Search Results

Search found 12214 results on 489 pages for 'video conversion'.

Page 133/489 | < Previous Page | 129 130 131 132 133 134 135 136 137 138 139 140  | Next Page >

• Batch convert of Word docs with images to HTML

  - by dylpickle

  OK, here is my situation: I made a knowledge base for a company, they have about 500 word documents with screenshots in them explaining procedures and such. I can easily paste the text into the cms wysiwyg editor on the knowledge base but the images need to be uploaded one at a time, then sized and placed in the article. Question: Is there any suggestions for an automatic method to to convert the documents to html with the appropriate image tags and links to the images in them, and export/package the images for ftp upload? I can already convert them to HTML automatically using a batch file and a program, but converting the images to the correct tags with href link, then exporting them for ftp is where i need some help. Might not even be possible, but if anyone has tried to do something like this I would like to here how you approached this.

  Read the article

• how to record videos from my laptop webcam?

  - by Nick

  I am not sure but I can't seem to turn on my webcam to record videos which I would broad cast somewhere later on. I have a HP G62 Laptop, and the cam turns on when I use programs like Skype and other Video Calling clients, other wise I can't turn it own, as I don't seem to know how. Laptop: HP G62 Notebook PC, AMD Atholon II P230 Dual-Core, