text="Attending" Value="Attending"/> <asp:ListItem Text="Not Attending" Value="NotAttending" /> <asp:ListItem Text="Maybe Attending" Value="MaybeAttending" /> <asp:ListItem Text="Not Sure Yet" Value="NotSureYet" /> </asp:DropDownList> </div> </div> <div> <div class="label">Special Needs:<br /> <small>(check all that apply)</small></div> <div> <asp:ListBox runat="server" ID="lstSpecialNeeds" SelectionMode="Multiple"> <asp:ListItem Text="Vegitarian" Value="Vegitarian" /> <asp:ListItem Text="Vegan" Value="Vegan" /> <asp:ListItem Text="Kosher" Value="Kosher" /> <asp:ListItem Text="Special Access" Value="SpecialAccess" /> <asp:ListItem Text="No Binder" Value="NoBinder" /> </asp:ListBox> </div> </div> <div> <div class="label"></div> <div> <asp:CheckBox ID="chkAdditionalGuests" Text="Additional Guests" runat="server" /> </div> </div> <hr /> <input type="button" id="btnSubmit" value="Send Registration" /> The form includes a few different kinds of form fields including a multi-selection listbox to demonstrate retrieving multiple values. Setting up the Server Side [WebMethod] The [WebMethod] on the server we’re going to call is going to be very simple and just capture the content of these values and echo then back as a formatted HTML string. Obviously this is overly simplistic but it serves to demonstrate the simple point of capturing the POST data on the server in an AJAX callback. public class PageMethodsService : System.Web.Services.WebService { [WebMethod] public string SendRegistration(NameValue[] formVars) { StringBuilder sb = new StringBuilder(); sb.AppendFormat("Thank you {0}, <br/><br/>", HttpUtility.HtmlEncode(formVars.Form("txtName"))); sb.AppendLine("You've entered the following: <hr/>"); foreach (NameValue nv in formVars) { // strip out ASP.NET form vars like _ViewState/_EventValidation if (!nv.name.StartsWith("__")) { if (nv.name.StartsWith("txt") || nv.name.StartsWith("lst") || nv.name.StartsWith("chk")) sb.Append(nv.name.Substring(3)); else sb.Append(nv.name); sb.AppendLine(": " + HttpUtility.HtmlEncode(nv.value) + "<br/>"); } } sb.AppendLine("<hr/>"); string[] needs = formVars.FormMultiple("lstSpecialNeeds"); if (needs == null) sb.AppendLine("No Special Needs"); else { sb.AppendLine("Special Needs: <br/>"); foreach (string need in needs) { sb.AppendLine("&nbsp;&nbsp;" + need + "<br/>"); } } return sb.ToString(); } } The key feature of this method is that it receives a custom type called NameValue[] which is an array of NameValue objects that map the structure that the jQuery .serializeArray() function generates. There are two custom types involved in this: The actual NameValue type and a NameValueExtensions class that defines a couple of extension methods for the NameValue[] array type to allow for single (.Form()) and multiple (.FormMultiple()) value retrieval by name. The NameValue class is as simple as this and simply maps the structure of the array elements of .serializeArray(): public class NameValue { public string name { get; set; } public string value { get; set; } } The extension method class defines the .Form() and .FormMultiple() methods to allow easy retrieval of form variables from the returned array: /// <summary> /// Simple NameValue class that maps name and value /// properties that can be used with jQuery's /// $.serializeArray() function and JSON requests /// </summary> public static class NameValueExtensionMethods { /// <summary> /// Retrieves a single form variable from the list of /// form variables stored /// </summary> /// <param name="formVars"></param> /// <param name="name">formvar to retrieve</param> /// <returns>value or string.Empty if not found</returns> public static string Form(this NameValue[] formVars, string name) { var matches = formVars.Where(nv => nv.name.ToLower() == name.ToLower()).FirstOrDefault(); if (matches != null) return matches.value; return string.Empty; } /// <summary> /// Retrieves multiple selection form variables from the list of /// form variables stored. /// </summary> /// <param name="formVars"></param> /// <param name="name">The name of the form var to retrieve</param> /// <returns>values as string[] or null if no match is found</returns> public static string[] FormMultiple(this NameValue[] formVars, string name) { var matches = formVars.Where(nv => nv.name.ToLower() == name.ToLower()).Select(nv => nv.value).ToArray(); if (matches.Length == 0) return null; return matches; } } Using these extension methods it’s easy to retrieve individual values from the array: string name = formVars.Form("txtName"); or multiple values: string[] needs = formVars.FormMultiple("lstSpecialNeeds"); if (needs != null) { // do something with matches } Using these functions in the SendRegistration method it’s easy to retrieve a few form variables directly (txtName and the multiple selections of lstSpecialNeeds) or to iterate over the whole list of values. Of course this is an overly simple example – in typical app you’d probably want to validate the input data and save it to the database and then return some sort of confirmation or possibly an updated data list back to the client. Since this is a full AJAX service callback realize that you don’t have to return simple string values – you can return any of the supported result types (which are most serializable types) including complex hierarchical objects and arrays that make sense to your client code. POSTing Form Variables from the Client to the AJAX Service To call the AJAX service method on the client is straight forward and requires only use of little native jQuery plus JSON serialization functionality. To start add jQuery and the json2.js library to your page: <script src="Scripts/jquery.min.js" type="text/javascript"></script> <script src="Scripts/json2.js" type="text/javascript"></script> json2.js can be found here (be sure to remove the first line from the file): http://www.json.org/json2.js It’s required to handle JSON serialization for those browsers that don’t support it natively. With those script references in the document let’s hookup the button click handler and call the service: $(document).ready(function () { $("#btnSubmit").click(sendRegistration); }); function sendRegistration() { var arForm = $("#form1").serializeArray(); $.ajax({ url: "PageMethodsService.asmx/SendRegistration", type: "POST", contentType: "application/json", data: JSON.stringify({ formVars: arForm }), dataType: "json", success: function (result) { var jEl = $("#divMessage"); jEl.html(result.d).fadeIn(1000); setTimeout(function () { jEl.fadeOut(1000) }, 5000); }, error: function (xhr, status) { alert("An error occurred: " + status); } }); } The key feature in this code is the $("#form1").serializeArray();  call which serializes all the form fields of form1 into an array. Each form var is represented as an object with a name/value property. This array is then serialized into JSON with: JSON.stringify({ formVars: arForm }) The format for the parameter list in AJAX service calls is an object with one property for each parameter of the method. In this case its a single parameter called formVars and we’re assigning the array of form variables to it. The URL to call on the server is the name of the Service (or ASPX Page for Page Methods) plus the name of the method to call. On return the success callback receives the result from the AJAX callback which in this case is the formatted string which is simply assigned to an element in the form and displayed. Remember the result type is whatever the method returns – it doesn’t have to be a string. Note that ASP.NET AJAX and WCF REST return JSON data as a wrapped object so the result has a ‘d’ property that holds the actual response: jEl.html(result.d).fadeIn(1000); Slightly simpler: Using ServiceProxy.js If you want things slightly cleaner you can use the ServiceProxy.js class I’ve mentioned here before. The ServiceProxy class handles a few things for calling ASP.NET and WCF services more cleanly: Automatic JSON encoding Automatic fix up of ‘d’ wrapper property Automatic Date conversion on the client Simplified error handling Reusable and abstracted To add the service proxy add: <script src="Scripts/ServiceProxy.js" type="text/javascript"></script> and then change the code to this slightly simpler version: <script type="text/javascript"> proxy = new ServiceProxy("PageMethodsService.asmx/"); $(document).ready(function () { $("#btnSubmit").click(sendRegistration); }); function sendRegistration() { var arForm = $("#form1").serializeArray(); proxy.invoke("SendRegistration", { formVars: arForm }, function (result) { var jEl = $("#divMessage"); jEl.html(result).fadeIn(1000); setTimeout(function () { jEl.fadeOut(1000) }, 5000); }, function (error) { alert(error.message); } ); } The code is not very different but it makes the call as simple as specifying the method to call, the parameters to pass and the actions to take on success and error. No more remembering which content type and data types to use and manually serializing to JSON. This code also removes the “d” property processing in the response and provides more consistent error handling in that the call always returns an error object regardless of a server error or a communication error unlike the native $.ajax() call. Either approach works and both are pretty easy. The ServiceProxy really pays off if you use lots of service calls and especially if you need to deal with date values returned from the server  on the client. Summary Making Web Service calls and getting POST data to the server is not always the best option – ASP.NET and WCF AJAX services are meant to work with data in objects. However, in some situations it’s simply easier to POST all the captured form data to the server instead of mapping all properties from the input fields to some sort of message object first. For this approach the above POST mechanism is useful as it puts the parsing of the data on the server and leaves the client code lean and mean. It’s even easy to build a custom model binder on the server that can map the array values to properties on an object generically with some relatively simple Reflection code and without having to manually map form vars to properties and do string conversions. Keep in mind though that other approaches also abound. ASP.NET MVC makes it pretty easy to create custom routes to data and the built in model binder makes it very easy to deal with inbound form POST data in its original urlencoded format. The West Wind West Wind Web Toolkit also includes functionality for AJAX callbacks using plain POST values. All that’s needed is a Method parameter to query/form value to specify the method to be called on the server. After that the content type is completely optional and up to the consumer. It’d be nice if the ASP.NET AJAX Service and WCF AJAX Services weren’t so tightly bound to the content type so that you could more easily create open access service endpoints that can take advantage of urlencoded data that is everywhere in existing pages. It would make it much easier to create basic REST endpoints without complicated service configuration. Ah one can dream! In the meantime I hope this article has given you some ideas on how you can transfer POST data from the client to the server using JSON – it might be useful in other scenarios beyond ASP.NET AJAX services as well. Additional Resources ServiceProxy.js A small JavaScript library that wraps $.ajax() to call ASP.NET AJAX and WCF AJAX Services. Includes date parsing extensions to the JSON object, a global dataFilter for processing dates on all jQuery JSON requests, provides cleanup for the .NET wrapped message format and handles errors in a consistent fashion. Making jQuery Calls to WCF/ASMX with a ServiceProxy Client More information on calling ASMX and WCF AJAX services with jQuery and some more background on ServiceProxy.js. Note the implementation has slightly changed since the article was written. ww.jquery.js The West Wind West Wind Web Toolkit also includes ServiceProxy.js in the West Wind jQuery extension library. This version is slightly different and includes embedded json encoding/decoding based on json2.js.© Rick Strahl, West Wind Technologies, 2005-2010Posted in jQuery  ASP.NET  AJAX  

  Read the article

• Windows Azure: Backup Services Release, Hyper-V Recovery Manager, VM Enhancements, Enhanced Enterprise Management Support

  - by ScottGu

  This morning we released a huge set of updates to Windows Azure.  These new capabilities include: Backup Services: General Availability of Windows Azure Backup Services Hyper-V Recovery Manager: Public preview of Windows Azure Hyper-V Recovery Manager Virtual Machines: Delete Attached Disks, Availability Set Warnings, SQL AlwaysOn Configuration Active Directory: Securely manage hundreds of SaaS applications Enterprise Management: Use Active Directory to Better Manage Windows Azure Windows Azure SDK 2.2: A massive update of our SDK + Visual Studio tooling support All of these improvements are now available to use immediately.  Below are more details about them. Backup Service: General Availability Release of Windows Azure Backup Today we are releasing Windows Azure Backup Service as a general availability service.  This release is now live in production, backed by an enterprise SLA, supported by Microsoft Support, and is ready to use for production scenarios. Windows Azure Backup is a cloud based backup solution for Windows Server which allows files and folders to be backed up and recovered from the cloud, and provides off-site protection against data loss. The service provides IT administrators and developers with the option to back up and protect critical data in an easily recoverable way from any location with no upfront hardware cost. Windows Azure Backup is built on the Windows Azure platform and uses Windows Azure blob storage for storing customer data. Windows Server uses the downloadable Windows Azure Backup Agent to transfer file and folder data securely and efficiently to the Windows Azure Backup Service. Along with providing cloud backup for Windows Server, Windows Azure Backup Service also provides capability to backup data from System Center Data Protection Manager and Windows Server Essentials, to the cloud. All data is encrypted onsite before it is sent to the cloud, and customers retain and manage the encryption key (meaning the data is stored entirely secured and can’t be decrypted by anyone but yourself). Getting Started To get started with the Windows Azure Backup Service, create a new Backup Vault within the Windows Azure Management Portal.  Click New->Data Services->Recovery Services->Backup Vault to do this: Once the backup vault is created you’ll be presented with a simple tutorial that will help guide you on how to register your Windows Servers with it: Once the servers you want to backup are registered, you can use the appropriate local management interface (such as the Microsoft Management Console snap-in, System Center Data Protection Manager Console, or Windows Server Essentials Dashboard) to configure the scheduled backups and to optionally initiate recoveries. You can follow these tutorials to learn more about how to do this: Tutorial: Schedule Backups Using the Windows Azure Backup Agent This tutorial helps you with setting up a backup schedule for your registered Windows Servers. Additionally, it also explains how to use Windows PowerShell cmdlets to set up a custom backup schedule. Tutorial: Recover Files and Folders Using the Windows Azure Backup Agent This tutorial helps you with recovering data from a backup. Additionally, it also explains how to use Windows PowerShell cmdlets to do the same tasks. Below are some of the key benefits the Windows Azure Backup Service provides: Simple configuration and management. Windows Azure Backup Service integrates with the familiar Windows Server Backup utility in Windows Server, the Data Protection Manager component in System Center and Windows Server Essentials, in order to provide a seamless backup and recovery experience to a local disk, or to the cloud. Block level incremental backups. The Windows Azure Backup Agent performs incremental backups by tracking file and block level changes and only transferring the changed blocks, hence reducing the storage and bandwidth utilization. Different point-in-time versions of the backups use storage efficiently by only storing the changes blocks between these versions. Data compression, encryption and throttling. The Windows Azure Backup Agent ensures that data is compressed and encrypted on the server before being sent to the Windows Azure Backup Service over the network. As a result, the Windows Azure Backup Service only stores encrypted data in the cloud storage. The encryption key is not available to the Windows Azure Backup Service, and as a result the data is never decrypted in the service. Also, users can setup throttling and configure how the Windows Azure Backup service utilizes the network bandwidth when backing up or restoring information. Data integrity is verified in the cloud. In addition to the secure backups, the backed up data is also automatically checked for integrity once the backup is done. As a result, any corruptions which may arise due to data transfer can be easily identified and are fixed automatically. Configurable retention policies for storing data in the cloud. The Windows Azure Backup Service accepts and implements retention policies to recycle backups that exceed the desired retention range, thereby meeting business policies and managing backup costs. Hyper-V Recovery Manager: Now Available in Public Preview I’m excited to also announce the public preview of a new Windows Azure Service – the Windows Azure Hyper-V Recovery Manager (HRM). Windows Azure Hyper-V Recovery Manager helps protect your business critical services by coordinating the replication and recovery of System Center Virtual Machine Manager 2012 SP1 and System Center Virtual Machine Manager 2012 R2 private clouds at a secondary location. With automated protection, asynchronous ongoing replication, and orderly recovery, the Hyper-V Recovery Manager service can help you implement Disaster Recovery and restore important services accurately, consistently, and with minimal downtime. Application data in an Hyper-V Recovery Manager scenarios always travels on your on-premise replication channel. Only metadata (such as names of logical clouds, virtual machines, networks etc.) that is needed for orchestration is sent to Azure. All traffic sent to/from Azure is encrypted. You can begin using Windows Azure Hyper-V Recovery today by clicking New->Data Services->Recovery Services->Hyper-V Recovery Manager within the Windows Azure Management Portal.  You can read more about Windows Azure Hyper-V Recovery Manager in Brad Anderson’s 9-part series, Transform the datacenter. To learn more about setting up Hyper-V Recovery Manager follow our detailed step-by-step guide. Virtual Machines: Delete Attached Disks, Availability Set Warnings, SQL AlwaysOn Today’s Windows Azure release includes a number of nice updates to Windows Azure Virtual Machines.  These improvements include: Ability to Delete both VM Instances + Attached Disks in One Operation Prior to today’s release, when you deleted VMs within Windows Azure we would delete the VM instance – but not delete the drives attached to the VM.  You had to manually delete these yourself from the storage account.  With today’s update we’ve added a convenience option that now allows you to either retain or delete the attached disks when you delete the VM:   We’ve also added the ability to delete a cloud service, its deployments, and its role instances with a single action. This can either be a cloud service that has production and staging deployments with web and worker roles, or a cloud service that contains virtual machines.  To do this, simply select the Cloud Service within the Windows Azure Management Portal and click the “Delete” button: Warnings on Availability Sets with Only One Virtual Machine In Them One of the nice features that Windows Azure Virtual Machines supports is the concept of “Availability Sets”.  An “availability set” allows you to define a tier/role (e.g. webfrontends, databaseservers, etc) that you can map Virtual Machines into – and when you do this Windows Azure separates them across fault domains and ensures that at least one of them is always available during servicing operations.  This enables you to deploy applications in a high availability way. One issue we’ve seen some customers run into is where they define an availability set, but then forget to map more than one VM into it (which defeats the purpose of having an availability set).  With today’s release we now display a warning in the Windows Azure Management Portal if you have only one virtual machine deployed in an availability set to help highlight this: You can learn more about configuring the availability of your virtual machines here. Configuring SQL Server Always On SQL Server Always On is a great feature that you can use with Windows Azure to enable high availability and DR scenarios with SQL Server. Today’s Windows Azure release makes it even easier to configure SQL Server Always On by enabling “Direct Server Return” endpoints to be configured and managed within the Windows Azure Management Portal.  Previously, setting this up required using PowerShell to complete the endpoint configuration.  Starting today you can enable this simply by checking the “Direct Server Return” checkbox: You can learn more about how to use direct server return for SQL Server AlwaysOn availability groups here. Active Directory: Application Access Enhancements This summer we released our initial preview of our Application Access Enhancements for Windows Azure Active Directory.  This service enables you to securely implement single-sign-on (SSO) support against SaaS applications (including Office 365, SalesForce, Workday, Box, Google Apps, GitHub, etc) as well as LOB based applications (including ones built with the new Windows Azure AD support we shipped last week with ASP.NET and VS 2013). Since the initial preview we’ve enhanced our SAML federation capabilities, integrated our new password vaulting system, and shipped multi-factor authentication support. We've also turned on our outbound identity provisioning system and have it working with hundreds of additional SaaS Applications: Earlier this month we published an update on dates and pricing for when the service will be released in general availability form.  In this blog post we announced our intention to release the service in general availability form by the end of the year.  We also announced that the below features would be available in a free tier with it: SSO to every SaaS app we integrate with – Users can Single Sign On to any app we are integrated with at no charge. This includes all the top SAAS Apps and every app in our application gallery whether they use federation or password vaulting. Application access assignment and removal – IT Admins can assign access privileges to web applications to the users in their active directory assuring that every employee has access to the SAAS Apps they need. And when a user leaves the company or changes jobs, the admin can just as easily remove their access privileges assuring data security and minimizing IP loss User provisioning (and de-provisioning) – IT admins will be able to automatically provision users in 3rd party SaaS applications like Box, Salesforce.com, GoToMeeting, DropBox and others. We are working with key partners in the ecosystem to establish these connections, meaning you no longer have to continually update user records in multiple systems. Security and auditing reports – Security is a key priority for us. With the free version of these enhancements you'll get access to our standard set of access reports giving you visibility into which users are using which applications, when they were using them and where they are using them from. In addition, we'll alert you to un-usual usage patterns for instance when a user logs in from multiple locations at the same time. Our Application Access Panel – Users are logging in from every type of devices including Windows, iOS, & Android. Not all of these devices handle authentication in the same manner but the user doesn't care. They need to access their apps from the devices they love. Our Application Access Panel will support the ability for users to access access and launch their apps from any device and anywhere. You can learn more about our plans for application management with Windows Azure Active Directory here.  Try out the preview and start using it today. Enterprise Management: Use Active Directory to Better Manage Windows Azure Windows Azure Active Directory provides the ability to manage your organization in a directory which is hosted entirely in the cloud, or alternatively kept in sync with an on-premises Windows Server Active Directory solution (allowing you to seamlessly integrate with the directory you already have).  With today’s Windows Azure release we are integrating Windows Azure Active Directory even more within the core Windows Azure management experience, and enabling an even richer enterprise security offering.  Specifically: 1) All Windows Azure accounts now have a default Windows Azure Active Directory created for them.  You can create and map any users you want into this directory, and grant administrative rights to manage resources in Windows Azure to these users. 2) You can keep this directory entirely hosted in the cloud – or optionally sync it with your on-premises Windows Server Active Directory.  Both options are free.  The later approach is ideal for companies that wish to use their corporate user identities to sign-in and manage Windows Azure resources.  It also ensures that if an employee leaves an organization, his or her access control rights to the company’s Windows Azure resources are immediately revoked. 3) The Windows Azure Service Management APIs have been updated to support using Windows Azure Active Directory credentials to sign-in and perform management operations.  Prior to today’s release customers had to download and use management certificates (which were not scoped to individual users) to perform management operations.  We still support this management certificate approach (don’t worry – nothing will stop working).  But we think the new Windows Azure Active Directory authentication support enables an even easier and more secure way for customers to manage resources going forward.  4) The Windows Azure SDK 2.2 release (which is also shipping today) includes built-in support for the new Service Management APIs that authenticate with Windows Azure Active Directory, and now allow you to create and manage Windows Azure applications and resources directly within Visual Studio using your Active Directory credentials.  This, combined with updated PowerShell scripts that also support Active Directory, enables an end-to-end enterprise authentication story with Windows Azure. Below are some details on how all of this works: Subscriptions within a Directory As part of today’s update, we have associated all existing Window Azure accounts with a Windows Azure Active Directory (and created one for you if you don’t already have one). When you login to the Windows Azure Management Portal you’ll now see the directory name in the URI of the browser.  For example, in the screen-shot below you can see that I have a “scottgu” directory that my subscriptions are hosted within: Note that you can continue to use Microsoft Accounts (formerly known as Microsoft Live IDs) to sign-into Windows Azure.  These map just fine to a Windows Azure Active Directory – so there is no need to create new usernames that are specific to a directory if you don’t want to.  In the scenario above I’m actually logged in using my @hotmail.com based Microsoft ID which is now mapped to a “scottgu” active directory that was created for me.  By default everything will continue to work just like you used to before. Manage your Directory You can manage an Active Directory (including the one we now create for you by default) by clicking the “Active Directory” tab in the left-hand side of the portal.  This will list all of the directories in your account.  Clicking one the first time will display a getting started page that provides documentation and links to perform common tasks with it: You can use the built-in directory management support within the Windows Azure Management Portal to add/remove/manage users within the directory, enable multi-factor authentication, associate a custom domain (e.g. mycompanyname.com) with the directory, and/or rename the directory to whatever friendly name you want (just click the configure tab to do this).  You can also setup the directory to automatically sync with an on-premises Active Directory using the “Directory Integration” tab. Note that users within a directory by default do not have admin rights to login or manage Windows Azure based resources.  You still need to explicitly grant them co-admin permissions on a subscription for them to login or manage resources in Windows Azure.  You can do this by clicking the Settings tab on the left-hand side of the portal and then by clicking the administrators tab within it. Sign-In Integration within Visual Studio If you install the new Windows Azure SDK 2.2 release, you can now connect to Windows Azure from directly inside Visual Studio without having to download any management certificates.  You can now just right-click on the “Windows Azure” icon within the Server Explorer and choose the “Connect to Windows Azure” context menu option to do so: Doing this will prompt you to enter the email address of the username you wish to sign-in with (make sure this account is a user in your directory with co-admin rights on a subscription): You can use either a Microsoft Account (e.g. Windows Live ID) or an Active Directory based Organizational account as the email.  The dialog will update with an appropriate login prompt depending on which type of email address you enter: Once you sign-in you’ll see the Windows Azure resources that you have permissions to manage show up automatically within the Visual Studio server explorer and be available to start using: No downloading of management certificates required.  All of the authentication was handled using your Windows Azure Active Directory! Manage Subscriptions across Multiple Directories If you have already have multiple directories and multiple subscriptions within your Windows Azure account, we have done our best to create a good default mapping of your subscriptions->directories as part of today’s update.  If you don’t like the default subscription-to-directory mapping we have done you can click the Settings tab in the left-hand navigation of the Windows Azure Management Portal and browse to the Subscriptions tab within it: If you want to map a subscription under a different directory in your account, simply select the subscription from the list, and then click the “Edit Directory” button to choose which directory to map it to.  Mapping a subscription to a different directory takes only seconds and will not cause any of the resources within the subscription to recycle or stop working.  We’ve made the directory->subscription mapping process self-service so that you always have complete control and can map things however you want. Filtering By Directory and Subscription Within the Windows Azure Management Portal you can filter resources in the portal by subscription (allowing you to show/hide different subscriptions).  If you have subscriptions mapped to multiple directory tenants, we also now have a filter drop-down that allows you to filter the subscription list by directory tenant.  This filter is only available if you have multiple subscriptions mapped to multiple directories within your Windows Azure Account:   Windows Azure SDK 2.2 Today we are also releasing a major update of our Windows Azure SDK.  The Windows Azure SDK 2.2 release adds some great new features including: Visual Studio 2013 Support Integrated Windows Azure Sign-In support within Visual Studio Remote Debugging Cloud Services with Visual Studio Firewall Management support within Visual Studio for SQL Databases Visual Studio 2013 RTM VM Images for MSDN Subscribers Windows Azure Management Libraries for .NET Updated Windows Azure PowerShell Cmdlets and ScriptCenter I’ll post a follow-up blog shortly with more details about all of the above. Additional Updates In addition to the above enhancements, today’s release also includes a number of additional improvements: AutoScale: Richer time and date based scheduling support (set different rules on different dates) AutoScale: Ability to Scale to Zero Virtual Machines (very useful for Dev/Test scenarios) AutoScale: Support for time-based scheduling of Mobile Service AutoScale rules Operation Logs: Auditing support for Service Bus management operations Today we also shipped a major update to the Windows Azure SDK – Windows Azure SDK 2.2.  It has so much goodness in it that I have a whole second blog post coming shortly on it! :-) Summary Today’s Windows Azure release enables a bunch of great new scenarios, and enables a much richer enterprise authentication offering. If you don’t already have a Windows Azure account, you can sign-up for a free trial and start using all of the above features today.  Then visit the Windows Azure Developer Center to learn more about how to build apps with it. Hope this helps, Scott P.S. In addition to blogging, I am also now using Twitter for quick updates and to share links. Follow me at: twitter.com/scottgu

  Read the article

• An Introduction to Meteor

  - by Stephen.Walther

  The goal of this blog post is to give you a brief introduction to Meteor which is a framework for building Single Page Apps. In this blog entry, I provide a walkthrough of building a simple Movie database app. What is special about Meteor? Meteor has two jaw-dropping features: Live HTML – If you make any changes to the HTML, CSS, JavaScript, or data on the server then every client shows the changes automatically without a browser refresh. For example, if you change the background color of a page to yellow then every open browser will show the new yellow background color without a refresh. Or, if you add a new movie to a collection of movies, then every open browser will display the new movie automatically. With Live HTML, users no longer need a refresh button. Changes to an application happen everywhere automatically without any effort. The Meteor framework handles all of the messy details of keeping all of the clients in sync with the server for you. Latency Compensation – When you modify data on the client, these modifications appear as if they happened on the server without any delay. For example, if you create a new movie then the movie appears instantly. However, that is all an illusion. In the background, Meteor updates the database with the new movie. If, for whatever reason, the movie cannot be added to the database then Meteor removes the movie from the client automatically. Latency compensation is extremely important for creating a responsive web application. You want the user to be able to make instant modifications in the browser and the framework to handle the details of updating the database without slowing down the user. Installing Meteor Meteor is licensed under the open-source MIT license and you can start building production apps with the framework right now. Be warned that Meteor is still in the “early preview” stage. It has not reached a 1.0 release. According to the Meteor FAQ, Meteor will reach version 1.0 in “More than a month, less than a year.” Don’t be scared away by that. You should be aware that, unlike most open source projects, Meteor has financial backing. The Meteor project received an $11.2 million round of financing from Andreessen Horowitz. So, it would be a good bet that this project will reach the 1.0 mark. And, if it doesn’t, the framework as it exists right now is still very powerful. Meteor runs on top of Node.js. You write Meteor apps by writing JavaScript which runs both on the client and on the server. You can build Meteor apps on Windows, Mac, or Linux (Although the support for Windows is still officially unofficial). If you want to install Meteor on Windows then download the MSI from the following URL: http://win.meteor.com/ If you want to install Meteor on Mac/Linux then run the following CURL command from your terminal: curl https://install.meteor.com | /bin/sh Meteor will install all of its dependencies automatically including Node.js. However, I recommend that you install Node.js before installing Meteor by installing Node.js from the following address: http://nodejs.org/ If you let Meteor install Node.js then Meteor won’t install NPM which is the standard package manager for Node.js. If you install Node.js and then you install Meteor then you get NPM automatically. Creating a New Meteor App To get a sense of how Meteor works, I am going to walk through the steps required to create a simple Movie database app. Our app will display a list of movies and contain a form for creating a new movie. The first thing that we need to do is create our new Meteor app. Open a command prompt/terminal window and execute the following command: Meteor create MovieApp After you execute this command, you should see something like the following: Follow the instructions: execute cd MovieApp to change to your MovieApp directory, and run the meteor command. Executing the meteor command starts Meteor on port 3000. Open up your favorite web browser and navigate to http://localhost:3000 and you should see the default Meteor Hello World page: Open up your favorite development environment to see what the Meteor app looks like. Open the MovieApp folder which we just created. Here’s what the MovieApp looks like in Visual Studio 2012: Notice that our MovieApp contains three files named MovieApp.css, MovieApp.html, and MovieApp.js. In other words, it contains a Cascading Style Sheet file, an HTML file, and a JavaScript file. Just for fun, let’s see how the Live HTML feature works. Open up multiple browsers and point each browser at http://localhost:3000. Now, open the MovieApp.html page and modify the text “Hello World!” to “Hello Cruel World!” and save the change. The text in all of the browsers should update automatically without a browser refresh. Pretty amazing, right? Controlling Where JavaScript Executes You write a Meteor app using JavaScript. Some of the JavaScript executes on the client (the browser) and some of the JavaScript executes on the server and some of the JavaScript executes in both places. For a super simple app, you can use the Meteor.isServer and Meteor.isClient properties to control where your JavaScript code executes. For example, the following JavaScript contains a section of code which executes on the server and a section of code which executes in the browser: if (Meteor.isClient) { console.log("Hello Browser!"); } if (Meteor.isServer) { console.log("Hello Server!"); } console.log("Hello Browser and Server!"); When you run the app, the message “Hello Browser!” is written to the browser JavaScript console. The message “Hello Server!” is written to the command/terminal window where you ran Meteor. Finally, the message “Hello Browser and Server!” is execute on both the browser and server and the message appears in both places. For simple apps, using Meteor.isClient and Meteor.isServer to control where JavaScript executes is fine. For more complex apps, you should create separate folders for your server and client code. Here are the folders which you can use in a Meteor app: · client – This folder contains any JavaScript which executes only on the client. · server – This folder contains any JavaScript which executes only on the server. · common – This folder contains any JavaScript code which executes on both the client and server. · lib – This folder contains any JavaScript files which you want to execute before any other JavaScript files. · public – This folder contains static application assets such as images. For the Movie App, we need the client, server, and common folders. Delete the existing MovieApp.js, MovieApp.html, and MovieApp.css files. We will create new files in the right locations later in this walkthrough. Combining HTML, CSS, and JavaScript Files Meteor combines all of your JavaScript files, and all of your Cascading Style Sheet files, and all of your HTML files automatically. If you want to create one humongous JavaScript file which contains all of the code for your app then that is your business. However, if you want to build a more maintainable application, then you should break your JavaScript files into many separate JavaScript files and let Meteor combine them for you. Meteor also combines all of your HTML files into a single file. HTML files are allowed to have the following top-level elements: <head> — All <head> files are combined into a single <head> and served with the initial page load. <body> — All <body> files are combined into a single <body> and served with the initial page load. <template> — All <template> files are compiled into JavaScript templates. Because you are creating a single page app, a Meteor app typically will contain a single HTML file for the <head> and <body> content. However, a Meteor app typically will contain several template files. In other words, all of the interesting stuff happens within the <template> files. Displaying a List of Movies Let me start building the Movie App by displaying a list of movies. In order to display a list of movies, we need to create the following four files: · client\movies.html – Contains the HTML for the <head> and <body> of the page for the Movie app. · client\moviesTemplate.html – Contains the HTML template for displaying the list of movies. · client\movies.js – Contains the JavaScript for supplying data to the moviesTemplate. · server\movies.js – Contains the JavaScript for seeding the database with movies. After you create these files, your folder structure should looks like this: Here’s what the client\movies.html file looks like: <head> <title>My Movie App</title> </head> <body> <h1>Movies</h1> {{> moviesTemplate }} </body>   Notice that it contains <head> and <body> top-level elements. The <body> element includes the moviesTemplate with the syntax {{> moviesTemplate }}. The moviesTemplate is defined in the client/moviesTemplate.html file: <template name="moviesTemplate"> <ul> {{#each movies}} <li> {{title}} </li> {{/each}} </ul> </template> By default, Meteor uses the Handlebars templating library. In the moviesTemplate above, Handlebars is used to loop through each of the movies using {{#each}}…{{/each}} and display the title for each movie using {{title}}. The client\movies.js JavaScript file is used to bind the moviesTemplate to the Movies collection on the client. Here’s what this JavaScript file looks like: // Declare client Movies collection Movies = new Meteor.Collection("movies"); // Bind moviesTemplate to Movies collection Template.moviesTemplate.movies = function () { return Movies.find(); }; The Movies collection is a client-side proxy for the server-side Movies database collection. Whenever you want to interact with the collection of Movies stored in the database, you use the Movies collection instead of communicating back to the server. The moviesTemplate is bound to the Movies collection by assigning a function to the Template.moviesTemplate.movies property. The function simply returns all of the movies from the Movies collection. The final file which we need is the server-side server\movies.js file: // Declare server Movies collection Movies = new Meteor.Collection("movies"); // Seed the movie database with a few movies Meteor.startup(function () { if (Movies.find().count() == 0) { Movies.insert({ title: "Star Wars", director: "Lucas" }); Movies.insert({ title: "Memento", director: "Nolan" }); Movies.insert({ title: "King Kong", director: "Jackson" }); } }); The server\movies.js file does two things. First, it declares the server-side Meteor Movies collection. When you declare a server-side Meteor collection, a collection is created in the MongoDB database associated with your Meteor app automatically (Meteor uses MongoDB as its database automatically). Second, the server\movies.js file seeds the Movies collection (MongoDB collection) with three movies. Seeding the database gives us some movies to look at when we open the Movies app in a browser. Creating New Movies Let me modify the Movies Database App so that we can add new movies to the database of movies. First, I need to create a new template file – named client\movieForm.html – which contains an HTML form for creating a new movie: <template name="movieForm"> <fieldset> <legend>Add New Movie</legend> <form> <div> <label> Title: <input id="title" /> </label> </div> <div> <label> Director: <input id="director" /> </label> </div> <div> <input type="submit" value="Add Movie" /> </div> </form> </fieldset> </template> In order for the new form to show up, I need to modify the client\movies.html file to include the movieForm.html template. Notice that I added {{> movieForm }} to the client\movies.html file: <head> <title>My Movie App</title> </head> <body> <h1>Movies</h1> {{> moviesTemplate }} {{> movieForm }} </body> After I make these modifications, our Movie app will display the form: The next step is to handle the submit event for the movie form. Below, I’ve modified the client\movies.js file so that it contains a handler for the submit event raised when you submit the form contained in the movieForm.html template: // Declare client Movies collection Movies = new Meteor.Collection("movies"); // Bind moviesTemplate to Movies collection Template.moviesTemplate.movies = function () { return Movies.find(); }; // Handle movieForm events Template.movieForm.events = { 'submit': function (e, tmpl) { // Don't postback e.preventDefault(); // create the new movie var newMovie = { title: tmpl.find("#title").value, director: tmpl.find("#director").value }; // add the movie to the db Movies.insert(newMovie); } }; The Template.movieForm.events property contains an event map which maps event names to handlers. In this case, I am mapping the form submit event to an anonymous function which handles the event. In the event handler, I am first preventing a postback by calling e.preventDefault(). This is a single page app, no postbacks are allowed! Next, I am grabbing the new movie from the HTML form. I’m taking advantage of the template find() method to retrieve the form field values. Finally, I am calling Movies.insert() to insert the new movie into the Movies collection. Here, I am explicitly inserting the new movie into the client-side Movies collection. Meteor inserts the new movie into the server-side Movies collection behind the scenes. When Meteor inserts the movie into the server-side collection, the new movie is added to the MongoDB database associated with the Movies app automatically. If server-side insertion fails for whatever reasons – for example, your internet connection is lost – then Meteor will remove the movie from the client-side Movies collection automatically. In other words, Meteor takes care of keeping the client Movies collection and the server Movies collection in sync. If you open multiple browsers, and add movies, then you should notice that all of the movies appear on all of the open browser automatically. You don’t need to refresh individual browsers to update the client-side Movies collection. Meteor keeps everything synchronized between the browsers and server for you. Removing the Insecure Module To make it easier to develop and debug a new Meteor app, by default, you can modify the database directly from the client. For example, you can delete all of the data in the database by opening up your browser console window and executing multiple Movies.remove() commands. Obviously, enabling anyone to modify your database from the browser is not a good idea in a production application. Before you make a Meteor app public, you should first run the meteor remove insecure command from a command/terminal window: Running meteor remove insecure removes the insecure package from the Movie app. Unfortunately, it also breaks our Movie app. We’ll get an “Access denied” error in our browser console whenever we try to insert a new movie. No worries. I’ll fix this issue in the next section. Creating Meteor Methods By taking advantage of Meteor Methods, you can create methods which can be invoked on both the client and the server. By taking advantage of Meteor Methods you can: 1. Perform form validation on both the client and the server. For example, even if an evil hacker bypasses your client code, you can still prevent the hacker from submitting an invalid value for a form field by enforcing validation on the server. 2. Simulate database operations on the client but actually perform the operations on the server. Let me show you how we can modify our Movie app so it uses Meteor Methods to insert a new movie. First, we need to create a new file named common\methods.js which contains the definition of our Meteor Methods: Meteor.methods({ addMovie: function (newMovie) { // Perform form validation if (newMovie.title == "") { throw new Meteor.Error(413, "Missing title!"); } if (newMovie.director == "") { throw new Meteor.Error(413, "Missing director!"); } // Insert movie (simulate on client, do it on server) return Movies.insert(newMovie); } }); The addMovie() method is called from both the client and the server. This method does two things. First, it performs some basic validation. If you don’t enter a title or you don’t enter a director then an error is thrown. Second, the addMovie() method inserts the new movie into the Movies collection. When called on the client, inserting the new movie into the Movies collection just updates the collection. When called on the server, inserting the new movie into the Movies collection causes the database (MongoDB) to be updated with the new movie. You must add the common\methods.js file to the common folder so it will get executed on both the client and the server. Our folder structure now looks like this: We actually call the addMovie() method within our client code in the client\movies.js file. Here’s what the updated file looks like: // Declare client Movies collection Movies = new Meteor.Collection("movies"); // Bind moviesTemplate to Movies collection Template.moviesTemplate.movies = function () { return Movies.find(); }; // Handle movieForm events Template.movieForm.events = { 'submit': function (e, tmpl) { // Don't postback e.preventDefault(); // create the new movie var newMovie = { title: tmpl.find("#title").value, director: tmpl.find("#director").value }; // add the movie to the db Meteor.call( "addMovie", newMovie, function (err, result) { if (err) { alert("Could not add movie " + err.reason); } } ); } }; The addMovie() method is called – on both the client and the server – by calling the Meteor.call() method. This method accepts the following parameters: · The string name of the method to call. · The data to pass to the method (You can actually pass multiple params for the data if you like). · A callback function to invoke after the method completes. In the JavaScript code above, the addMovie() method is called with the new movie retrieved from the HTML form. The callback checks for an error. If there is an error then the error reason is displayed in an alert (please don’t use alerts for validation errors in a production app because they are ugly!). Summary The goal of this blog post was to provide you with a brief walk through of a simple Meteor app. I showed you how you can create a simple Movie Database app which enables you to display a list of movies and create new movies. I also explained why it is important to remove the Meteor insecure package from a production app. I showed you how to use Meteor Methods to insert data into the database instead of doing it directly from the client. I’m very impressed with the Meteor framework. The support for Live HTML and Latency Compensation are required features for many real world Single Page Apps but implementing these features by hand is not easy. Meteor makes it easy.

  Read the article

• Rounded Corners and Shadows &ndash; Dialogs with CSS

  - by Rick Strahl

  Well, it looks like we’ve finally arrived at a place where at least all of the latest versions of main stream browsers support rounded corners and box shadows. The two CSS properties that make this possible are box-shadow and box-radius. Both of these CSS Properties now supported in all the major browsers as shown in this chart from QuirksMode: In it’s simplest form you can use box-shadow and border radius like this: .boxshadow { -moz-box-shadow: 3px 3px 5px #535353; -webkit-box-shadow: 3px 3px 5px #535353; box-shadow: 3px 3px 5px #535353; } .roundbox { -moz-border-radius: 6px 6px 6px 6px; -webkit-border-radius: 6px; border-radius: 6px 6px 6px 6px; } box-shadow: horizontal-shadow-pixels vertical-shadow-pixels blur-distance shadow-color box-shadow attributes specify the the horizontal and vertical offset of the shadow, the blur distance (to give the shadow a smooth soft look) and a shadow color. The spec also supports multiple shadows separated by commas using the attributes above but we’re not using that functionality here. box-radius: top-left-radius top-right-radius bottom-right-radius bottom-left-radius border-radius takes a pixel size for the radius for each corner going clockwise. CSS 3 also specifies each of the individual corner elements such as border-top-left-radius, but support for these is much less prevalent so I would recommend not using them for now until support improves. Instead use the single box-radius to specify all corners. Browser specific Support in older Browsers Notice that there are two variations: The actual CSS 3 properties (box-shadow and box-radius) and the browser specific ones (-moz, –webkit prefixes for FireFox and Chrome/Safari respectively) which work in slightly older versions of modern browsers before official CSS 3 support was added. The goal is to spread support as widely as possible and the prefix versions extend the range slightly more to those browsers that provided early support for these features. Notice that box-shadow and border-radius are used after the browser specific versions to ensure that the latter versions get precedence if the browser supports both (last assignment wins). Use the .boxshadow and .roundbox Styles in HTML To use these two styles create a simple rounded box with a shadow you can use HTML like this: <!-- Simple Box with rounded corners and shadow --> <div class="roundbox boxshadow" style="width: 550px; border: solid 2px steelblue"> <div class="boxcontenttext"> Simple Rounded Corner Box. </div> </div> which looks like this in the browser: This works across browsers and it’s pretty sweet and simple. Watch out for nested Elements! There are a couple of things to be aware of however when using rounded corners. Specifically, you need to be careful when you nest other non-transparent content into the rounded box. For example check out what happens when I change the inside <div> to have a colored background: <!-- Simple Box with rounded corners and shadow --> <div class="roundbox boxshadow" style="width: 550px; border: solid 2px steelblue"> <div class="boxcontenttext" style="background: khaki;"> Simple Rounded Corner Box. </div> </div> which renders like this:   If you look closely you’ll find that the inside <div>’s corners are not rounded and so ‘poke out’ slightly over the rounded corners. It looks like the rounded corners are ‘broken’ up instead of a solid rounded line around the corner, which his pretty ugly. The bigger the radius the more drastic this effect becomes . To fix this issue the inner <div> also has have rounded corners at the same or slightly smaller radius than the outer <div>. The simple fix for this is to simply also apply the roundbox style to the inner <div> in addition to the boxcontenttext style already applied: <div class="boxcontenttext roundbox" style="background: khaki;"> The fixed display now looks proper: Separate Top and Bottom Elements This gets even a little more tricky if you have an element at the top or bottom only of the rounded box. What if you need to add something like a header or footer <div> that have non-transparent backgrounds which is a pretty common scenario? In those cases you want only the top or bottom corners rounded and not both. To make this work a couple of additional styles to round only the top and bottom corners can be created: .roundbox-top { -moz-border-radius: 4px 4px 0 0; -webkit-border-radius: 4px 4px 0 0; border-radius: 4px 4px 0 0; } .roundbox-bottom { -moz-border-radius: 0 0 4px 4px; -webkit-border-radius: 0 0 4px 4px; border-radius: 0 0 4px 4px; } Notice that radius used for the ‘inside’ rounding is smaller (4px) than the outside radius (6px). This is so the inner radius fills into the outer border – if you use the same size you may have some white space showing between inner and out rounded corners. Experiment with values to see what works – in my experimenting the behavior across browsers here is consistent (thankfully). These styles can be applied in addition to other styles to make only the top or bottom portions of an element rounded. For example imagine I have styles like this: .gridheader, .gridheaderbig, .gridheaderleft, .gridheaderright { padding: 4px 4px 4px 4px; background: #003399 url(images/vertgradient.png) repeat-x; text-align: center; font-weight: bold; text-decoration: none; color: khaki; } .gridheaderleft { text-align: left; } .gridheaderright { text-align: right; } .gridheaderbig { font-size: 135%; } If I just apply say gridheader by itself in HTML like this: <div class="roundbox boxshadow" style="width: 550px; border: solid 2px steelblue"> <div class="gridheaderleft">Box with a Header</div> <div class="boxcontenttext" style="background: khaki;"> Simple Rounded Corner Box. </div> </div> This results in a pretty funky display – again due to the fact that the inner elements render square rather than rounded corners: If you look close again you can see that both the header and the main content have square edges which jumps out at the eye. To fix this you can now apply the roundbox-top and roundbox-bottom to the header and content respectively: <div class="roundbox boxshadow" style="width: 550px; border: solid 2px steelblue"> <div class="gridheaderleft roundbox-top">Box with a Header</div> <div class="boxcontenttext roundbox-bottom" style="background: khaki;"> Simple Rounded Corner Box. </div> </div> Which now gives the proper display with rounded corners both on the top and bottom: All of this is sweet to be supported – at least by the newest browser – without having to resort to images and nasty JavaScripts solutions. While this is still not a mainstream feature yet for the majority of actually installed browsers, the majority of browser users are very likely to have this support as most browsers other than IE are actively pushing users to upgrade to newer versions. Since this is a ‘visual display only feature it degrades reasonably well in non-supporting browsers: You get an uninteresting square and non-shadowed browser box, but the display is still overall functional. The main sticking point – as always is Internet Explorer versions 8.0 and down as well as older versions of other browsers. With those browsers you get a functional view that is a little less interesting to look at obviously: but at least it’s still functional. Maybe that’s just one more incentive for people using older browsers to upgrade to a  more modern browser :-) Creating Dialog Related Styles In a lot of my AJAX based applications I use pop up windows which effectively work like dialogs. Using the simple CSS behaviors above, it’s really easy to create some fairly nice looking overlaid windows with nothing but CSS. Here’s what a typical ‘dialog’ I use looks like: The beauty of this is that it’s plain CSS – no plug-ins or images (other than the gradients which are optional) required. Add jQuery-ui draggable (or ww.jquery.js as shown below) and you have a nice simple inline implementation of a dialog represented by a simple <div> tag. Here’s the HTML for this dialog: <div id="divDialog" class="dialog boxshadow" style="width: 450px;"> <div class="dialog-header"> <div class="closebox"></div> User Sign-in </div> <div class="dialog-content"> <label>Username:</label> <input type="text" name="txtUsername" value=" " /> <label>Password</label> <input type="text" name="txtPassword" value=" " /> <hr /> <input type="button" id="btnLogin" value="Login" /> </div> <div class="dialog-statusbar">Ready</div> </div> Most of this behavior is driven by the ‘dialog’ styles which are fairly basic and easy to understand. They do use a few support images for the gradients which are provided in the sample I’ve provided. Here’s what the CSS looks like: .dialog { background: White; overflow: hidden; border: solid 1px steelblue; -moz-border-radius: 6px 6px 4px 4px; -webkit-border-radius: 6px 6px 4px 4px; border-radius: 6px 6px 3px 3px; } .dialog-header { background-image: url(images/dialogheader.png); background-repeat: repeat-x; text-align: left; color: cornsilk; padding: 5px; padding-left: 10px; font-size: 1.02em; font-weight: bold; position: relative; -moz-border-radius: 4px 4px 0px 0px; -webkit-border-radius: 4px 4px 0px 0px; border-radius: 4px 4px 0px 0px; } .dialog-top { -moz-border-radius: 4px 4px 0px 0px; -webkit-border-radius: 4px 4px 0px 0px; border-radius: 4px 4px 0px 0px; } .dialog-bottom { -moz-border-radius: 0 0 3px 3px; -webkit-border-radius: 0 0 3px 3px; border-radius: 0 0 3px 3px; } .dialog-content { padding: 15px; } .dialog-statusbar, .dialog-toolbar { background: #eeeeee; background-image: url(images/dialogstrip.png); background-repeat: repeat-x; padding: 5px; padding-left: 10px; border-top: solid 1px silver; border-bottom: solid 1px silver; font-size: 0.8em; } .dialog-statusbar { -moz-border-radius: 0 0 3px 3px; -webkit-border-radius: 0 0 3px 3px; border-radius: 0 0 3px 3px; padding-right: 10px; } .closebox { position: absolute; right: 2px; top: 2px; background-image: url(images/close.gif); background-repeat: no-repeat; width: 14px; height: 14px; cursor: pointer; opacity: 0.60; filter: alpha(opacity="80"); } .closebox:hover { opacity: 1; filter: alpha(opacity="100"); } The main style is the dialog class which is the outer box. It has the rounded border that serves as the outline. Note that I didn’t add the box-shadow to this style because in some situations I just want the rounded box in an inline display that doesn’t have a shadow so it’s still applied separately. dialog-header, then has the rounded top corners and displays a typical dialog heading format. dialog-bottom and dialog-top then provide the same functionality as roundbox-top and roundbox-bottom described earlier but are provided mainly in the stylesheet for consistency to match the dialog’s round edges and making it easier to  remember and find in Intellisense as it shows up in the same dialog- group. dialog-statusbar and dialog-toolbar are two elements I use a lot for floating windows – the toolbar serves for buttons and options and filters typically, while the status bar provides information specific to the floating window. Since the the status bar is always on the bottom of the dialog it automatically handles the rounding of the bottom corners. Finally there’s  closebox style which is to be applied to an empty <div> tag in the header typically. What this does is render a close image that is by default low-lighted with a low opacity value, and then highlights when hovered over. All you’d have to do handle the close operation is handle the onclick of the <div>. Note that the <div> right aligns so typically you should specify it before any other content in the header. Speaking of closable – some time ago I created a closable jQuery plug-in that basically automates this process and can be applied against ANY element in a page, automatically removing or closing the element with some simple script code. Using this you can leave out the <div> tag for closable and just do the following: To make the above dialog closable (and draggable) which makes it effectively and overlay window, you’d add jQuery.js and ww.jquery.js to the page: <script type="text/javascript" src="../../scripts/jquery.min.js"></script> <script type="text/javascript" src="../../scripts/ww.jquery.min.js"></script> and then simply call: <script type="text/javascript"> $(document).ready(function () { $("#divDialog") .draggable({ handle: ".dialog-header" }) .closable({ handle: ".dialog-header", closeHandler: function () { alert("Window about to be closed."); return true; // true closes - false leaves open } }); }); </script> * ww.jquery.js emulates base features in jQuery-ui’s draggable. If jQuery-ui is loaded its draggable version will be used instead and voila you have now have a draggable and closable window – here in mid-drag:   The dragging and closable behaviors are of course optional, but it’s the final touch that provides dialog like window behavior. Relief for older Internet Explorer Versions with CSS Pie If you want to get these features to work with older versions of Internet Explorer all the way back to version 6 you can check out CSS Pie. CSS Pie provides an Internet Explorer behavior file that attaches to specific CSS rules and simulates these behavior using script code in IE (mostly by implementing filters). You can simply add the behavior to each CSS style that uses box-shadow and border-radius like this: .boxshadow {     -moz-box-shadow: 3px 3px 5px #535353;     -webkit-box-shadow: 3px 3px 5px #535353;           box-shadow: 3px 3px 5px #535353;     behavior: url(scripts/PIE.htc);           } .roundbox {      -moz-border-radius: 6px 6px 6px 6px;     -webkit-border-radius: 6px;      border-radius: 6px 6px 6px 6px;     behavior: url(scripts/PIE.htc); } CSS Pie requires the PIE.htc on your server and referenced from each CSS style that needs it. Note that the url() for IE behaviors is NOT CSS file relative as other CSS resources, but rather PAGE relative , so if you have more than one folder you probably need to reference the HTC file with a fixed path like this: behavior: url(/MyApp/scripts/PIE.htc); in the style. Small price to pay, but a royal pain if you have a common CSS file you use in many applications. Once the PIE.htc file has been copied and you have applied the behavior to each style that uses these new features Internet Explorer will render rounded corners and box shadows! Yay! Hurray for box-shadow and border-radius All of this functionality is very welcome natively in the browser. If you think this is all frivolous visual candy, you might be right :-), but if you take a look on the Web and search for rounded corner solutions that predate these CSS attributes you’ll find a boatload of stuff from image files, to custom drawn content to Javascript solutions that play tricks with a few images. It’s sooooo much easier to have this functionality built in and I for one am glad to see that’s it’s finally becoming standard in the box. Still remember that when you use these new CSS features, they are not universal, and are not going to be really soon. Legacy browsers, especially old versions of Internet Explorer that can’t be updated will continue to be around and won’t work with this shiny new stuff. I say screw ‘em: Let them get a decent recent browser or see a degraded and ugly UI. We have the luxury with this functionality in that it doesn’t typically affect usability – it just doesn’t look as nice. Resources Download the Sample The sample includes the styles and images and sample page as well as ww.jquery.js for the draggable/closable example. Online Sample Check out the sample described in this post online. Closable and Draggable Documentation Documentation for the closeable and draggable plug-ins in ww.jquery.js. You can also check out the full documentation for all the plug-ins contained in ww.jquery.js here. © Rick Strahl, West Wind Technologies, 2005-2011Posted in HTML  CSS  

  Read the article

• Tips on Migrating from AquaLogic .NET Accelerator to WebCenter WSRP Producer for .NET

  - by user647124

  This year I embarked on a journey to migrate a group of ASP.NET web applications developed to integrate with WebLogic Portal 9.2 via the AquaLogic® Interaction .NET Application Accelerator 1.0 to instead use the Oracle WebCenter WSRP Producer for .NET and integrated with WebLogic Portal 10.3.4. It has been a very winding path and this blog entry is intended to share both the lessons learned and relevant approaches that led to those learnings. Like most journeys of discovery, it was not a direct path, and there are notes to let you know when it is practical to skip a section if you are in a hurry to get from here to there. For the Curious From the perspective of necessity, this section would be better at the end. If it were there, though, it would probably be read by far fewer people, including those that are actually interested in these types of sections. Those in a hurry may skip past and be none the worst for it in dealing with the hands-on bits of performing a migration from .NET Accelerator to WSRP Producer. For others who want to talk about why they did what they did after they did it, or just want to know for themselves, enjoy. A Brief (and edited) History of the WSRP for .NET Technologies (as Relevant to the this Post) Note: This section is for those who are curious about why the migration path is not as simple as many other Oracle technologies. You can skip this section in its entirety and still be just as competent in performing a migration as if you had read it. The currently deployed architecture that was to be migrated and upgraded achieved initial integration between .NET and J2EE over the WSRP protocol through the use of The AquaLogic Interaction .NET Application Accelerator. The .NET Accelerator allowed the applications that were written in ASP.NET and deployed on a Microsoft Internet Information Server (IIS) to interact with a WebLogic Portal application deployed on a WebLogic (J2EE application) Server (both version 9.2, the state of the art at the time of its creation). At the time this architectural decision for the application was made, both the AquaLogic and WebLogic brands were owned by BEA Systems. The AquaLogic brand included products acquired by BEA through the acquisition of Plumtree, whose flagship product was a portal platform available in both J2EE and .NET versions. As part of this dual technology support an adaptor was created to facilitate the use of WSRP as a communication protocol where customers wished to integrate components from both versions of the Plumtree portal. The adapter evolved over several product generations to include a broad array of both standard and proprietary WSRP integration capabilities. Later, BEA Systems was acquired by Oracle. Over the course of several years Oracle has acquired a large number of portal applications and has taken the strategic direction to migrate users of these myriad (and formerly competitive) products to the Oracle WebCenter technology stack. As part of Oracle’s strategic technology roadmap, older portal products are being schedule for end of life, including the portal products that were part of the BEA acquisition. The .NET Accelerator has been modified over a very long period of time with features driven by users of that product and developed under three different vendors (each a direct competitor in the same solution space prior to merger). The Oracle WebCenter WSRP Producer for .NET was introduced much more recently with the key objective to specifically address the needs of the WebCenter customers developing solutions accessible through both J2EE and .NET platforms utilizing the WSRP specifications. The Oracle Product Development Team also provides these insights on the drivers for developing the WSRP Producer: ***************************************** Support for ASP.NET AJAX. Controls using the ASP.NET AJAX script manager do not function properly in the Application Accelerator for .NET. Support 2 way SSL in WLP. This was not possible with the proxy/bridge set up in the existing Application Accelerator for .NET. Allow developers to code portlets (Web Parts) using the .NET framework rather than a proprietary framework. Developers had to use the Application Accelerator for .NET plug-ins to Visual Studio to manage preferences and profile data. This is now replaced with the .NET Framework Personalization (for preferences) and Profile providers. The WSRP Producer for .NET was created as a new way of developing .NET portlets. It was never designed to be an upgrade path for the Application Accelerator for .NET. .NET developers would create new .NET portlets with the WSRP Producer for .NET and leave any existing .NET portlets running in the Application Accelerator for .NET. ***************************************** The advantage to creating a new solution for WSRP is a product that is far easier for Oracle to maintain and support which in turn improves quality, reliability and maintainability for their customers. No changes to J2EE applications consuming the WSRP portlets previously rendered by the.NET Accelerator is required to migrate from the Aqualogic WSRP solution. For some customers using the .NET Accelerator the challenge is adapting their current .NET applications to work with the WSRP Producer (or any other WSRP adapter as they are proprietary by nature). Part of this adaptation is the need to deploy the .NET applications as a child to the WSRP producer web application as root. Differences between .NET Accelerator and WSRP Producer Note: This section is for those who are curious about why the migration is not as pluggable as something such as changing security providers in WebLogic Server. You can skip this section in its entirety and still be just as competent in performing a migration as if you had read it. The basic terminology used to describe the participating applications in a WSRP environment are the same when applied to either the .NET Accelerator or the WSRP Producer: Producer and Consumer. In both cases the .NET application serves as what is referred to as a WSRP environment as the Producer. The difference lies in how the two adapters create the WSRP translation of the .NET application. The .NET Accelerator, as the name implies, is meant to serve as a quick way of adding WSRP capability to a .NET application. As such, at a high level, the .NET Accelerator behaves as a proxy for requests between the .NET application and the WSRP Consumer. A WSRP request is sent from the consumer to the .NET Accelerator, the.NET Accelerator transforms this request into an ASP.NET request, receives the response, then transforms the response into a WSRP response. The .NET Accelerator is deployed as a stand-alone application on IIS. The WSRP Producer is deployed as a parent application on IIS and all ASP.NET modules that will be made available over WSRP are deployed as children of the WSRP Producer application. In this manner, the WSRP Producer acts more as a Request Filter than a proxy in the WSRP transactions between Producer and Consumer. Highly Recommended Enabling Logging Note: You can skip this section now, but you will most likely want to come back to it later, so why not just read it now? Logging is very helpful in tracking down the causes of any anomalies during testing of migrated portlets. To enable the WSRP Producer logging, update the Application_Start method in the Global.asax.cs for your .NET application by adding log4net.Config.XmlConfigurator.Configure(); IIS logs will usually (in a standard configuration) be in a sub folder under C:\WINDOWS\system32\LogFiles\W3SVC. WSRP Producer logs will be found at C:\Oracle\Middleware\WSRPProducerForDotNet\wsrpdefault\Logs\WSRPProducer.log InputTrace.webinfo and OutputTrace.webinfo are located under C:\Oracle\Middleware\WSRPProducerForDotNet\wsrpdefault and can be useful in debugging issues related to markup transformations. Things You Must Do Merge Web.Config Note: If you have been skipping all the sections that you can, now is the time to stop and pay attention J Because the existing .NET application will become a sub-application to the WSRP Producer, you will want to merge required settings from the existing Web.Config to the one in the WSRP Producer. Use the WSRP Producer Master Page The Master Page installed for the WSRP Producer provides common, hiddenform fields and JavaScripts to facilitate portlet instance management and display configuration when the child page is being rendered over WSRP. You add the Master Page by including it in the <@ Page declaration with MasterPageFile="~/portlets/Resources/MasterPages/WSRP.Master" . You then replace: <!DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.0 Transitional//EN" > <HTML> <HEAD> With <asp:Content ID="ContentHead1" ContentPlaceHolderID="wsrphead" Runat="Server"> And </HEAD> <body> <form id="theForm" method="post" runat="server"> With </asp:Content> <asp:Content ID="ContentBody1" ContentPlaceHolderID="Main" Runat="Server"> And finally </form> </body> </HTML> With </asp:Content> In the event you already use Master Pages, adapt your existing Master Pages to be sub masters. See Nested ASP.NET Master Pages for a detailed reference of how to do this. It Happened to Me, It Might Happen to You…Or Not Watch for Use of Session or Request in OnInit In the event the .NET application being modified has pages developed to assume the user has been authenticated in an earlier page request there may be direct or indirect references in the OnInit method to request or session objects that may not have been created yet. This will vary from application to application, so the recommended approach is to test first. If there is an issue with a page running as a WSRP portlet then check for potential references in the OnInit method (including references by methods called within OnInit) to session or request objects. If there are, the simplest solution is to create a new method and then call that method once the necessary object(s) is fully available. I find doing this at the start of the Page_Load method to be the simplest solution. Case Sensitivity .NET languages are not case sensitive, but Java is. This means it is possible to have many variations of SRC= and src= or .JPG and .jpg. The preferred solution is to make these mark up instances all lower case in your .NET application. This will allow the default Rewriter rules in wsrp-producer.xml to work as is. If this is not practical, then make duplicates of any rules where an issue is occurring due to upper or mixed case usage in the .NET application markup and match the case in use with the duplicate rule. For example: <RewriterRule> <LookFor>(href=\"([^\"]+)</LookFor> <ChangeToAbsolute>true</ChangeToAbsolute> <ApplyTo>.axd,.css</ApplyTo> <MakeResource>true</MakeResource> </RewriterRule> May need to be duplicated as: <RewriterRule> <LookFor>(HREF=\"([^\"]+)</LookFor> <ChangeToAbsolute>true</ChangeToAbsolute> <ApplyTo>.axd,.css</ApplyTo> <MakeResource>true</MakeResource> </RewriterRule> While it is possible to write a regular expression that will handle mixed case usage, it would be long and strenous to test and maintain, so the recommendation is to use duplicate rules. Is it Still Relative? Some .NET applications base relative paths with a fixed root location. With the introduction of the WSRP Producer, the root has moved up one level. References to ~/ will need to be updated to ~/portlets and many ../ paths will need another ../ in front. I Can See You But I Can’t Find You This issue was first discovered while debugging modules with code that referenced the form on a page from the code-behind by name and/or id. The initial error presented itself as run-time error that was difficult to interpret over WSRP but seemed clear when run as straight ASP.NET as it indicated that the object with the form name did not exist. Since the form name was no longer valid after implementing the WSRP Master Page, the likely fix seemed to simply update the references in the code. However, as the WSRP Master Page is external to the code, a compile time error resulted: Error      155         The name 'form1' does not exist in the current context                C:\Oracle\Middleware\WSRPProducerForDotNet\wsrpdefault\portlets\legacywebsite\module\Screens \Reporting.aspx.cs                51           52           legacywebsite.module Much hair-pulling research later it was discovered that it was the use of the FindControl method causing the issue. FindControl doesn’t work quite as expected once a Master Page has been introduced as the controls become embedded in controls, require a recursion to find them that is not part of the FindControl method. In code where the page form is referenced by name, there are two steps to the solution. First, the form needs to be referenced in code generically with Page.Form. For example, this: ToggleControl ctrl = new ToggleControl(frmManualEntry, FunctionLibrary.ParseArrayLst(userObj.Roles)); Becomes this: ToggleControl ctrl = new ToggleControl(Page.Form, FunctionLibrary.ParseArrayLst(userObj.Roles)); Generally the form id is referenced in most ASP.NET applications as a path to a control on the form. To reach the control once a MasterPage has been added requires an additional method to recurse through the controls collections within the form and find the control ID. The following method (found at Rick Strahl's Web Log) corrects this very nicely: public static Control FindControlRecursive(Control Root, string Id) { if (Root.ID == Id) return Root; foreach (Control Ctl in Root.Controls) { Control FoundCtl = FindControlRecursive(Ctl, Id); if (FoundCtl != null) return FoundCtl; } return null; } Where the form name is not referenced, simply using the FindControlRecursive method in place of FindControl will be all that is necessary. Following the second part of the example referenced earlier, the method called with Page.Form changes its value extraction code block from this: Label lblErrMsg = (Label)frmRef.FindControl("lblBRMsg" To this: Label lblErrMsg = (Label) FunctionLibrary.FindControlRecursive(frmRef, "lblBRMsg" The Master That Won’t Step Aside In most migrations it is preferable to make as few changes as possible. In one case I ran across an existing Master Page that would not function as a sub-Master Page. While it would probably have been educational to trace down why, the expedient process of updating it to take the place of the WSRP Master Page is the route I took. The changes are highlighted below: … <asp:ContentPlaceHolder ID="wsrphead" runat="server"></asp:ContentPlaceHolder> </head> <body leftMargin="0" topMargin="0"> <form id="TheForm" runat="server"> <input type="hidden" name="key" id="key" value="" /> <input type="hidden" name="formactionurl" id="formactionurl" value="" /> <input type="hidden" name="handle" id="handle" value="" /> <asp:ScriptManager ID="ScriptManager1" runat="server" EnablePartialRendering="true" > </asp:ScriptManager> This approach did not work for all existing Master Pages, but fortunately all of the other existing Master Pages I have run across worked fine as a sub-Master to the WSRP Master Page. Moving On In Enterprise Portals, even after you get everything working, the work is not finished. Next you need to get it where everyone will work with it. Migration Planning Providing that the server where IIS is running is adequately sized, it is possible to run both the .NET Accelerator and the WSRP Producer on the same server during the upgrade process. The upgrade can be performed incrementally, i.e., one portlet at a time, if server administration processes support it. Those processes would include the ability to manage a second producer in the consuming portal and to change over individual portlet instances from one provider to the other. If processes or requirements demand that all portlets be cut over at the same time, it needs to be determined if this cut over should include a new producer, updating all of the portlets in the consumer, or if the WSRP Producer portlet configuration must maintain the naming conventions used by the .NET Accelerator and simply change the WSRP end point configured in the consumer. In some enterprises it may even be necessary to maintain the same WSDL end point, at which point the IIS configuration will be where the updates occur. The downside to such a requirement is that it makes rolling back very difficult, should the need arise. Location, Location, Location Not everyone wants the web application to have the descriptively obvious wsrpdefault location, or needs to create a second WSRP site on the same server. The instructions below are from the product team and, while targeted towards making a second site, will work for creating a site with a different name and then remove the old site. You can also change just the name in IIS. Manually Creating a WSRP Producer Site Instructions (NOTE: all executables used are the same ones used by the installer and “wsrpdev” will be the name of the new instance): 1. Copy C:\Oracle\Middleware\WSRPProducerForDotNet\wsrpdefault to C:\Oracle\Middleware\WSRPProducerForDotNet\wsrpdev. 2. Bring up a command window as an administrator 3. Run C:\Oracle\Middleware\WSRPProducerForDotNet\uninstall_resources\IISAppAccelSiteCreator.exe install WSRPProducers wsrpdev "C:\Oracle\Middleware\WSRPProducerForDotNet\wsrpdev" 8678 2.0.50727 4. Run C:\Oracle\Middleware\WSRPProducerForDotNet\uninstall_resources\PermManage.exe add FileSystem C:\Oracle\Middleware\WSRPProducerForDotNet\wsrpdev "NETWORK SERVICE" 3 1 5. Run C:\Oracle\Middleware\WSRPProducerForDotNet\uninstall_resources\PermManage.exe add FileSystem C:\Oracle\Middleware\WSRPProducerForDotNet\wsrpdev EVERYONE 1 1 6. Open up C:\Oracle\Middleware\WSRPProducerForDotNet\wsdl\1.0\WSRPService.wsdl and replace wsrpdefault with wsrpdev 7. Open up C:\Oracle\Middleware\WSRPProducerForDotNet\wsdl\2.0\WSRPService.wsdl and replace wsrpdefault with wsrpdev Tests: 1. Bring up a browser on the host itself and go to http://localhost:8678/wsrpdev/wsdl/1.0/WSRPService.wsdl and make sure that the URLs in the XML returned include the wsrpdev changes you made in step 6. 2. Bring up a browser on the host itself and see if the default sample comes up: http://localhost:8678/wsrpdev/portlets/ASPNET_AJAX_sample/default.aspx 3. Register the producer in WLP and test the portlet. Changing the Port used by WSRP Producer The pre-configured port for the WSRP Producer is 8678. You can change this port by updating both the IIS configuration and C:\Oracle\Middleware\WSRPProducerForDotNet\[WSRP_APP_NAME]\wsdl\1.0\WSRPService.wsdl. Do You Need to Migrate? Oracle Premier Support ended in November of 2010 for AquaLogic Interaction .NET Application Accelerator 1.x and Extended Support ends in November 2012 (see http://www.oracle.com/us/support/lifetime-support/lifetime-support-software-342730.html for other related dates). This means that integration with products released after November of 2010 is not supported. If having such support is the policy within your enterprise, you do indeed need to migrate. If changes in your enterprise cause your current solution with the .NET Accelerator to no longer function properly, you may need to migrate. Migration is a choice, and if the goals of your enterprise are to take full advantage of newer technologies then migration is certainly one activity you should be planning for.

  Read the article

• ASP.NET Frameworks and Raw Throughput Performance

  - by Rick Strahl

  A few days ago I had a curious thought: With all these different technologies that the ASP.NET stack has to offer, what's the most efficient technology overall to return data for a server request? When I started this it was mere curiosity rather than a real practical need or result. Different tools are used for different problems and so performance differences are to be expected. But still I was curious to see how the various technologies performed relative to each just for raw throughput of the request getting to the endpoint and back out to the client with as little processing in the actual endpoint logic as possible (aka Hello World!). I want to clarify that this is merely an informal test for my own curiosity and I'm sharing the results and process here because I thought it was interesting. It's been a long while since I've done any sort of perf testing on ASP.NET, mainly because I've not had extremely heavy load requirements and because overall ASP.NET performs very well even for fairly high loads so that often it's not that critical to test load performance. This post is not meant to make a point  or even come to a conclusion which tech is better, but just to act as a reference to help understand some of the differences in perf and give a starting point to play around with this yourself. I've included the code for this simple project, so you can play with it and maybe add a few additional tests for different things if you like. Source Code on GitHub I looked at this data for these technologies: ASP.NET Web API ASP.NET MVC WebForms ASP.NET WebPages ASMX AJAX Services  (couldn't get AJAX/JSON to run on IIS8 ) WCF Rest Raw ASP.NET HttpHandlers It's quite a mixed bag, of course and the technologies target different types of development. What started out as mere curiosity turned into a bit of a head scratcher as the results were sometimes surprising. What I describe here is more to satisfy my curiosity more than anything and I thought it interesting enough to discuss on the blog :-) First test: Raw Throughput The first thing I did is test raw throughput for the various technologies. This is the least practical test of course since you're unlikely to ever create the equivalent of a 'Hello World' request in a real life application. The idea here is to measure how much time a 'NOP' request takes to return data to the client. So for this request I create the simplest Hello World request that I could come up for each tech. Http Handler The first is the lowest level approach which is an HTTP handler. public class Handler : IHttpHandler { public void ProcessRequest(HttpContext context) { context.Response.ContentType = "text/plain"; context.Response.Write("Hello World. Time is: " + DateTime.Now.ToString()); } public bool IsReusable { get { return true; } } } WebForms Next I added a couple of ASPX pages - one using CodeBehind and one using only a markup page. The CodeBehind page simple does this in CodeBehind without any markup in the ASPX page: public partial class HelloWorld_CodeBehind : System.Web.UI.Page { protected void Page_Load(object sender, EventArgs e) { Response.Write("Hello World. Time is: " + DateTime.Now.ToString() ); Response.End(); } } while the Markup page only contains some static output via an expression:<%@ Page Language="C#" AutoEventWireup="false" CodeBehind="HelloWorld_Markup.aspx.cs" Inherits="AspNetFrameworksPerformance.HelloWorld_Markup" %> Hello World. Time is <%= DateTime.Now %> ASP.NET WebPages WebPages is the freestanding Razor implementation of ASP.NET. Here's the simple HelloWorld.cshtml page:Hello World @DateTime.Now WCF REST WCF REST was the token REST implementation for ASP.NET before WebAPI and the inbetween step from ASP.NET AJAX. I'd like to forget that this technology was ever considered for production use, but I'll include it here. Here's an OperationContract class: [ServiceContract(Namespace = "")] [AspNetCompatibilityRequirements(RequirementsMode = AspNetCompatibilityRequirementsMode.Allowed)] public class WcfService { [OperationContract] [WebGet] public Stream HelloWorld() { var data = Encoding.Unicode.GetBytes("Hello World" + DateTime.Now.ToString()); var ms = new MemoryStream(data); // Add your operation implementation here return ms; } } WCF REST can return arbitrary results by returning a Stream object and a content type. The code above turns the string result into a stream and returns that back to the client. ASP.NET AJAX (ASMX Services) I also wanted to test ASP.NET AJAX services because prior to WebAPI this is probably still the most widely used AJAX technology for the ASP.NET stack today. Unfortunately I was completely unable to get this running on my Windows 8 machine. Visual Studio 2012  removed adding of ASP.NET AJAX services, and when I tried to manually add the service and configure the script handler references it simply did not work - I always got a SOAP response for GET and POST operations. No matter what I tried I always ended up getting XML results even when explicitly adding the ScriptHandler. So, I didn't test this (but the code is there - you might be able to test this on a Windows 7 box). ASP.NET MVC Next up is probably the most popular ASP.NET technology at the moment: MVC. Here's the small controller: public class MvcPerformanceController : Controller { public ActionResult Index() { return View(); } public ActionResult HelloWorldCode() { return new ContentResult() { Content = "Hello World. Time is: " + DateTime.Now.ToString() }; } } ASP.NET WebAPI Next up is WebAPI which looks kind of similar to MVC. Except here I have to use a StringContent result to return the response: public class WebApiPerformanceController : ApiController { [HttpGet] public HttpResponseMessage HelloWorldCode() { return new HttpResponseMessage() { Content = new StringContent("Hello World. Time is: " + DateTime.Now.ToString(), Encoding.UTF8, "text/plain") }; } } Testing Take a minute to think about each of the technologies… and take a guess which you think is most efficient in raw throughput. The fastest should be pretty obvious, but the others - maybe not so much. The testing I did is pretty informal since it was mainly to satisfy my curiosity - here's how I did this: I used Apache Bench (ab.exe) from a full Apache HTTP installation to run and log the test results of hitting the server. ab.exe is a small executable that lets you hit a URL repeatedly and provides counter information about the number of requests, requests per second etc. ab.exe and the batch file are located in the \LoadTests folder of the project. An ab.exe command line  looks like this: ab.exe -n100000 -c20 http://localhost/aspnetperf/api/HelloWorld which hits the specified URL 100,000 times with a load factor of 20 concurrent requests. This results in output like this:   It's a great way to get a quick and dirty performance summary. Run it a few times to make sure there's not a large amount of varience. You might also want to do an IISRESET to clear the Web Server. Just make sure you do a short test run to warm up the server first - otherwise your first run is likely to be skewed downwards. ab.exe also allows you to specify headers and provide POST data and many other things if you want to get a little more fancy. Here all tests are GET requests to keep it simple. I ran each test: 100,000 iterations Load factor of 20 concurrent connections IISReset before starting A short warm up run for API and MVC to make sure startup cost is mitigated Here is the batch file I used for the test: IISRESET REM make sure you add REM C:\Program Files (x86)\Apache Software Foundation\Apache2.2\bin REM to your path so ab.exe can be found REM Warm up ab.exe -n100 -c20 http://localhost/aspnetperf/MvcPerformance/HelloWorldJsonab.exe -n100 -c20 http://localhost/aspnetperf/api/HelloWorldJson ab.exe -n100 -c20 http://localhost/AspNetPerf/WcfService.svc/HelloWorld ab.exe -n100000 -c20 http://localhost/aspnetperf/handler.ashx > handler.txt ab.exe -n100000 -c20 http://localhost/aspnetperf/HelloWorld_CodeBehind.aspx > AspxCodeBehind.txt ab.exe -n100000 -c20 http://localhost/aspnetperf/HelloWorld_Markup.aspx > AspxMarkup.txt ab.exe -n100000 -c20 http://localhost/AspNetPerf/WcfService.svc/HelloWorld > Wcf.txt ab.exe -n100000 -c20 http://localhost/aspnetperf/MvcPerformance/HelloWorldCode > Mvc.txt ab.exe -n100000 -c20 http://localhost/aspnetperf/api/HelloWorld > WebApi.txt I ran each of these tests 3 times and took the average score for Requests/second, with the machine otherwise idle. I did see a bit of variance when running many tests but the values used here are the medians. Part of this has to do with the fact I ran the tests on my local machine - result would probably more consistent running the load test on a separate machine hitting across the network. I ran these tests locally on my laptop which is a Dell XPS with quad core Sandibridge I7-2720QM @ 2.20ghz and a fast SSD drive on Windows 8. CPU load during tests ran to about 70% max across all 4 cores (IOW, it wasn't overloading the machine). Ideally you can try running these tests on a separate machine hitting the local machine. If I remember correctly IIS 7 and 8 on client OSs don't throttle so the performance here should be Results Ok, let's cut straight to the chase. Below are the results from the tests… It's not surprising that the handler was fastest. But it was a bit surprising to me that the next fastest was WebForms and especially Web Forms with markup over a CodeBehind page. WebPages also fared fairly well. MVC and WebAPI are a little slower and the slowest by far is WCF REST (which again I find surprising). As mentioned at the start the raw throughput tests are not overly practical as they don't test scripting performance for the HTML generation engines or serialization performances of the data engines. All it really does is give you an idea of the raw throughput for the technology from time of request to reaching the endpoint and returning minimal text data back to the client which indicates full round trip performance. But it's still interesting to see that Web Forms performs better in throughput than either MVC, WebAPI or WebPages. It'd be interesting to try this with a few pages that actually have some parsing logic on it, but that's beyond the scope of this throughput test. But what's also amazing about this test is the sheer amount of traffic that a laptop computer is handling. Even the slowest tech managed 5700 requests a second, which is one hell of a lot of requests if you extrapolate that out over a 24 hour period. Remember these are not static pages, but dynamic requests that are being served. Another test - JSON Data Service Results The second test I used a JSON result from several of the technologies. I didn't bother running WebForms and WebPages through this test since that doesn't make a ton of sense to return data from the them (OTOH, returning text from the APIs didn't make a ton of sense either :-) In these tests I have a small Person class that gets serialized and then returned to the client. The Person class looks like this: public class Person { public Person() { Id = 10; Name = "Rick"; Entered = DateTime.Now; } public int Id { get; set; } public string Name { get; set; } public DateTime Entered { get; set; } } Here are the updated handler classes that use Person: Handler public class Handler : IHttpHandler { public void ProcessRequest(HttpContext context) { var action = context.Request.QueryString["action"]; if (action == "json") JsonRequest(context); else TextRequest(context); } public void TextRequest(HttpContext context) { context.Response.ContentType = "text/plain"; context.Response.Write("Hello World. Time is: " + DateTime.Now.ToString()); } public void JsonRequest(HttpContext context) { var json = JsonConvert.SerializeObject(new Person(), Formatting.None); context.Response.ContentType = "application/json"; context.Response.Write(json); } public bool IsReusable { get { return true; } } } This code adds a little logic to check for a action query string and route the request to an optional JSON result method. To generate JSON, I'm using the same JSON.NET serializer (JsonConvert.SerializeObject) used in Web API to create the JSON response. WCF REST   [ServiceContract(Namespace = "")] [AspNetCompatibilityRequirements(RequirementsMode = AspNetCompatibilityRequirementsMode.Allowed)] public class WcfService { [OperationContract] [WebGet] public Stream HelloWorld() { var data = Encoding.Unicode.GetBytes("Hello World " + DateTime.Now.ToString()); var ms = new MemoryStream(data); // Add your operation implementation here return ms; } [OperationContract] [WebGet(ResponseFormat=WebMessageFormat.Json,BodyStyle=WebMessageBodyStyle.WrappedRequest)] public Person HelloWorldJson() { // Add your operation implementation here return new Person(); } } For WCF REST all I have to do is add a method with the Person result type.   ASP.NET MVC public class MvcPerformanceController : Controller { // // GET: /MvcPerformance/ public ActionResult Index() { return View(); } public ActionResult HelloWorldCode() { return new ContentResult() { Content = "Hello World. Time is: " + DateTime.Now.ToString() }; } public JsonResult HelloWorldJson() { return Json(new Person(), JsonRequestBehavior.AllowGet); } } For MVC all I have to do for a JSON response is return a JSON result. ASP.NET internally uses JavaScriptSerializer. ASP.NET WebAPI public class WebApiPerformanceController : ApiController { [HttpGet] public HttpResponseMessage HelloWorldCode() { return new HttpResponseMessage() { Content = new StringContent("Hello World. Time is: " + DateTime.Now.ToString(), Encoding.UTF8, "text/plain") }; } [HttpGet] public Person HelloWorldJson() { return new Person(); } [HttpGet] public HttpResponseMessage HelloWorldJson2() { var response = new HttpResponseMessage(HttpStatusCode.OK); response.Content = new ObjectContent<Person>(new Person(), GlobalConfiguration.Configuration.Formatters.JsonFormatter); return response; } } Testing and Results To run these data requests I used the following ab.exe commands:REM JSON RESPONSES ab.exe -n100000 -c20 http://localhost/aspnetperf/Handler.ashx?action=json > HandlerJson.txt ab.exe -n100000 -c20 http://localhost/aspnetperf/MvcPerformance/HelloWorldJson > MvcJson.txt ab.exe -n100000 -c20 http://localhost/aspnetperf/api/HelloWorldJson > WebApiJson.txt ab.exe -n100000 -c20 http://localhost/AspNetPerf/WcfService.svc/HelloWorldJson > WcfJson.txt The results from this test run are a bit interesting in that the WebAPI test improved performance significantly over returning plain string content. Here are the results:   The performance for each technology drops a little bit except for WebAPI which is up quite a bit! From this test it appears that WebAPI is actually significantly better performing returning a JSON response, rather than a plain string response. Snag with Apache Benchmark and 'Length Failures' I ran into a little snag with Apache Benchmark, which was reporting failures for my Web API requests when serializing. As the graph shows performance improved significantly from with JSON results from 5580 to 6530 or so which is a 15% improvement (while all others slowed down by 3-8%). However, I was skeptical at first because the WebAPI test reports showed a bunch of errors on about 10% of the requests. Check out this report: Notice the Failed Request count. What the hey? Is WebAPI failing on roughly 10% of requests when sending JSON? Turns out: No it's not! But it took some sleuthing to figure out why it reports these failures. At first I thought that Web API was failing, and so to make sure I re-ran the test with Fiddler attached and runiisning the ab.exe test by using the -X switch: ab.exe -n100 -c10 -X localhost:8888 http://localhost/aspnetperf/api/HelloWorldJson which showed that indeed all requests where returning proper HTTP 200 results with full content. However ab.exe was reporting the errors. After some closer inspection it turned out that the dates varying in size altered the response length in dynamic output. For example: these two results: {"Id":10,"Name":"Rick","Entered":"2012-09-04T10:57:24.841926-10:00"} {"Id":10,"Name":"Rick","Entered":"2012-09-04T10:57:24.8519262-10:00"} are different in length for the number which results in 68 and 69 bytes respectively. The same URL produces different result lengths which is what ab.exe reports. I didn't notice at first bit the same is happening when running the ASHX handler with JSON.NET result since it uses the same serializer that varies the milliseconds. Moral: You can typically ignore Length failures in Apache Benchmark and when in doubt check the actual output with Fiddler. Note that the other failure values are accurate though. Another interesting Side Note: Perf drops over Time As I was running these tests repeatedly I was finding that performance steadily dropped from a startup peak to a 10-15% lower stable level. IOW, with Web API I'd start out with around 6500 req/sec and in subsequent runs it keeps dropping until it would stabalize somewhere around 5900 req/sec occasionally jumping lower. For these tests this is why I did the IIS RESET and warm up for individual tests. This is a little puzzling. Looking at Process Monitor while the test are running memory very quickly levels out as do handles and threads, on the first test run. Subsequent runs everything stays stable, but the performance starts going downwards. This applies to all the technologies - Handlers, Web Forms, MVC, Web API - curious to see if others test this and see similar results. Doing an IISRESET then resets everything and performance starts off at peak again… Summary As I stated at the outset, these were informal to satiate my curiosity not to prove that any technology is better or even faster than another. While there clearly are differences in performance the differences (other than WCF REST which was by far the slowest and the raw handler which was by far the highest) are relatively minor, so there is no need to feel that any one technology is a runaway standout in raw performance. Choosing a technology is about more than pure performance but also about the adequateness for the job and the easy of implementation. The strengths of each technology will make for any minor performance difference we see in these tests. However, to me it's important to get an occasional reality check and compare where new technologies are heading. Often times old stuff that's been optimized and designed for a time of less horse power can utterly blow the doors off newer tech and simple checks like this let you compare. Luckily we're seeing that much of the new stuff performs well even in V1.0 which is great. To me it was very interesting to see Web API perform relatively badly with plain string content, which originally led me to think that Web API might not be properly optimized just yet. For those that caught my Tweets late last week regarding WebAPI's slow responses was with String content which is in fact considerably slower. Luckily where it counts with serialized JSON and XML WebAPI actually performs better. But I do wonder what would make generic string content slower than serialized code? This stresses another point: Don't take a single test as the final gospel and don't extrapolate out from a single set of tests. Certainly Twitter can make you feel like a fool when you post something immediate that hasn't been fleshed out a little more <blush>. Egg on my face. As a result I ended up screwing around with this for a few hours today to compare different scenarios. Well worth the time… I hope you found this useful, if not for the results, maybe for the process of quickly testing a few requests for performance and charting out a comparison. Now onwards with more serious stuff… Resources Source Code on GitHub Apache HTTP Server Project (ab.exe is part of the binary distribution)© Rick Strahl, West Wind Technologies, 2005-2012Posted in ASP.NET  Web Api   Tweet !function(d,s,id){var js,fjs=d.getElementsByTagName(s)[0];if(!d.getElementById(id)){js=d.createElement(s);js.id=id;js.src="//platform.twitter.com/widgets.js";fjs.parentNode.insertBefore(js,fjs);}}(document,"script","twitter-wjs"); (function() { var po = document.createElement('script'); po.type = 'text/javascript'; po.async = true; po.src = 'https://apis.google.com/js/plusone.js'; var s = document.getElementsByTagName('script')[0]; s.parentNode.insertBefore(po, s); })();

  Read the article

• Syncing Data with a Server using Silverlight and HTTP Polling Duplex

  - by dwahlin

  Many applications have the need to stay in-sync with data provided by a service. Although web applications typically rely on standard polling techniques to check if data has changed, Silverlight provides several interesting options for keeping an application in-sync that rely on server “push” technologies. A few years back I wrote several blog posts covering different “push” technologies available in Silverlight that rely on sockets or HTTP Polling Duplex. We recently had a project that looked like it could benefit from pushing data from a server to one or more clients so I thought I’d revisit the subject and provide some updates to the original code posted. If you’ve worked with AJAX before in Web applications then you know that until browsers fully support web sockets or other duplex (bi-directional communication) technologies that it’s difficult to keep applications in-sync with a server without relying on polling. The problem with polling is that you have to check for changes on the server on a timed-basis which can often be wasteful and take up unnecessary resources. With server “push” technologies, data can be pushed from the server to the client as it changes. Once the data is received, the client can update the user interface as appropriate. Using “push” technologies allows the client to listen for changes from the data but stay 100% focused on client activities as opposed to worrying about polling and asking the server if anything has changed. Silverlight provides several options for pushing data from a server to a client including sockets, TCP bindings and HTTP Polling Duplex.  Each has its own strengths and weaknesses as far as performance and setup work with HTTP Polling Duplex arguably being the easiest to setup and get going.  In this article I’ll demonstrate how HTTP Polling Duplex can be used in Silverlight 4 applications to push data and show how you can create a WCF server that provides an HTTP Polling Duplex binding that a Silverlight client can consume.   What is HTTP Polling Duplex? Technologies that allow data to be pushed from a server to a client rely on duplex functionality. Duplex (or bi-directional) communication allows data to be passed in both directions.  A client can call a service and the server can call the client. HTTP Polling Duplex (as its name implies) allows a server to communicate with a client without forcing the client to constantly poll the server. It has the benefit of being able to run on port 80 making setup a breeze compared to the other options which require specific ports to be used and cross-domain policy files to be exposed on port 943 (as with sockets and TCP bindings). Having said that, if you’re looking for the best speed possible then sockets and TCP bindings are the way to go. But, they’re not the only game in town when it comes to duplex communication. The first time I heard about HTTP Polling Duplex (initially available in Silverlight 2) I wasn’t exactly sure how it was any better than standard polling used in AJAX applications. I read the Silverlight SDK, looked at various resources and generally found the following definition unhelpful as far as understanding the actual benefits that HTTP Polling Duplex provided: "The Silverlight client periodically polls the service on the network layer, and checks for any new messages that the service wants to send on the callback channel. The service queues all messages sent on the client callback channel and delivers them to the client when the client polls the service." Although the previous definition explained the overall process, it sounded as if standard polling was used. Fortunately, Microsoft’s Scott Guthrie provided me with a more clear definition several years back that explains the benefits provided by HTTP Polling Duplex quite well (used with his permission): "The [HTTP Polling Duplex] duplex support does use polling in the background to implement notifications – although the way it does it is different than manual polling. It initiates a network request, and then the request is effectively “put to sleep” waiting for the server to respond (it doesn’t come back immediately). The server then keeps the connection open but not active until it has something to send back (or the connection times out after 90 seconds – at which point the duplex client will connect again and wait). This way you are avoiding hitting the server repeatedly – but still get an immediate response when there is data to send." After hearing Scott’s definition the light bulb went on and it all made sense. A client makes a request to a server to check for changes, but instead of the request returning immediately, it parks itself on the server and waits for data. It’s kind of like waiting to pick up a pizza at the store. Instead of calling the store over and over to check the status, you sit in the store and wait until the pizza (the request data) is ready. Once it’s ready you take it back home (to the client). This technique provides a lot of efficiency gains over standard polling techniques even though it does use some polling of its own as a request is initially made from a client to a server. So how do you implement HTTP Polling Duplex in your Silverlight applications? Let’s take a look at the process by starting with the server. Creating an HTTP Polling Duplex WCF Service Creating a WCF service that exposes an HTTP Polling Duplex binding is straightforward as far as coding goes. Add some one way operations into an interface, create a client callback interface and you’re ready to go. The most challenging part comes into play when configuring the service to properly support the necessary binding and that’s more of a cut and paste operation once you know the configuration code to use. To create an HTTP Polling Duplex service you’ll need to expose server-side and client-side interfaces and reference the System.ServiceModel.PollingDuplex assembly (located at C:\Program Files (x86)\Microsoft SDKs\Silverlight\v4.0\Libraries\Server on my machine) in the server project. For the demo application I upgraded a basketball simulation service to support the latest polling duplex assemblies. The service simulates a simple basketball game using a Game class and pushes information about the game such as score, fouls, shots and more to the client as the game changes over time. Before jumping too far into the game push service, it’s important to discuss two interfaces used by the service to communicate in a bi-directional manner. The first is called IGameStreamService and defines the methods/operations that the client can call on the server (see Listing 1). The second is IGameStreamClient which defines the callback methods that a server can use to communicate with a client (see Listing 2).   [ServiceContract(Namespace = "Silverlight", CallbackContract = typeof(IGameStreamClient))] public interface IGameStreamService { [OperationContract(IsOneWay = true)] void GetTeamData(); } Listing 1. The IGameStreamService interface defines server operations that can be called on the server.   [ServiceContract] public interface IGameStreamClient { [OperationContract(IsOneWay = true)] void ReceiveTeamData(List<Team> teamData); [OperationContract(IsOneWay = true, AsyncPattern=true)] IAsyncResult BeginReceiveGameData(GameData gameData, AsyncCallback callback, object state); void EndReceiveGameData(IAsyncResult result); } Listing 2. The IGameStreamClient interfaces defines client operations that a server can call.   The IGameStreamService interface is decorated with the standard ServiceContract attribute but also contains a value for the CallbackContract property.  This property is used to define the interface that the client will expose (IGameStreamClient in this example) and use to receive data pushed from the service. Notice that each OperationContract attribute in both interfaces sets the IsOneWay property to true. This means that the operation can be called and passed data as appropriate, however, no data will be passed back. Instead, data will be pushed back to the client as it’s available.  Looking through the IGameStreamService interface you can see that the client can request team data whereas the IGameStreamClient interface allows team and game data to be received by the client. One interesting point about the IGameStreamClient interface is the inclusion of the AsyncPattern property on the BeginReceiveGameData operation. I initially created this operation as a standard one way operation and it worked most of the time. However, as I disconnected clients and reconnected new ones game data wasn’t being passed properly. After researching the problem more I realized that because the service could take up to 7 seconds to return game data, things were getting hung up. By setting the AsyncPattern property to true on the BeginReceivedGameData operation and providing a corresponding EndReceiveGameData operation I was able to get around this problem and get everything running properly. I’ll provide more details on the implementation of these two methods later in this post. Once the interfaces were created I moved on to the game service class. The first order of business was to create a class that implemented the IGameStreamService interface. Since the service can be used by multiple clients wanting game data I added the ServiceBehavior attribute to the class definition so that I could set its InstanceContextMode to InstanceContextMode.Single (in effect creating a Singleton service object). Listing 3 shows the game service class as well as its fields and constructor.   [ServiceBehavior(ConcurrencyMode = ConcurrencyMode.Multiple, InstanceContextMode = InstanceContextMode.Single)] public class GameStreamService : IGameStreamService { object _Key = new object(); Game _Game = null; Timer _Timer = null; Random _Random = null; Dictionary<string, IGameStreamClient> _ClientCallbacks = new Dictionary<string, IGameStreamClient>(); static AsyncCallback _ReceiveGameDataCompleted = new AsyncCallback(ReceiveGameDataCompleted); public GameStreamService() { _Game = new Game(); _Timer = new Timer { Enabled = false, Interval = 2000, AutoReset = true }; _Timer.Elapsed += new ElapsedEventHandler(_Timer_Elapsed); _Timer.Start(); _Random = new Random(); }} Listing 3. The GameStreamService implements the IGameStreamService interface which defines a callback contract that allows the service class to push data back to the client. By implementing the IGameStreamService interface, GameStreamService must supply a GetTeamData() method which is responsible for supplying information about the teams that are playing as well as individual players.  GetTeamData() also acts as a client subscription method that tracks clients wanting to receive game data.  Listing 4 shows the GetTeamData() method. public void GetTeamData() { //Get client callback channel var context = OperationContext.Current; var sessionID = context.SessionId; var currClient = context.GetCallbackChannel<IGameStreamClient>(); context.Channel.Faulted += Disconnect; context.Channel.Closed += Disconnect; IGameStreamClient client; if (!_ClientCallbacks.TryGetValue(sessionID, out client)) { lock (_Key) { _ClientCallbacks[sessionID] = currClient; } } currClient.ReceiveTeamData(_Game.GetTeamData()); //Start timer which when fired sends updated score information to client if (!_Timer.Enabled) { _Timer.Enabled = true; } } Listing 4. The GetTeamData() method subscribes a given client to the game service and returns. The key the line of code in the GetTeamData() method is the call to GetCallbackChannel<IGameStreamClient>().  This method is responsible for accessing the calling client’s callback channel. The callback channel is defined by the IGameStreamClient interface shown earlier in Listing 2 and used by the server to communicate with the client. Before passing team data back to the client, GetTeamData() grabs the client’s session ID and checks if it already exists in the _ClientCallbacks dictionary object used to track clients wanting callbacks from the server. If the client doesn’t exist it adds it into the collection. It then pushes team data from the Game class back to the client by calling ReceiveTeamData().  Since the service simulates a basketball game, a timer is then started if it’s not already enabled which is then used to randomly send data to the client. When the timer fires, game data is pushed down to the client. Listing 5 shows the _Timer_Elapsed() method that is called when the timer fires as well as the SendGameData() method used to send data to the client. void _Timer_Elapsed(object sender, ElapsedEventArgs e) { int interval = _Random.Next(3000, 7000); lock (_Key) { _Timer.Interval = interval; _Timer.Enabled = false; } SendGameData(_Game.GetGameData()); } private void SendGameData(GameData gameData) { var cbs = _ClientCallbacks.Where(cb => ((IContextChannel)cb.Value).State == CommunicationState.Opened); for (int i = 0; i < cbs.Count(); i++) { var cb = cbs.ElementAt(i).Value; try { cb.BeginReceiveGameData(gameData, _ReceiveGameDataCompleted, cb); } catch (TimeoutException texp) { //Log timeout error } catch (CommunicationException cexp) { //Log communication error } } lock (_Key) _Timer.Enabled = true; } private static void ReceiveGameDataCompleted(IAsyncResult result) { try { ((IGameStreamClient)(result.AsyncState)).EndReceiveGameData(result); } catch (CommunicationException) { // empty } catch (TimeoutException) { // empty } } LIsting 5. _Timer_Elapsed is used to simulate time in a basketball game. When _Timer_Elapsed() fires the SendGameData() method is called which iterates through the clients wanting to be notified of changes. As each client is identified, their respective BeginReceiveGameData() method is called which ultimately pushes game data down to the client. Recall that this method was defined in the client callback interface named IGameStreamClient shown earlier in Listing 2. Notice that BeginReceiveGameData() accepts _ReceiveGameDataCompleted as its second parameter (an AsyncCallback delegate defined in the service class) and passes the client callback as the third parameter. The initial version of the sample application had a standard ReceiveGameData() method in the client callback interface. However, sometimes the client callbacks would work properly and sometimes they wouldn’t which was a little baffling at first glance. After some investigation I realized that I needed to implement an asynchronous pattern for client callbacks to work properly since 3 – 7 second delays are occurring as a result of the timer. Once I added the BeginReceiveGameData() and ReceiveGameDataCompleted() methods everything worked properly since each call was handled in an asynchronous manner. The final task that had to be completed to get the server working properly with HTTP Polling Duplex was adding configuration code into web.config. In the interest of brevity I won’t post all of the code here since the sample application includes everything you need. However, Listing 6 shows the key configuration code to handle creating a custom binding named pollingDuplexBinding and associate it with the service’s endpoint.   <bindings> <customBinding> <binding name="pollingDuplexBinding"> <binaryMessageEncoding /> <pollingDuplex maxPendingSessions="2147483647" maxPendingMessagesPerSession="2147483647" inactivityTimeout="02:00:00" serverPollTimeout="00:05:00"/> <httpTransport /> </binding> </customBinding> </bindings> <services> <service name="GameService.GameStreamService" behaviorConfiguration="GameStreamServiceBehavior"> <endpoint address="" binding="customBinding" bindingConfiguration="pollingDuplexBinding" contract="GameService.IGameStreamService"/> <endpoint address="mex" binding="mexHttpBinding" contract="IMetadataExchange" /> </service> </services>   Listing 6. Configuring an HTTP Polling Duplex binding in web.config and associating an endpoint with it. Calling the Service and Receiving “Pushed” Data Calling the service and handling data that is pushed from the server is a simple and straightforward process in Silverlight. Since the service is configured with a MEX endpoint and exposes a WSDL file, you can right-click on the Silverlight project and select the standard Add Service Reference item. After the web service proxy is created you may notice that the ServiceReferences.ClientConfig file only contains an empty configuration element instead of the normal configuration elements created when creating a standard WCF proxy. You can certainly update the file if you want to read from it at runtime but for the sample application I fed the service URI directly to the service proxy as shown next: var address = new EndpointAddress("http://localhost.:5661/GameStreamService.svc"); var binding = new PollingDuplexHttpBinding(); _Proxy = new GameStreamServiceClient(binding, address); _Proxy.ReceiveTeamDataReceived += _Proxy_ReceiveTeamDataReceived; _Proxy.ReceiveGameDataReceived += _Proxy_ReceiveGameDataReceived; _Proxy.GetTeamDataAsync(); This code creates the proxy and passes the endpoint address and binding to use to its constructor. It then wires the different receive events to callback methods and calls GetTeamDataAsync().  Calling GetTeamDataAsync() causes the server to store the client in the server-side dictionary collection mentioned earlier so that it can receive data that is pushed.  As the server-side timer fires and game data is pushed to the client, the user interface is updated as shown in Listing 7. Listing 8 shows the _Proxy_ReceiveGameDataReceived() method responsible for handling the data and calling UpdateGameData() to process it.   Listing 7. The Silverlight interface. Game data is pushed from the server to the client using HTTP Polling Duplex. void _Proxy_ReceiveGameDataReceived(object sender, ReceiveGameDataReceivedEventArgs e) { UpdateGameData(e.gameData); } private void UpdateGameData(GameData gameData) { //Update Score this.tbTeam1Score.Text = gameData.Team1Score.ToString(); this.tbTeam2Score.Text = gameData.Team2Score.ToString(); //Update ball visibility if (gameData.Action != ActionsEnum.Foul) { if (tbTeam1.Text == gameData.TeamOnOffense) { AnimateBall(this.BB1, this.BB2); } else //Team 2 { AnimateBall(this.BB2, this.BB1); } } if (this.lbActions.Items.Count > 9) this.lbActions.Items.Clear(); this.lbActions.Items.Add(gameData.LastAction); if (this.lbActions.Visibility == Visibility.Collapsed) this.lbActions.Visibility = Visibility.Visible; } private void AnimateBall(Image onBall, Image offBall) { this.FadeIn.Stop(); Storyboard.SetTarget(this.FadeInAnimation, onBall); Storyboard.SetTarget(this.FadeOutAnimation, offBall); this.FadeIn.Begin(); } Listing 8. As the server pushes game data, the client’s _Proxy_ReceiveGameDataReceived() method is called to process the data. In a real-life application I’d go with a ViewModel class to handle retrieving team data, setup data bindings and handle data that is pushed from the server. However, for the sample application I wanted to focus on HTTP Polling Duplex and keep things as simple as possible.   Summary Silverlight supports three options when duplex communication is required in an application including TCP bindins, sockets and HTTP Polling Duplex. In this post you’ve seen how HTTP Polling Duplex interfaces can be created and implemented on the server as well as how they can be consumed by a Silverlight client. HTTP Polling Duplex provides a nice way to “push” data from a server while still allowing the data to flow over port 80 or another port of your choice.   Sample Application Download

  Read the article

• Virtual host is not working in Ubuntu 14 VPS using XAMPP 1.8.3

  - by viral4ever

  I am using XAMPP as server in ubuntu 14.04 VPS of digitalocean. I tried to setup virtual hosts. But it is not working and I am getting 403 error of access denied. I changed files too. My files with changes are /opt/lampp/etc/httpd.conf # # This is the main Apache HTTP server configuration file. It contains the # configuration directives that give the server its instructions. # See <URL:http://httpd.apache.org/docs/trunk/> for detailed information. # In particular, see # <URL:http://httpd.apache.org/docs/trunk/mod/directives.html> # for a discussion of each configuration directive. # # Do NOT simply read the instructions in here without understanding # what they do. They're here only as hints or reminders. If you are unsure # consult the online docs. You have been warned. # # Configuration and logfile names: If the filenames you specify for many # of the server's control files begin with "/" (or "drive:/" for Win32), the # server will use that explicit path. If the filenames do *not* begin # with "/", the value of ServerRoot is prepended -- so 'log/access_log' # with ServerRoot set to '/www' will be interpreted by the # server as '/www/log/access_log', where as '/log/access_log' will be # interpreted as '/log/access_log'. # # ServerRoot: The top of the directory tree under which the server's # configuration, error, and log files are kept. # # Do not add a slash at the end of the directory path. If you point # ServerRoot at a non-local disk, be sure to specify a local disk on the # Mutex directive, if file-based mutexes are used. If you wish to share the # same ServerRoot for multiple httpd daemons, you will need to change at # least PidFile. # ServerRoot "/opt/lampp" # # Mutex: Allows you to set the mutex mechanism and mutex file directory # for individual mutexes, or change the global defaults # # Uncomment and change the directory if mutexes are file-based and the default # mutex file directory is not on a local disk or is not appropriate for some # other reason. # # Mutex default:logs # # Listen: Allows you to bind Apache to specific IP addresses and/or # ports, instead of the default. See also the <VirtualHost> # directive. # # Change this to Listen on specific IP addresses as shown below to # prevent Apache from glomming onto all bound IP addresses. # #Listen 12.34.56.78:80 Listen 80 # # Dynamic Shared Object (DSO) Support # # To be able to use the functionality of a module which was built as a DSO you # have to place corresponding `LoadModule' lines at this location so the # directives contained in it are actually available _before_ they are used. # Statically compiled modules (those listed by `httpd -l') do not need # to be loaded here. # # Example: # LoadModule foo_module modules/mod_foo.so # LoadModule authn_file_module modules/mod_authn_file.so LoadModule authn_dbm_module modules/mod_authn_dbm.so LoadModule authn_anon_module modules/mod_authn_anon.so LoadModule authn_dbd_module modules/mod_authn_dbd.so LoadModule authn_socache_module modules/mod_authn_socache.so LoadModule authn_core_module modules/mod_authn_core.so LoadModule authz_host_module modules/mod_authz_host.so LoadModule authz_groupfile_module modules/mod_authz_groupfile.so LoadModule authz_user_module modules/mod_authz_user.so LoadModule authz_dbm_module modules/mod_authz_dbm.so LoadModule authz_owner_module modules/mod_authz_owner.so LoadModule authz_dbd_module modules/mod_authz_dbd.so LoadModule authz_core_module modules/mod_authz_core.so LoadModule authnz_ldap_module modules/mod_authnz_ldap.so LoadModule access_compat_module modules/mod_access_compat.so LoadModule auth_basic_module modules/mod_auth_basic.so LoadModule auth_form_module modules/mod_auth_form.so LoadModule auth_digest_module modules/mod_auth_digest.so LoadModule allowmethods_module modules/mod_allowmethods.so LoadModule file_cache_module modules/mod_file_cache.so LoadModule cache_module modules/mod_cache.so LoadModule cache_disk_module modules/mod_cache_disk.so LoadModule socache_shmcb_module modules/mod_socache_shmcb.so LoadModule socache_dbm_module modules/mod_socache_dbm.so LoadModule socache_memcache_module modules/mod_socache_memcache.so LoadModule dbd_module modules/mod_dbd.so LoadModule bucketeer_module modules/mod_bucketeer.so LoadModule dumpio_module modules/mod_dumpio.so LoadModule echo_module modules/mod_echo.so LoadModule case_filter_module modules/mod_case_filter.so LoadModule case_filter_in_module modules/mod_case_filter_in.so LoadModule buffer_module modules/mod_buffer.so LoadModule ratelimit_module modules/mod_ratelimit.so LoadModule reqtimeout_module modules/mod_reqtimeout.so LoadModule ext_filter_module modules/mod_ext_filter.so LoadModule request_module modules/mod_request.so LoadModule include_module modules/mod_include.so LoadModule filter_module modules/mod_filter.so LoadModule substitute_module modules/mod_substitute.so LoadModule sed_module modules/mod_sed.so LoadModule charset_lite_module modules/mod_charset_lite.so LoadModule deflate_module modules/mod_deflate.so LoadModule mime_module modules/mod_mime.so LoadModule ldap_module modules/mod_ldap.so LoadModule log_config_module modules/mod_log_config.so LoadModule log_debug_module modules/mod_log_debug.so LoadModule logio_module modules/mod_logio.so LoadModule env_module modules/mod_env.so LoadModule mime_magic_module modules/mod_mime_magic.so LoadModule cern_meta_module modules/mod_cern_meta.so LoadModule expires_module modules/mod_expires.so LoadModule headers_module modules/mod_headers.so LoadModule usertrack_module modules/mod_usertrack.so LoadModule unique_id_module modules/mod_unique_id.so LoadModule setenvif_module modules/mod_setenvif.so LoadModule version_module modules/mod_version.so LoadModule remoteip_module modules/mod_remoteip.so LoadModule proxy_module modules/mod_proxy.so LoadModule proxy_connect_module modules/mod_proxy_connect.so LoadModule proxy_ftp_module modules/mod_proxy_ftp.so LoadModule proxy_http_module modules/mod_proxy_http.so LoadModule proxy_fcgi_module modules/mod_proxy_fcgi.so LoadModule proxy_scgi_module modules/mod_proxy_scgi.so LoadModule proxy_ajp_module modules/mod_proxy_ajp.so LoadModule proxy_balancer_module modules/mod_proxy_balancer.so LoadModule proxy_express_module modules/mod_proxy_express.so LoadModule session_module modules/mod_session.so LoadModule session_cookie_module modules/mod_session_cookie.so LoadModule session_dbd_module modules/mod_session_dbd.so LoadModule slotmem_shm_module modules/mod_slotmem_shm.so LoadModule ssl_module modules/mod_ssl.so LoadModule lbmethod_byrequests_module modules/mod_lbmethod_byrequests.so LoadModule lbmethod_bytraffic_module modules/mod_lbmethod_bytraffic.so LoadModule lbmethod_bybusyness_module modules/mod_lbmethod_bybusyness.so LoadModule lbmethod_heartbeat_module modules/mod_lbmethod_heartbeat.so LoadModule unixd_module modules/mod_unixd.so LoadModule dav_module modules/mod_dav.so LoadModule status_module modules/mod_status.so LoadModule autoindex_module modules/mod_autoindex.so LoadModule info_module modules/mod_info.so LoadModule suexec_module modules/mod_suexec.so LoadModule cgi_module modules/mod_cgi.so LoadModule cgid_module modules/mod_cgid.so LoadModule dav_fs_module modules/mod_dav_fs.so LoadModule vhost_alias_module modules/mod_vhost_alias.so LoadModule negotiation_module modules/mod_negotiation.so LoadModule dir_module modules/mod_dir.so LoadModule actions_module modules/mod_actions.so LoadModule speling_module modules/mod_speling.so LoadModule userdir_module modules/mod_userdir.so LoadModule alias_module modules/mod_alias.so LoadModule rewrite_module modules/mod_rewrite.so <IfDefine JUSTTOMAKEAPXSHAPPY> LoadModule php4_module modules/libphp4.so LoadModule php5_module modules/libphp5.so </IfDefine> <IfModule unixd_module> # # If you wish httpd to run as a different user or group, you must run # httpd as root initially and it will switch. # # User/Group: The name (or #number) of the user/group to run httpd as. # It is usually good practice to create a dedicated user and group for # running httpd, as with most system services. # User root Group www </IfModule> # 'Main' server configuration # # The directives in this section set up the values used by the 'main' # server, which responds to any requests that aren't handled by a # <VirtualHost> definition. These values also provide defaults for # any <VirtualHost> containers you may define later in the file. # # All of these directives may appear inside <VirtualHost> containers, # in which case these default settings will be overridden for the # virtual host being defined. # # # ServerAdmin: Your address, where problems with the server should be # e-mailed. This address appears on some server-generated pages, such # as error documents. e.g. [email protected] # ServerAdmin [email protected] # # ServerName gives the name and port that the server uses to identify itself. # This can often be determined automatically, but we recommend you specify # it explicitly to prevent problems during startup. # # If your host doesn't have a registered DNS name, enter its IP address here. # #ServerName www.example.com:@@Port@@ # XAMPP ServerName localhost # # Deny access to the entirety of your server's filesystem. You must # explicitly permit access to web content directories in other # <Directory> blocks below. # <Directory /> AllowOverride none Require all denied </Directory> # # Note that from this point forward you must specifically allow # particular features to be enabled - so if something's not working as # you might expect, make sure that you have specifically enabled it # below. # # # DocumentRoot: The directory out of which you will serve your # documents. By default, all requests are taken from this directory, but # symbolic links and aliases may be used to point to other locations. # DocumentRoot "/opt/lampp/htdocs" <Directory "/opt/lampp/htdocs"> # # Possible values for the Options directive are "None", "All", # or any combination of: # Indexes Includes FollowSymLinks SymLinksifOwnerMatch ExecCGI MultiViews # # Note that "MultiViews" must be named *explicitly* --- "Options All" # doesn't give it to you. # # The Options directive is both complicated and important. Please see # http://httpd.apache.org/docs/trunk/mod/core.html#options # for more information. # #Options Indexes FollowSymLinks # XAMPP Options Indexes FollowSymLinks ExecCGI Includes # # AllowOverride controls what directives may be placed in .htaccess files. # It can be "All", "None", or any combination of the keywords: # Options FileInfo AuthConfig Limit # #AllowOverride None # since XAMPP 1.4: AllowOverride All # # Controls who can get stuff from this server. # Require all granted </Directory> # # DirectoryIndex: sets the file that Apache will serve if a directory # is requested. # <IfModule dir_module> #DirectoryIndex index.html # XAMPP DirectoryIndex index.html index.html.var index.php index.php3 index.php4 </IfModule> # # The following lines prevent .htaccess and .htpasswd files from being # viewed by Web clients. # <Files ".ht*"> Require all denied </Files> # # ErrorLog: The location of the error log file. # If you do not specify an ErrorLog directive within a <VirtualHost> # container, error messages relating to that virtual host will be # logged here. If you *do* define an error logfile for a <VirtualHost> # container, that host's errors will be logged there and not here. # ErrorLog "logs/error_log" # # LogLevel: Control the number of messages logged to the error_log. # Possible values include: debug, info, notice, warn, error, crit, # alert, emerg. # LogLevel warn <IfModule log_config_module> # # The following directives define some format nicknames for use with # a CustomLog directive (see below). # LogFormat "%h %l %u %t \"%r\" %>s %b \"%{Referer}i\" \"%{User-Agent}i\"" combined LogFormat "%h %l %u %t \"%r\" %>s %b" common <IfModule logio_module> # You need to enable mod_logio.c to use %I and %O LogFormat "%h %l %u %t \"%r\" %>s %b \"%{Referer}i\" \"%{User-Agent}i\" %I %O" combinedio </IfModule> # # The location and format of the access logfile (Common Logfile Format). # If you do not define any access logfiles within a <VirtualHost> # container, they will be logged here. Contrariwise, if you *do* # define per-<VirtualHost> access logfiles, transactions will be # logged therein and *not* in this file. # CustomLog "logs/access_log" common # # If you prefer a logfile with access, agent, and referer information # (Combined Logfile Format) you can use the following directive. # #CustomLog "logs/access_log" combined </IfModule> <IfModule alias_module> # # Redirect: Allows you to tell clients about documents that used to # exist in your server's namespace, but do not anymore. The client # will make a new request for the document at its new location. # Example: # Redirect permanent /foo http://www.example.com/bar # # Alias: Maps web paths into filesystem paths and is used to # access content that does not live under the DocumentRoot. # Example: # Alias /webpath /full/filesystem/path # # If you include a trailing / on /webpath then the server will # require it to be present in the URL. You will also likely # need to provide a <Directory> section to allow access to # the filesystem path. # # ScriptAlias: This controls which directories contain server scripts. # ScriptAliases are essentially the same as Aliases, except that # documents in the target directory are treated as applications and # run by the server when requested rather than as documents sent to the # client. The same rules about trailing "/" apply to ScriptAlias # directives as to Alias. # ScriptAlias /cgi-bin/ "/opt/lampp/cgi-bin/" </IfModule> <IfModule cgid_module> # # ScriptSock: On threaded servers, designate the path to the UNIX # socket used to communicate with the CGI daemon of mod_cgid. # #Scriptsock logs/cgisock </IfModule> # # "/opt/lampp/cgi-bin" should be changed to whatever your ScriptAliased # CGI directory exists, if you have that configured. # <Directory "/opt/lampp/cgi-bin"> AllowOverride None Options None Require all granted </Directory> <IfModule mime_module> # # TypesConfig points to the file containing the list of mappings from # filename extension to MIME-type. # TypesConfig etc/mime.types # # AddType allows you to add to or override the MIME configuration # file specified in TypesConfig for specific file types. # #AddType application/x-gzip .tgz # # AddEncoding allows you to have certain browsers uncompress # information on the fly. Note: Not all browsers support this. # #AddEncoding x-compress .Z #AddEncoding x-gzip .gz .tgz # # If the AddEncoding directives above are commented-out, then you # probably should define those extensions to indicate media types: # AddType application/x-compress .Z AddType application/x-gzip .gz .tgz # # AddHandler allows you to map certain file extensions to "handlers": # actions unrelated to filetype. These can be either built into the server # or added with the Action directive (see below) # # To use CGI scripts outside of ScriptAliased directories: # (You will also need to add "ExecCGI" to the "Options" directive.) # #AddHandler cgi-script .cgi # XAMPP, since LAMPP 0.9.8: AddHandler cgi-script .cgi .pl # For type maps (negotiated resources): #AddHandler type-map var # # Filters allow you to process content before it is sent to the client. # # To parse .shtml files for server-side includes (SSI): # (You will also need to add "Includes" to the "Options" directive.) # # XAMPP AddType text/html .shtml AddOutputFilter INCLUDES .shtml </IfModule> # # The mod_mime_magic module allows the server to use various hints from the # contents of the file itself to determine its type. The MIMEMagicFile # directive tells the module where the hint definitions are located. # #MIMEMagicFile etc/magic # # Customizable error responses come in three flavors: # 1) plain text 2) local redirects 3) external redirects # # Some examples: #ErrorDocument 500 "The server made a boo boo." #ErrorDocument 404 /missing.html #ErrorDocument 404 "/cgi-bin/missing_handler.pl" #ErrorDocument 402 http://www.example.com/subscription_info.html # # # MaxRanges: Maximum number of Ranges in a request before # returning the entire resource, or one of the special # values 'default', 'none' or 'unlimited'. # Default setting is to accept 200 Ranges. #MaxRanges unlimited # # EnableMMAP and EnableSendfile: On systems that support it, # memory-mapping or the sendfile syscall may be used to deliver # files. This usually improves server performance, but must # be turned off when serving from networked-mounted # filesystems or if support for these functions is otherwise # broken on your system. # Defaults: EnableMMAP On, EnableSendfile Off # EnableMMAP off EnableSendfile off # Supplemental configuration # # The configuration files in the etc/extra/ directory can be # included to add extra features or to modify the default configuration of # the server, or you may simply copy their contents here and change as # necessary. # Server-pool management (MPM specific) #Include etc/extra/httpd-mpm.conf # Multi-language error messages Include etc/extra/httpd-multilang-errordoc.conf # Fancy directory listings Include etc/extra/httpd-autoindex.conf # Language settings #Include etc/extra/httpd-languages.conf # User home directories #Include etc/extra/httpd-userdir.conf # Real-time info on requests and configuration #Include etc/extra/httpd-info.conf # Virtual hosts Include etc/extra/httpd-vhosts.conf # Local access to the Apache HTTP Server Manual #Include etc/extra/httpd-manual.conf # Distributed authoring and versioning (WebDAV) #Include etc/extra/httpd-dav.conf # Various default settings Include etc/extra/httpd-default.conf # Configure mod_proxy_html to understand HTML4/XHTML1 <IfModule proxy_html_module> Include etc/extra/proxy-html.conf </IfModule> # Secure (SSL/TLS) connections <IfModule ssl_module> # XAMPP <IfDefine SSL> Include etc/extra/httpd-ssl.conf </IfDefine> </IfModule> # # Note: The following must must be present to support # starting without SSL on platforms with no /dev/random equivalent # but a statically compiled-in mod_ssl. # <IfModule ssl_module> SSLRandomSeed startup builtin SSLRandomSeed connect builtin </IfModule> # XAMPP Include etc/extra/httpd-xampp.conf Include "/opt/lampp/apache2/conf/httpd.conf" I used command shown in this example. I used below lines to change and add group Add group "groupadd www" Add user to group "usermod -aG www root" Change htdocs group "chgrp -R www /opt/lampp/htdocs" Change sitedir group "chgrp -R www /opt/lampp/htdocs/mysite" Change htdocs chmod "chmod 2775 /opt/lampp/htdocs" Change sitedir chmod "chmod 2775 /opt/lampp/htdocs/mysite" And then I changed my vhosts.conf file # Virtual Hosts # # Required modules: mod_log_config # If you want to maintain multiple domains/hostnames on your # machine you can setup VirtualHost containers for them. Most configurations # use only name-based virtual hosts so the server doesn't need to worry about # IP addresses. This is indicated by the asterisks in the directives below. # # Please see the documentation at # <URL:http://httpd.apache.org/docs/2.4/vhosts/> # for further details before you try to setup virtual hosts. # # You may use the command line option '-S' to verify your virtual host # configuration. # # VirtualHost example: # Almost any Apache directive may go into a VirtualHost container. # The first VirtualHost section is used for all requests that do not # match a ServerName or ServerAlias in any <VirtualHost> block. # <VirtualHost *:80> ServerAdmin [email protected] DocumentRoot "/opt/lampp/docs/dummy-host.example.com" ServerName dummy-host.example.com ServerAlias www.dummy-host.example.com ErrorLog "logs/dummy-host.example.com-error_log" CustomLog "logs/dummy-host.example.com-access_log" common </VirtualHost> <VirtualHost *:80> ServerAdmin [email protected] DocumentRoot "/opt/lampp/docs/dummy-host2.example.com" ServerName dummy-host2.example.com ErrorLog "logs/dummy-host2.example.com-error_log" CustomLog "logs/dummy-host2.example.com-access_log" common </VirtualHost> NameVirtualHost * <VirtualHost *> ServerAdmin [email protected] DocumentRoot "/opt/lampp/htdocs/mysite" ServerName mysite.com ServerAlias mysite.com ErrorLog "/opt/lampp/htdocs/mysite/errorlogs" CustomLog "/opt/lampp/htdocs/mysite/customlog" common <Directory "/opt/lampp/htdocs/mysite"> Options Indexes FollowSymLinks Includes ExecCGI AllowOverride All Order Allow,Deny Allow from all Require all granted </Directory> </VirtualHost> but still its not working and I am getting 403 error on my ip and domain however I can access phpmyadmin. If anyone can help me, please help me.

  Read the article

• Magento, NGINX, PHP-FPM, APC, MEMCACHED, 16gb Ram CentOS, Spiking PHP-FPM to 100% CPU

  - by Terry Dunford

  I have been trying to resolve my issue of spiking cpu caused by php-fpm processes. I've reduced the php-fpm config settings to: pm = ondemand pm.max_children = 12 pm.start_servers = 2 pm.min_spare_servers = 2 pm.max_spare_servers = 10 pm.max_requests = 500 php_admin_value[memory_limit] = 128M Problem still exists. I'm running a Joomla main site (which is having no problems) and a Magento store in a sub-directory. My server is a Linux CentOS, running NGINX, APC, Memcached, Full Page Cache and php-fpm. My server has 8 cores and 16gb dedicated ram. My host has shut down my server several times the past week because my php-fpm processes are consuming the entire network. A lot of the individual php-fpm processes are getting over 50% cpu. I've hired several "professionals" and none of them was able to help me, so now broke and stumped, I'm turning to you guys for help. So any suggestions would be greatly appreciated. I turned on slow php logs and here are some of the latest results: [01-Apr-2012 14:26:12] [pool magento] pid 21537 script_filename = /home/flyfish/www/flyshop/index.php [0x0000000011a394f8] _renderStraightjoin() /home/flyfish/www/flyshop/lib/Varien/Db/Select.php:397 [0x0000000011a39158] _renderStraightjoin() /home/flyfish/www/flyshop/lib/Zend/Db/Select.php:705 [0x0000000011a38f30] assemble() /home/flyfish/www/flyshop/lib/Zend/Db/Select.php:1343 [0x00007fffbb6d6e50] __toString() unknown:0 [0x0000000011a38630] _prepareQuery() /home/flyfish/www/flyshop/lib/Varien/Db/Adapter/Pdo/Mysql.php:409 [0x0000000011a38270] _prepareQuery() /home/flyfish/www/flyshop/lib/Varien/Db/Adapter/Pdo/Mysql.php:388 [0x0000000011a38008] query() /home/flyfish/www/flyshop/lib/Zend/Db/Adapter/Abstract.php:734 [0x0000000011a375c8] fetchAll() /home/flyfish/www/flyshop/app/code/core/Mage/Catalog/Model/Resource/Product/Type/Configurable/Attribute/Collection.php:196 [0x0000000011a370e0] _loadLabels() /home/flyfish/www/flyshop/app/code/core/Mage/Catalog/Model/Resource/Product/Type/Configurable/Attribute/Collection.php:129 [0x0000000011a369a0] _afterLoad() /home/flyfish/www/flyshop/lib/Varien/Data/Collection/Db.php:536 [0x0000000011a364a8] load() /home/flyfish/www/flyshop/app/code/core/Mage/Catalog/Model/Product/Type/Configurable.php:253 [0x0000000011a35968] getConfigurableAttributes() /home/flyfish/www/flyshop/app/code/core/Mage/Catalog/Model/Product/Type/Configurable.php:330 [0x0000000011a35590] getUsedProducts() /home/flyfish/www/flyshop/app/code/core/Mage/Catalog/Model/Product/Type/Configurable.php:458 [0x0000000011a35410] isSalable() /home/flyfish/www/flyshop/app/code/core/Mage/Catalog/Model/Product.php:1264 [0x0000000011a35098] isAvailable() /home/flyfish/www/flyshop/app/code/core/Mage/Catalog/Model/Product.php:1244 [0x0000000011a34fa8] isSalable() /home/flyfish/www/flyshop/app/code/core/Mage/Catalog/Model/Product.php:1308 [0x0000000011a33998] isSaleable() /home/flyfish/www/flyshop/app/design/frontend/moxy/default/template/rokmagemodules/rokmage-categoryview/rokmage-categoryview.phtml:122 [0x0000000011a331f0] +++ dump failed [01-Apr-2012 14:26:44] [pool magento] pid 21531 script_filename = /home/flyfish/www/flyshop/index.php [0x0000000011a37768] _loadPrices() /home/flyfish/www/flyshop/app/code/core/Mage/Catalog/Model/Resource/Product/Type/Configurable/Attribute/Collection.php:251 [0x0000000011a37280] _loadPrices() /home/flyfish/www/flyshop/app/code/core/Mage/Catalog/Model/Resource/Product/Type/Configurable/Attribute/Collection.php:132 [0x0000000011a36b40] _afterLoad() /home/flyfish/www/flyshop/lib/Varien/Data/Collection/Db.php:536 [0x0000000011a36648] load() /home/flyfish/www/flyshop/app/code/core/Mage/Catalog/Model/Product/Type/Configurable.php:253 [0x0000000011a35b08] getConfigurableAttributes() /home/flyfish/www/flyshop/app/code/core/Mage/Catalog/Model/Product/Type/Configurable.php:330 [0x0000000011a35730] getUsedProducts() /home/flyfish/www/flyshop/app/code/core/Mage/Catalog/Model/Product/Type/Configurable.php:458 [0x0000000011a355b0] isSalable() /home/flyfish/www/flyshop/app/code/core/Mage/Catalog/Model/Product.php:1264 [0x0000000011a35238] isAvailable() /home/flyfish/www/flyshop/app/code/core/Mage/Catalog/Model/Product.php:1244 [0x0000000011a35148] isSalable() /home/flyfish/www/flyshop/app/code/core/Mage/Catalog/Model/Product.php:1308 [0x0000000011a33b38] isSaleable() /home/flyfish/www/flyshop/app/design/frontend/moxy/default/template/rokmagemodules/rokmage-categoryview/rokmage-categoryview.phtml:122 [0x0000000011a33390] +++ dump failed [01-Apr-2012 14:27:01] [pool magento] pid 21528 script_filename = /home/flyfish/www/flyshop/index.php [0x0000000011ff67a8] execute() /home/flyfish/www/flyshop/lib/Zend/Db/Statement/Pdo.php:228 [0x0000000011ff6518] _execute() /home/flyfish/www/flyshop/lib/Varien/Db/Statement/Pdo/Mysql.php:110 [0x0000000011ff5e90] _execute() /home/flyfish/www/flyshop/lib/Zend/Db/Statement.php:300 [0x0000000011ff5a20] execute() /home/flyfish/www/flyshop/lib/Zend/Db/Adapter/Abstract.php:479 [0x0000000011ff5438] query() /home/flyfish/www/flyshop/lib/Zend/Db/Adapter/Pdo/Abstract.php:238 [0x0000000011ff5078] query() /home/flyfish/www/flyshop/lib/Varien/Db/Adapter/Pdo/Mysql.php:389 [0x0000000011ff4e98] query() /home/flyfish/www/flyshop/lib/Zend/Db/Adapter/Abstract.php:825 [0x0000000011ff4948] fetchOne() /home/flyfish/www/flyshop/app/code/core/Mage/Catalog/Model/Resource/Category/Flat.php:1161 [0x0000000011ff4678] getProductCount() /home/flyfish/www/flyshop/app/code/core/Mage/Catalog/Model/Category.php:801 [0x0000000011ff33e0] getProductCount() /home/flyfish/www/flyshop/app/code/local/Extendware/EWLayeredNav/Model/Library/Plugin/Catalog/Layer/Filter/Category.php:54 [0x0000000011ff2da0] _initItemsData() /home/flyfish/www/flyshop/app/code/local/Extendware/EWLayeredNav/Model/Library/Plugin/Catalog/Layer/Filter/Category.php:23 [0x0000000011ff2818] _getItemsData() /home/flyfish/www/flyshop/app/code/local/Extendware/EWLayeredNav/Model/Library/Plugin/Catalog/Layer/Filter/Category.php:119 [0x0000000011ff26b0] _initItems() /home/flyfish/www/flyshop/app/code/core/Mage/Catalog/Model/Layer/Filter/Abstract.php:120 [0x0000000011ff2598] getItems() /home/flyfish/www/flyshop/app/code/core/Mage/Catalog/Model/Layer/Filter/Abstract.php:109 [0x0000000011ff2480] getItemsCount() /home/flyfish/www/flyshop/app/code/core/Mage/Catalog/Block/Layer/Filter/Abstract.php:126 [0x0000000011ff22b8] getItemsCount() /home/flyfish/www/flyshop/var/cache/extendware/ewcore/overrides/Mage/Catalog/Block/Layer/View/67dcc5dfa9c44bd3a205b75a08193105.php:218 [0x0000000011ff2088] canShowOptions() /home/flyfish/www/flyshop/var/cache/extendware/ewcore/overrides/Mage/Catalog/Block/Layer/View/67dcc5dfa9c44bd3a205b75a08193105.php:233 [0x0000000011ff14f8] canShowBlock() /home/flyfish/www/flyshop/app/design/frontend/moxy/default/template/extendware/ewlayerednav/catalog/layer/view.phtml:6 [0x0000000011ff0d50] +++ dump failed [01-Apr-2012 14:27:04] [pool magento] pid 21529 script_filename = /home/flyfish/www/flyshop/index.php [0x0000000012468ff8] execute() /home/flyfish/www/flyshop/lib/Zend/Db/Statement/Pdo.php:228 [0x0000000012468d68] _execute() /home/flyfish/www/flyshop/lib/Varien/Db/Statement/Pdo/Mysql.php:110 [0x00000000124686e0] _execute() /home/flyfish/www/flyshop/lib/Zend/Db/Statement.php:300 [0x0000000012468270] execute() /home/flyfish/www/flyshop/lib/Zend/Db/Adapter/Abstract.php:479 [0x0000000012467c88] query() /home/flyfish/www/flyshop/lib/Zend/Db/Adapter/Pdo/Abstract.php:238 [0x00000000124678c8] query() /home/flyfish/www/flyshop/lib/Varien/Db/Adapter/Pdo/Mysql.php:389 [0x0000000012467660] query() /home/flyfish/www/flyshop/lib/Zend/Db/Adapter/Abstract.php:734 [0x0000000012467248] fetchAll() /home/flyfish/www/flyshop/lib/Varien/Data/Collection/Db.php:687 [0x00000000124668f0] _fetchAll() /home/flyfish/www/flyshop/app/code/core/Mage/Eav/Model/Entity/Collection/Abstract.php:1045 [0x0000000012466288] _loadEntities() /home/flyfish/www/flyshop/app/code/core/Mage/Eav/Model/Entity/Collection/Abstract.php:869 [0x0000000012465fb0] load() /home/flyfish/www/flyshop/app/code/core/Mage/Review/Model/Observer.php:78 [0x0000000012465d10] catalogBlockProductCollectionBeforeToHtml() /home/flyfish/www/flyshop/app/code/core/Mage/Core/Model/App.php:1303 [0x0000000012464c28] _callObserverMethod() /home/flyfish/www/flyshop/app/code/core/Mage/Core/Model/App.php:1278 [0x00000000124649e0] dispatchEvent() /home/flyfish/www/flyshop/app/Mage.php:416 [0x0000000012464290] dispatchEvent() /home/flyfish/www/flyshop/app/code/core/Mage/Catalog/Block/Product/List.php:163 [0x0000000012463760] _beforeToHtml() /home/flyfish/www/flyshop/var/ait_rewrite/6bfe16ca572eea47db567910902c6209.php:864 [0x00000000124633b0] toHtml() /home/flyfish/www/flyshop/var/ait_rewrite/6bfe16ca572eea47db567910902c6209.php:584 [0x0000000012462e30] _getChildHtml() /home/flyfish/www/flyshop/var/ait_rewrite/6bfe16ca572eea47db567910902c6209.php:528 [0x0000000012462d38] getChildHtml() /home/flyfish/www/flyshop/var/cache/extendware/ewcore/overrides/Mage/Catalog/Block/Category/View/6362e7526f5dcb27e7f8b0b414b59004.php:85 [0x00000000124629f0] getProductListHtml() /home/flyfish/www/flyshop/app/code/local/Extendware/EWLayeredNav/Block/Override/Mage/Catalog/Category/View.php:20 [01-Apr-2012 14:27:55] [pool magento] pid 21536 script_filename = /home/flyfish/www/flyshop/index.php [0x0000000011a35010] execute() /home/flyfish/www/flyshop/lib/Zend/Db/Statement/Pdo.php:228 [0x0000000011a34d80] _execute() /home/flyfish/www/flyshop/lib/Varien/Db/Statement/Pdo/Mysql.php:110 [0x0000000011a346f8] _execute() /home/flyfish/www/flyshop/lib/Zend/Db/Statement.php:300 [0x0000000011a34288] execute() /home/flyfish/www/flyshop/lib/Zend/Db/Adapter/Abstract.php:479 [0x0000000011a33ca0] query() /home/flyfish/www/flyshop/lib/Zend/Db/Adapter/Pdo/Abstract.php:238 [0x0000000011a338e0] query() /home/flyfish/www/flyshop/lib/Varien/Db/Adapter/Pdo/Mysql.php:389 [0x0000000011a33700] query() /home/flyfish/www/flyshop/lib/Zend/Db/Adapter/Abstract.php:825 [0x0000000011a33368] fetchOne() /home/flyfish/www/flyshop/app/code/core/Mage/Eav/Model/Resource/Entity/Type.php:71 [0x0000000011a33238] getAdditionalAttributeTable() /home/flyfish/www/flyshop/app/code/core/Mage/Eav/Model/Resource/Entity/Attribute.php:483 [0x0000000011a32be8] getAdditionalAttributeTable() /home/flyfish/www/flyshop/app/code/core/Mage/Eav/Model/Resource/Entity/Attribute.php:500 [0x0000000011a32860] _afterLoad() /home/flyfish/www/flyshop/app/code/core/Mage/Eav/Model/Resource/Entity/Attribute.php:108 [0x0000000011a32330] loadByCode() /home/flyfish/www/flyshop/app/code/core/Mage/Eav/Model/Entity/Attribute/Abstract.php:118 [0x0000000011a31350] loadByCode() /home/flyfish/www/flyshop/app/code/core/Mage/Eav/Model/Config.php:423 [0x0000000011a30ce8] getAttribute() /home/flyfish/www/flyshop/app/code/core/Mage/Catalog/Helper/Output.php:156 [0x0000000011a30208] categoryAttribute() /home/flyfish/www/flyshop/app/design/frontend/base/default/template/catalog/category/view.phtml:47 [0x0000000011a2fa60] +++ dump failed [01-Apr-2012 14:27:56] [pool magento] pid 21530 script_filename = /home/flyfish/www/flyshop/index.php [0x0000000011a35b10] updateParamDefaults() /home/flyfish/www/flyshop/var/ait_rewrite/78778b0d1ad4bf93e846365bd2fbf33f.php:276 [0x0000000011a35750] updateParamDefaults() /home/flyfish/www/flyshop/var/ait_rewrite/78778b0d1ad4bf93e846365bd2fbf33f.php:326 [0x0000000011a351f0] getSkinBaseUrl() /home/flyfish/www/flyshop/var/ait_rewrite/78778b0d1ad4bf93e846365bd2fbf33f.php:482 [0x0000000011a350a8] getSkinUrl() /home/flyfish/www/flyshop/var/ait_rewrite/6bfe16ca572eea47db567910902c6209.php:981 [0x0000000011a32468] getSkinUrl() /home/flyfish/www/flyshop/app/code/local/Extendware/EWMinify/Block/Override/Mage/Page/Html/Head.php:126 [0x0000000011a30ca8] getCssJsHtml() /home/flyfish/www/flyshop/app/code/local/Extendware/EWCore/Block/Override/Mage/Page/Html/Head.php:55 [0x0000000011a30978] getCssJsHtml() /home/flyfish/www/flyshop/app/code/local/MageWorx/SeoSuite/Block/Page/Html/Head.php:41 [0x0000000011a2fd10] getCssJsHtml() /home/flyfish/www/flyshop/app/design/frontend/moxy/default/template/rokmagemodules/rokmage-modalheader/rokmage-head.phtml:26 [0x0000000011a2f568] +++ dump failed [01-Apr-2012 14:28:28] [pool magento] pid 21527 script_filename = /home/flyfish/www/flyshop/index.php [0x0000000010c7bba0] execute() /home/flyfish/www/flyshop/lib/Zend/Db/Statement/Pdo.php:228 [0x0000000010c7b910] _execute() /home/flyfish/www/flyshop/lib/Varien/Db/Statement/Pdo/Mysql.php:110 [0x0000000010c7b288] _execute() /home/flyfish/www/flyshop/lib/Zend/Db/Statement.php:300 [0x0000000010c7ae18] execute() /home/flyfish/www/flyshop/lib/Zend/Db/Adapter/Abstract.php:479 [0x0000000010c7a830] query() /home/flyfish/www/flyshop/lib/Zend/Db/Adapter/Pdo/Abstract.php:238 [0x0000000010c7a470] query() /home/flyfish/www/flyshop/lib/Varien/Db/Adapter/Pdo/Mysql.php:389 [0x0000000010c7a168] query() /home/flyfish/www/flyshop/lib/Zend/Db/Adapter/Abstract.php:808 [0x0000000010c79558] fetchPairs() /home/flyfish/www/flyshop/app/code/core/Mage/Catalog/Model/Resource/Product/Collection.php:840 [0x0000000010c79240] addCountToCategories() /home/flyfish/www/flyshop/app/code/community/Mage/Catalog/Block/Navigation.php:133 [0x0000000010c71d48] getCurrentChildCategories() /home/flyfish/www/flyshop/app/design/frontend/base/default/template/rokmagemodules/rokmage-magemenus/rokmage-magemenu-left.phtml:139 [0x0000000010c715a0] +++ dump failed [01-Apr-2012 14:28:28] [pool magento] pid 21577 script_filename = /home/flyfish/www/flyshop/index.php [0x0000000011a3a8d8] execute() /home/flyfish/www/flyshop/lib/Zend/Db/Statement/Pdo.php:228 [0x0000000011a3a648] _execute() /home/flyfish/www/flyshop/lib/Varien/Db/Statement/Pdo/Mysql.php:110 [0x0000000011a39fc0] _execute() /home/flyfish/www/flyshop/lib/Zend/Db/Statement.php:300 [0x0000000011a39b50] execute() /home/flyfish/www/flyshop/lib/Zend/Db/Adapter/Abstract.php:479 [0x0000000011a39568] query() /home/flyfish/www/flyshop/lib/Zend/Db/Adapter/Pdo/Abstract.php:238 [0x0000000011a391a8] query() /home/flyfish/www/flyshop/lib/Varien/Db/Adapter/Pdo/Mysql.php:389 [0x0000000011a38f40] query() /home/flyfish/www/flyshop/lib/Zend/Db/Adapter/Abstract.php:734 [0x0000000011a37cc0] fetchAll() /home/flyfish/www/flyshop/app/code/core/Mage/Catalog/Model/Resource/Category/Flat.php:276 [0x0000000011a37b20] _loadNodes() /home/flyfish/www/flyshop/app/code/core/Mage/Catalog/Model/Resource/Category/Flat.php:1229 [0x0000000011a379a0] getChildrenCategories() /home/flyfish/www/flyshop/app/code/core/Mage/Catalog/Model/Category.php:841 [0x0000000011a37690] getChildrenCategories() /home/flyfish/www/flyshop/app/code/community/Mage/Catalog/Block/Navigation.php:130 [0x0000000011a30198] getCurrentChildCategories() /home/flyfish/www/flyshop/app/design/frontend/base/default/template/rokmagemodules/rokmage-magemenus/rokmage-magemenu-left.phtml:139 [0x0000000011a2f9f0] +++ dump failed [01-Apr-2012 14:28:48] [pool magento] pid 21629 script_filename = /home/flyfish/www/flyshop/index.php [0x00002ac987e2cb48] _loadPrices() /home/flyfish/www/flyshop/app/code/core/Mage/Catalog/Model/Resource/Product/Type/Configurable/Attribute/Collection.php:252 [0x00002ac987e2c660] _loadPrices() /home/flyfish/www/flyshop/app/code/core/Mage/Catalog/Model/Resource/Product/Type/Configurable/Attribute/Collection.php:132 [0x00002ac987e2bf20] _afterLoad() /home/flyfish/www/flyshop/lib/Varien/Data/Collection/Db.php:536 [0x00002ac987e2ba28] load() /home/flyfish/www/flyshop/app/code/core/Mage/Catalog/Model/Product/Type/Configurable.php:253 [0x00002ac987e2aee8] getConfigurableAttributes() /home/flyfish/www/flyshop/app/code/core/Mage/Catalog/Model/Product/Type/Configurable.php:330 [0x00002ac987e2ab10] getUsedProducts() /home/flyfish/www/flyshop/app/code/core/Mage/Catalog/Model/Product/Type/Configurable.php:458 [0x00002ac987e2a990] isSalable() /home/flyfish/www/flyshop/app/code/core/Mage/Catalog/Model/Product.php:1264 [0x00002ac987e2a618] isAvailable() /home/flyfish/www/flyshop/app/code/core/Mage/Catalog/Model/Product.php:1244 [0x00002ac987e2a528] isSalable() /home/flyfish/www/flyshop/app/code/core/Mage/Catalog/Model/Product.php:1308 [0x00002ac987e28f18] isSaleable() /home/flyfish/www/flyshop/app/design/frontend/moxy/default/template/rokmagemodules/rokmage-categoryview/rokmage-categoryview.phtml:122 [0x00002ac987e28770] +++ dump failed ___________________________________________ A snippet of the Latest php-fpm error log: [01-Apr-2012 14:26:12] WARNING: [pool magento] child 21537, script '/home/flyfish/www/flyshop/index.php' (request: "GET /flyshop/index.php") executing too slow (5.265105 sec), logging [01-Apr-2012 14:26:12] ERROR: failed to ptrace(PEEKDATA) pid 21537: Input/output error (5) [01-Apr-2012 14:26:44] WARNING: [pool magento] child 21531, script '/home/flyfish/www/flyshop/index.php' (request: "GET /flyshop/index.php") executing too slow (5.268434 sec), logging [01-Apr-2012 14:26:44] ERROR: failed to ptrace(PEEKDATA) pid 21531: Input/output error (5) [01-Apr-2012 14:27:01] WARNING: [pool magento] child 21528, script '/home/flyfish/www/flyshop/index.php' (request: "GET /flyshop/index.php") executing too slow (6.656633 sec), logging [01-Apr-2012 14:27:01] ERROR: failed to ptrace(PEEKDATA) pid 21528: Input/output error (5) [01-Apr-2012 14:27:04] WARNING: [pool magento] child 21529, script '/home/flyfish/www/flyshop/index.php' (request: "GET /flyshop/index.php") executing too slow (5.211136 sec), logging [01-Apr-2012 14:27:55] WARNING: [pool magento] child 21536, script '/home/flyfish/www/flyshop/index.php' (request: "GET /flyshop/index.php") executing too slow (5.207001 sec), logging [01-Apr-2012 14:27:55] ERROR: failed to ptrace(PEEKDATA) pid 21536: Input/output error (5) [01-Apr-2012 14:27:56] WARNING: [pool magento] child 21530, script '/home/flyfish/www/flyshop/index.php' (request: "GET /flyshop/index.php") executing too slow (5.503186 sec), logging [01-Apr-2012 14:27:56] ERROR: failed to ptrace(PEEKDATA) pid 21530: Input/output error (5) [01-Apr-2012 14:28:28] WARNING: [pool magento] child 21577, script '/home/flyfish/www/flyshop/index.php' (request: "GET /flyshop/index.php") executing too slow (5.722625 sec), logging [01-Apr-2012 14:28:28] WARNING: [pool magento] child 21527, script '/home/flyfish/www/flyshop/index.php' (request: "GET /flyshop/index.php") executing too slow (5.122326 sec), logging [01-Apr-2012 14:28:28] ERROR: failed to ptrace(PEEKDATA) pid 21527: Input/output error (5) [01-Apr-2012 14:28:28] ERROR: failed to ptrace(PEEKDATA) pid 21577: Input/output error (5) [01-Apr-2012 14:28:48] WARNING: [pool magento] child 21629, script '/home/flyfish/www/flyshop/index.php' (request: "GET /flyshop/index.php") executing too slow (5.446961 sec), logging [01-Apr-2012 14:28:48] ERROR: failed to ptrace(PEEKDATA) pid 21629: Input/output error (5) _____________________________________________ I also noticed that the server is not using much memory: Mem: 16777216k total, 1204040k used, 15573176k free My.conf settings: query_cache_size = 128M innodb_buffer_pool_size = 512M open-files-limit = 8192 table_cache=4096 I just noticed that someone changed my innodb_buffer_pool_size to 512M. Shouldn't this be set to 80% of available ram? So I have 16gb ram so it should be set at 12G; however, I set it at 10G. What do you think? I made that change and restart everything. Php-fpm is still spiking cpu. Here is just 1 php-fpm process: 23942 user 17 0 507m 99m 27m R 90.9%CPU 0.6 0:03.46 php-fpm I'm sure there may be more information you will need to help, so just let me know what you guys need to help me figure this out. Thank you.

  Read the article

• OpenVPN Client timing out

  - by Austin

  I recently installed OpenVPN on my Ubuntu VPS. Whenenver I try to connect to it, I can establish a connection just fine. However, everything I try to connect to times out. If I try to ping something, it will resolve the IP, but will time out after resolving the IP. (So DNS Server seems to be working correctly) My server.conf has this relevant information (At least I think it's relevant. I'm not sure if you need more or not) # Which local IP address should OpenVPN # listen on? (optional) ;local a.b.c.d # Which TCP/UDP port should OpenVPN listen on? # If you want to run multiple OpenVPN instances # on the same machine, use a different port # number for each one. You will need to # open up this port on your firewall. port 1194 # TCP or UDP server? ;proto tcp proto udp # "dev tun" will create a routed IP tunnel, # "dev tap" will create an ethernet tunnel. # Use "dev tap0" if you are ethernet bridging # and have precreated a tap0 virtual interface # and bridged it with your ethernet interface. # If you want to control access policies # over the VPN, you must create firewall # rules for the the TUN/TAP interface. # On non-Windows systems, you can give # an explicit unit number, such as tun0. # On Windows, use "dev-node" for this. # On most systems, the VPN will not function # unless you partially or fully disable # the firewall for the TUN/TAP interface. ;dev tap dev tun # Windows needs the TAP-Win32 adapter name # from the Network Connections panel if you # have more than one. On XP SP2 or higher, # you may need to selectively disable the # Windows firewall for the TAP adapter. # Non-Windows systems usually don't need this. ;dev-node MyTap # SSL/TLS root certificate (ca), certificate # (cert), and private key (key). Each client # and the server must have their own cert and # key file. The server and all clients will # use the same ca file. # # See the "easy-rsa" directory for a series # of scripts for generating RSA certificates # and private keys. Remember to use # a unique Common Name for the server # and each of the client certificates. # # Any X509 key management system can be used. # OpenVPN can also use a PKCS #12 formatted key file # (see "pkcs12" directive in man page). ca ca.crt cert server.crt key server.key # This file should be kept secret # Diffie hellman parameters. # Generate your own with: # openssl dhparam -out dh1024.pem 1024 # Substitute 2048 for 1024 if you are using # 2048 bit keys. dh dh1024.pem # Configure server mode and supply a VPN subnet # for OpenVPN to draw client addresses from. # The server will take 10.8.0.1 for itself, # the rest will be made available to clients. # Each client will be able to reach the server # on 10.8.0.1. Comment this line out if you are # ethernet bridging. See the man page for more info. server 10.8.0.0 255.255.255.0 # Maintain a record of client <-> virtual IP address # associations in this file. If OpenVPN goes down or # is restarted, reconnecting clients can be assigned # the same virtual IP address from the pool that was # previously assigned. ifconfig-pool-persist ipp.txt # Configure server mode for ethernet bridging. # You must first use your OS's bridging capability # to bridge the TAP interface with the ethernet # NIC interface. Then you must manually set the # IP/netmask on the bridge interface, here we # assume 10.8.0.4/255.255.255.0. Finally we # must set aside an IP range in this subnet # (start=10.8.0.50 end=10.8.0.100) to allocate # to connecting clients. Leave this line commented # out unless you are ethernet bridging. ;server-bridge 10.8.0.4 255.255.255.0 10.8.0.50 10.8.0.100 # Configure server mode for ethernet bridging # using a DHCP-proxy, where clients talk # to the OpenVPN server-side DHCP server # to receive their IP address allocation # and DNS server addresses. You must first use # your OS's bridging capability to bridge the TAP # interface with the ethernet NIC interface. # Note: this mode only works on clients (such as # Windows), where the client-side TAP adapter is # bound to a DHCP client. ;server-bridge # Push routes to the client to allow it # to reach other private subnets behind # the server. Remember that these # private subnets will also need # to know to route the OpenVPN client # address pool (10.8.0.0/255.255.255.0) # back to the OpenVPN server. ;push "route 192.168.10.0 255.255.255.0" ;push "route 192.168.20.0 255.255.255.0" # To assign specific IP addresses to specific # clients or if a connecting client has a private # subnet behind it that should also have VPN access, # use the subdirectory "ccd" for client-specific # configuration files (see man page for more info). # EXAMPLE: Suppose the client # having the certificate common name "Thelonious" # also has a small subnet behind his connecting # machine, such as 192.168.40.128/255.255.255.248. # First, uncomment out these lines: ;client-config-dir ccd ;route 192.168.40.128 255.255.255.248 # Then create a file ccd/Thelonious with this line: # iroute 192.168.40.128 255.255.255.248 # This will allow Thelonious' private subnet to # access the VPN. This example will only work # if you are routing, not bridging, i.e. you are # using "dev tun" and "server" directives. # EXAMPLE: Suppose you want to give # Thelonious a fixed VPN IP address of 10.9.0.1. # First uncomment out these lines: ;client-config-dir ccd ;route 10.9.0.0 255.255.255.252 # Then add this line to ccd/Thelonious: # ifconfig-push 10.9.0.1 10.9.0.2 # Suppose that you want to enable different # firewall access policies for different groups # of clients. There are two methods: # (1) Run multiple OpenVPN daemons, one for each # group, and firewall the TUN/TAP interface # for each group/daemon appropriately. # (2) (Advanced) Create a script to dynamically # modify the firewall in response to access # from different clients. See man # page for more info on learn-address script. ;learn-address ./script # If enabled, this directive will configure # all clients to redirect their default # network gateway through the VPN, causing # all IP traffic such as web browsing and # and DNS lookups to go through the VPN # (The OpenVPN server machine may need to NAT # or bridge the TUN/TAP interface to the internet # in order for this to work properly). push "redirect-gateway def1 bypass-dhcp" push "dhcp-option DNS 8.8.8.8" # Certain Windows-specific network settings # can be pushed to clients, such as DNS # or WINS server addresses. CAVEAT: # http://openvpn.net/faq.html#dhcpcaveats # The addresses below refer to the public # DNS servers provided by opendns.com. ;push "dhcp-option DNS 8.8.8.8" push "dhcp-option DNS 8.8.4.4" # Uncomment this directive to allow different # clients to be able to "see" each other. # By default, clients will only see the server. # To force clients to only see the server, you # will also need to appropriately firewall the # server's TUN/TAP interface. ;client-to-client # Uncomment this directive if multiple clients # might connect with the same certificate/key # files or common names. This is recommended # only for testing purposes. For production use, # each client should have its own certificate/key # pair. # # IF YOU HAVE NOT GENERATED INDIVIDUAL # CERTIFICATE/KEY PAIRS FOR EACH CLIENT, # EACH HAVING ITS OWN UNIQUE "COMMON NAME", # UNCOMMENT THIS LINE OUT. ;duplicate-cn # The keepalive directive causes ping-like # messages to be sent back and forth over # the link so that each side knows when # the other side has gone down. # Ping every 10 seconds, assume that remote # peer is down if no ping received during # a 120 second time period. keepalive 10 120 # For extra security beyond that provided # by SSL/TLS, create an "HMAC firewall" # to help block DoS attacks and UDP port flooding. # # Generate with: # openvpn --genkey --secret ta.key # # The server and each client must have # a copy of this key. # The second parameter should be '0' # on the server and '1' on the clients. ;tls-auth ta.key 0 # This file is secret # Select a cryptographic cipher. # This config item must be copied to # the client config file as well. ;cipher BF-CBC # Blowfish (default) ;cipher AES-128-CBC # AES ;cipher DES-EDE3-CBC # Triple-DES # Enable compression on the VPN link. # If you enable it here, you must also # enable it in the client config file. comp-lzo # The maximum number of concurrently connected # clients we want to allow. ;max-clients 100 # It's a good idea to reduce the OpenVPN # daemon's privileges after initialization. # # You can uncomment this out on # non-Windows systems. ;user nobody ;group nogroup # The persist options will try to avoid # accessing certain resources on restart # that may no longer be accessible because # of the privilege downgrade. persist-key persist-tun # Output a short status file showing # current connections, truncated # and rewritten every minute. status openvpn-status.log # By default, log messages will go to the syslog (or # on Windows, if running as a service, they will go to # the "\Program Files\OpenVPN\log" directory). # Use log or log-append to override this default. # "log" will truncate the log file on OpenVPN startup, # while "log-append" will append to it. Use one # or the other (but not both). ;log openvpn.log ;log-append openvpn.log # Set the appropriate level of log # file verbosity. # # 0 is silent, except for fatal errors # 4 is reasonable for general usage # 5 and 6 can help to debug connection problems # 9 is extremely verbose verb 3 # Silence repeating messages. At most 20 # sequential messages of the same message # category will be output to the log. ;mute 20 I've tried on multiple computers by the way. The same result on all of them. What could be wrong? Thanks in advance, and if you need other information I'll gladly post it. Information for new comments root@vps:~# iptables -L -n -v Chain INPUT (policy ACCEPT 862K packets, 51M bytes) pkts bytes target prot opt in out source destination Chain FORWARD (policy ACCEPT 3 packets, 382 bytes) pkts bytes target prot opt in out source destination 0 0 ACCEPT all -- * * 0.0.0.0/0 0.0.0.0/0 state RELATED,ESTABLISHED 4641 298K ACCEPT all -- * * 10.8.0.0/24 0.0.0.0/0 0 0 REJECT all -- * * 0.0.0.0/0 0.0.0.0/0 reject-with icmp-port-unreachable Chain OUTPUT (policy ACCEPT 1671K packets, 2378M bytes) pkts bytes target prot opt in out source destination And root@vps:~# iptables -t nat -L -n -v Chain PREROUTING (policy ACCEPT 17937 packets, 2013K bytes) pkts bytes target prot opt in out source destination Chain POSTROUTING (policy ACCEPT 8975 packets, 562K bytes) pkts bytes target prot opt in out source destination 1579 103K SNAT all -- * * 10.8.0.0/24 0.0.0.0/0 to:SERVERIP Chain OUTPUT (policy ACCEPT 8972 packets, 562K bytes) pkts bytes target prot opt in out source destination

  Read the article

• Memory leak involving jQuery Ajax requests

  - by Eli Courtwright

  I have a webpage that's leaking memory in both IE8 and Firefox; the memory usage displayed in the Windows Process Explorer just keeps growing over time. The following page requests the "unplanned.json" url, which is a static file that never changes (though I do set my Cache-control HTTP header to no-cache to make sure that the Ajax request always goes through). When it gets the results, it clears out an HTML table, loops over the json array it got back from the server, and dynamically adds a row to an HTML table for each entry in the array. Then it waits 2 seconds and repeats this process. Here's the entire webpage: <html> <head> <title>Test Page</title> <script type="text/javascript" src="http://ajax.googleapis.com/ajax/libs/jquery/1.3/jquery.min.js"></script> </head> <body> <script type="text/javascript"> function kickoff() { $.getJSON("unplanned.json", resetTable); } function resetTable(rows) { $("#content tbody").empty(); for(var i=0; i<rows.length; i++) { $("<tr>" + "<td>" + rows[i].mpe_name + "</td>" + "<td>" + rows[i].bin + "</td>" + "<td>" + rows[i].request_time + "</td>" + "<td>" + rows[i].filtered_delta + "</td>" + "<td>" + rows[i].failed_delta + "</td>" + "</tr>").appendTo("#content tbody"); } setTimeout(kickoff, 2000); } $(kickoff); </script> <table id="content" border="1" style="width:100% ; text-align:center"> <thead><tr> <th>MPE</th> <th>Bin</th> <th>When</th> <th>Filtered</th> <th>Failed</th> </tr></thead> <tbody></tbody> </table> </body> </html> If it helps, here's an example of the json I'm sending back (it's this exact array wuith thousands of entries instead of just one): [ { mpe_name: "DBOSS-995", request_time: "09/18/2009 11:51:06", bin: 4, filtered_delta: 1, failed_delta: 1 } ] EDIT: I've accepted Toran's extremely helpful answer, but I feel I should post some additional code, since his removefromdom jQuery plugin has some limitations: It only removes individual elements. So you can't give it a query like `$("#content tbody tr")` and expect it to remove all of the elements you've specified. Any element that you remove with it must have an `id` attribute. So if I want to remove my `tbody`, then I must assign an `id` to my `tbody` tag or else it will give an error. It removes the element itself and all of its descendants, so if you simply want to empty that element then you'll have to re-create it afterwards (or modify the plugin to empty instead of remove). So here's my page above modified to use Toran's plugin. For the sake of simplicity I didn't apply any of the general performance advice offered by Peter. Here's the page which now no longer memory leaks: <html> <head> <title>Test Page</title> <script type="text/javascript" src="http://ajax.googleapis.com/ajax/libs/jquery/1.3/jquery.min.js"></script> </head> <body> <script type="text/javascript"> <!-- $.fn.removefromdom = function(s) { if (!this) return; var el = document.getElementById(this.attr("id")); if (!el) return; var bin = document.getElementById("IELeakGarbageBin"); //before deleting el, recursively delete all of its children. while (el.childNodes.length > 0) { if (!bin) { bin = document.createElement("DIV"); bin.id = "IELeakGarbageBin"; document.body.appendChild(bin); } bin.appendChild(el.childNodes[el.childNodes.length - 1]); bin.innerHTML = ""; } el.parentNode.removeChild(el); if (!bin) { bin = document.createElement("DIV"); bin.id = "IELeakGarbageBin"; document.body.appendChild(bin); } bin.appendChild(el); bin.innerHTML = ""; }; var resets = 0; function kickoff() { $.getJSON("unplanned.json", resetTable); } function resetTable(rows) { $("#content tbody").removefromdom(); $("#content").append('<tbody id="id_field_required"></tbody>'); for(var i=0; i<rows.length; i++) { $("#content tbody").append("<tr><td>" + rows[i].mpe_name + "</td>" + "<td>" + rows[i].bin + "</td>" + "<td>" + rows[i].request_time + "</td>" + "<td>" + rows[i].filtered_delta + "</td>" + "<td>" + rows[i].failed_delta + "</td></tr>"); } resets++; $("#message").html("Content set this many times: " + resets); setTimeout(kickoff, 2000); } $(kickoff); // --> </script> <div id="message" style="color:red"></div> <table id="content" border="1" style="width:100% ; text-align:center"> <thead><tr> <th>MPE</th> <th>Bin</th> <th>When</th> <th>Filtered</th> <th>Failed</th> </tr></thead> <tbody id="id_field_required"></tbody> </table> </body> </html> FURTHER EDIT: I'll leave my question unchanged, though it's worth noting that this memory leak has nothing to do with Ajax. In fact, the following code would memory leak just the same and be just as easily solved with Toran's removefromdom jQuery plugin: function resetTable() { $("#content tbody").empty(); for(var i=0; i<1000; i++) { $("#content tbody").append("<tr><td>" + "DBOSS-095" + "</td>" + "<td>" + 4 + "</td>" + "<td>" + "09/18/2009 11:51:06" + "</td>" + "<td>" + 1 + "</td>" + "<td>" + 1 + "</td></tr>"); } setTimeout(resetTable, 2000); } $(resetTable);

  Read the article

• Handling aces and finding a segfault in a blackjack program

  - by Bill Adams

  Here's what i have so far... I have yet to figure out how i'm going to handle the 11 / 1 situation with an ace, and when the player chooses an option for hit/stand, i get segfault. HELP!!! #include <stdio.h> #include <string.h> #include <stdlib.h> #include <time.h> #define DECKSIZE 52 #define VALUE 9 #define FACE 4 #define HANDSIZE 26 typedef struct { int value; char* suit; char* name; }Card; typedef struct { int value; char* suit; char* name; }dealerHand; typedef struct { int value; char* suit; char* name; }playerHand; Card cards[DECKSIZE]; dealerHand deal[HANDSIZE]; playerHand dealt[HANDSIZE]; char *faceName[]={"two","three", "four","five","six", "seven","eight","nine", "ten", "jack","queen", "king","ace"}; char *suitName[]={"spades","diamonds","clubs","hearts"}; void printDeck(){ int i; for(i=0;i<DECKSIZE;i++){ printf("%s of %s value = %d\n ",cards[i].name,cards[i].suit,cards[i].value); if((i+1)%13==0 && i!=0) printf("-------------------\n\n"); } } void shuffleDeck(){ srand(time(NULL)); int this; int that; Card temp; int c; for(c=0;c<10000;c++){ //c is the index for number of individual card shuffles should be set to c<10000 or more this=rand()%DECKSIZE; that=rand()%DECKSIZE; temp=cards[this]; cards[this]=cards[that]; cards[that]=temp; } } /*void hitStand(i,y){ // I dumped this because of a segfault i couldn't figure out. int k; printf(" Press 1 to HIT or press 2 to STAND:"); scanf("%d",k); if(k=1){ dealt[y].suit=cards[i].suit; dealt[y].name=cards[i].name; dealt[y].value=cards[i].value; y++; i++; } } */ int main(){ int suitCount=0; int faceCount=0; int i; int x; int y; int d; int p; int k; for(i=0;i<DECKSIZE;i++){ //this for statement builds the deck if(faceCount<9){ cards[i].value=faceCount+2; }else{ //assigns face cards as value 10 cards[i].value=10; } cards[i].suit=suitName[suitCount]; cards[i].name=faceName[faceCount++]; if(faceCount==13){ //this if loop increments suit count once cards[i].value=11; //all faces have been assigned, and also suitCount++; //assigns the ace as 11 faceCount=0; } //end building deck } /*printDeck(); //prints the deck in order shuffleDeck(); //shuffles the deck printDeck(); //prints the deck as shuffled This was used in testing, commented out to keep the deck hidden!*/ shuffleDeck(); x=0; y=0; for(i=0;i<4;i++){ //this for loop deals the first 4 cards, dealt[y].suit=cards[i].suit; //first card to player, second to dealer, dealt[y].name=cards[i].name; //as per standard dealing practice. dealt[y].value=cards[i].value; i++; y++; deal[x].suit=cards[i].suit; deal[x].name=cards[i].name; deal[x].value=cards[i].value; x++; } printf(" Dealer's hand is: %s of %s and XXXX of XXXX. (Second card is hidden!)\n",deal[0].name,deal[0].suit,deal[1].name,deal[1].suit); printf(" Player's hand is: %s of %s and %s of %s.\n",dealt[0].name,dealt[0].suit,dealt[1].name,dealt[1].suit); printf(" the current value of the index i=%d\n",i); //this line gave me the value of i for testing d=deal[0].value+deal[1].value; p=dealt[0].value+dealt[1].value; if(d==21){ printf(" The Dealer has Blackjack! House win!\n"); }else{ if(d>21){ printf(" The dealer is Bust! You win!\n"); }else{ if(d>17){ printf(" Press 1 to HIT or 2 to STAND"); scanf("%d",k); if(k==1){ dealt[y].suit=cards[i].suit; dealt[y].name=cards[i].name; dealt[y].value=cards[i].value; y++; i++; } }else{ if(d<17){ printf(" Dealer Hits!"); deal[x].suit=cards[i].suit; deal[x].name=cards[i].name; deal[x].value=cards[i].value; x++; i++; } } } } return 0; }

  Read the article

• I need some help with either my SQL or my PHP I do not know which...

  - by sico87

  Hello I am creating a CMS and some of the functionality of it that the images that are within the content are managable. I currently trying to display a table that shows the the content title and then the associated images, ideally I would like a layout similar to this, Content Title Image 1 Image 2 Image 3 Content Title 2 Image 1 Image 2 Content Title 3 Image 1 The SQL the returns the data is actually formed using Codeigniters Active Record class, function getAllContentImages() { $this->db->select('*'); $this->db->from('contentImagesTable'); $this->db->join('contentTable', 'contentTable.contentId = contentImagesTable.contentId'); $this->db->join('categoryTable', 'categoryTable.categoryId = contentTable.categoryId'); $query = $this->db->get(); return $query->result_array(); } The array that is returned is looks like this, I have cut the size down for readability. Array ( [0] => Array ( [contentImageId] => 25 [contentImageName] => green.png [contentImageType] => .png [contentImagePath] => /var/www/bangmarketing.bang/media/uploads/contentImages/2/green.png [isHeadlineImage] => 1 [contentImageDateUploaded] => 1265222654 [contentId] => 2 [dashboardUserId] => 0 [contentTitle] => sadsadsadassss [contentAbstract] => <p>Pllllleeeeeeeaaaaasssssseeeeee Work</p> [contentBody] => <p>Please work :-( please</p> [contentOnline] => 0 [contentAllowComments] => 0 [contentDateCreated] => 1265124038 [categoryId] => 1 [categoryTitle] => blogsss [categoryAbstract] => <p>asdsdsadasdsadfdsgdgdsgdsgssssssssssss</p> [categorySlug] => blog [categoryIsSpecial] => 0 [categoryOnline] => 1 [categoryDateCreated] => 1266588327 ) [1] => Array ( [contentImageId] => 28 [contentImageName] => yellow.png [contentImageType] => .png [contentImagePath] => /var/www/bangmarketing.bang/media/uploads/contentImages/7/yellow.png [isHeadlineImage] => 1 [contentImageDateUploaded] => 1265388055 [contentId] => 7 [dashboardUserId] => 0 [contentTitle] => Another Blog [contentAbstract] => <p>This is another blog and it is shit becuase this does not work</p> [contentBody] => <p>ioasfihfududfhdufhuishdfiudshfiudhsfiuhdsiufhusdhfuids</p> [contentOnline] => 1 [contentAllowComments] => 0 [contentDateCreated] => 1265388034 [categoryId] => 1 [categoryTitle] => blogsss [categoryAbstract] => <p>asdsdsadasdsadfdsgdgdsgdsgssssssssssss</p> [categorySlug] => blog [categoryIsSpecial] => 0 [categoryOnline] => 1 [categoryDateCreated] => 1266588327 ) [2] => Array ( [contentImageId] => 33 [contentImageName] => portaski.jpg [contentImageType] => .jpg [contentImagePath] => /var/www/bangmarketing.bang/media/uploads/contentImages/11/portaski.jpg [isHeadlineImage] => 1 [contentImageDateUploaded] => 1265714175 [contentId] => 11 [dashboardUserId] => 0 [contentTitle] => Portaski - new product and brand launch by Bang [contentAbstract] => <p>Bang's experience in new product development has helped launch PortaSki &ndash; the pocket-sized device which is set to revolutionise skiing.</p> [contentBody] => <p>After developing Portaski's brand identity and positioning, Bang re-designed the product and its packaging ahead of launch in late 2008.</p> <p>A media and PR strategy was devised and implemented using Bang's close relationship with two of the UK's most influential organisations in the Advertising and Media Buying industries. On-line advertising was supported with editorial reviews in the UK's leading broadsheets and tabloids, which combined with pin-point HTML direct mail to drive consumers to the new e-commerce site.</p> <p>Impressive month-on-month growth has been achieved since launch, and the direct marketing activity resulted in an unprecedented 2.71% of targets going on-line to purchase a PortaSki.</p> <p>For further information visit <a href="http://www.portaski.com" target="_blank">www.portaski.com</a></p> [contentOnline] => 1 [contentAllowComments] => 0 [contentDateCreated] => 1265718184 [categoryId] => 1 [categoryTitle] => blogsss [categoryAbstract] => <p>asdsdsadasdsadfdsgdgdsgdsgssssssssssss</p> [categorySlug] => blog [categoryIsSpecial] => 0 [categoryOnline] => 1 [categoryDateCreated] => 1266588327 ) [3] => Array ( [contentImageId] => 26 [contentImageName] => housingplus.jpg [contentImageType] => .jpg [contentImagePath] => /var/www/bangmarketing.bang/media/uploads/contentImages/5/housingplus.jpg [isHeadlineImage] => 1 [contentImageDateUploaded] => 1265284989 [contentId] => 5 [dashboardUserId] => 0 [contentTitle] => Bang launches Housing Plus [contentAbstract] => <p>Bang has launched Housing Plus, the new brand for the Central Borders Housing Group, along with new sub-brands Property Care and SSHA.</p> [contentBody] => <p>The Midlands based Group, with turnover in excess of &pound;21M, appointed Bang in 2008 following an open pitch of over 40 agencies. Bang's work began with an extensive marketing research strategy that challenged the Group's former positioning and brand structure.</p> <p>The research unveiled that the housing sector demanded a values-led Group. This led Bang to develop the brave &lsquo;Together for the Right Reasons' positioning for Housing Plus.</p> <p>Chris Garratt, Marketing Director at Bang explained "The housing sector has witnessed wholesale change in recent years. Much to tenant's dismay, many associations and Groups appear to be losing touch with their roots, we wanted to develop a Group for associations who place principles at the heart of their corporate strategy".</p> <p>The repositioned sub-brands also play an important role in the Group's revised brand by highlighting Housing Plus' willingness to embrace and nurture individual identities. Chris Garratt continued "By adopting a &lsquo;house of brands' hierarchy from the outset, Housing Plus has sent out a strong message to prospective strategic partners".</p> <p>Bang handled all aspects of work for the redevelopment of the three brands, including research, brand creation, naming, positioning, internal branding and communications, advertising, the brand launches, building the brands' on-line presence and the creation of a powerful brand film &ndash; which is already attracting significant interest from across the sector.</p> [contentOnline] => 1 [contentAllowComments] => 0 [contentDateCreated] => 1265285940 [categoryId] => 8 [categoryTitle] => News [categoryAbstract] => <p>The world at Bang Marketing moves fast, keep up to date w [categorySlug] => news [categoryIsSpecial] => 0 [categoryOnline] => 1 [categoryDateCreated] => 1265283717 ) I need a way that I can get all the content images associated with the same content title in one group and then display under the content title. Can anyone help?

  Read the article

• ANSI C blackjack assignment, linux GCC compiler, i'm stuck...

  - by Bill Adams

  Here's what i have so far... I have yet to figure out how i'm going to handle the 11 / 1 situation with an ace, and when the player chooses an option for hit/stand, i get segfault. HELP!!! #include <stdio.h> #include <string.h> #include <stdlib.h> #include <time.h> #define DECKSIZE 52 #define VALUE 9 #define FACE 4 #define HANDSIZE 26 typedef struct { int value; char* suit; char* name; }Card; typedef struct { int value; char* suit; char* name; }dealerHand; typedef struct { int value; char* suit; char* name; }playerHand; Card cards[DECKSIZE]; dealerHand deal[HANDSIZE]; playerHand dealt[HANDSIZE]; char *faceName[]={"two","three", "four","five","six", "seven","eight","nine", "ten", "jack","queen", "king","ace"}; char *suitName[]={"spades","diamonds","clubs","hearts"}; void printDeck(){ int i; for(i=0;i<DECKSIZE;i++){ printf("%s of %s value = %d\n ",cards[i].name,cards[i].suit,cards[i].value); if((i+1)%13==0 && i!=0) printf("-------------------\n\n"); } } void shuffleDeck(){ srand(time(NULL)); int this; int that; Card temp; int c; for(c=0;c<10000;c++){ //c is the index for number of individual card shuffles should be set to c<10000 or more this=rand()%DECKSIZE; that=rand()%DECKSIZE; temp=cards[this]; cards[this]=cards[that]; cards[that]=temp; } } /*void hitStand(i,y){ // I dumped this because of a segfault i couldn't figure out. int k; printf(" Press 1 to HIT or press 2 to STAND:"); scanf("%d",k); if(k=1){ dealt[y].suit=cards[i].suit; dealt[y].name=cards[i].name; dealt[y].value=cards[i].value; y++; i++; } } */ int main(){ int suitCount=0; int faceCount=0; int i; int x; int y; int d; int p; int k; for(i=0;i<DECKSIZE;i++){ //this for statement builds the deck if(faceCount<9){ cards[i].value=faceCount+2; }else{ //assigns face cards as value 10 cards[i].value=10; } cards[i].suit=suitName[suitCount]; cards[i].name=faceName[faceCount++]; if(faceCount==13){ //this if loop increments suit count once cards[i].value=11; //all faces have been assigned, and also suitCount++; //assigns the ace as 11 faceCount=0; } //end building deck } /*printDeck(); //prints the deck in order shuffleDeck(); //shuffles the deck printDeck(); //prints the deck as shuffled This was used in testing, commented out to keep the deck hidden!*/ shuffleDeck(); x=0; y=0; for(i=0;i<4;i++){ //this for loop deals the first 4 cards, dealt[y].suit=cards[i].suit; //first card to player, second to dealer, dealt[y].name=cards[i].name; //as per standard dealing practice. dealt[y].value=cards[i].value; i++; y++; deal[x].suit=cards[i].suit; deal[x].name=cards[i].name; deal[x].value=cards[i].value; x++; } printf(" Dealer's hand is: %s of %s and XXXX of XXXX. (Second card is hidden!)\n",deal[0].name,deal[0].suit,deal[1].name,deal[1].suit); printf(" Player's hand is: %s of %s and %s of %s.\n",dealt[0].name,dealt[0].suit,dealt[1].name,dealt[1].suit); printf(" the current value of the index i=%d\n",i); //this line gave me the value of i for testing d=deal[0].value+deal[1].value; p=dealt[0].value+dealt[1].value; if(d==21){ printf(" The Dealer has Blackjack! House win!\n"); }else{ if(d>21){ printf(" The dealer is Bust! You win!\n"); }else{ if(d>17){ printf(" Press 1 to HIT or 2 to STAND"); scanf("%d",k); if(k==1){ dealt[y].suit=cards[i].suit; dealt[y].name=cards[i].name; dealt[y].value=cards[i].value; y++; i++; } }else{ if(d<17){ printf(" Dealer Hits!"); deal[x].suit=cards[i].suit; deal[x].name=cards[i].name; deal[x].value=cards[i].value; x++; i++; } } } } return 0; }

  Read the article

< Previous Page | 126 127 128 129 130 131 132  | Next Page >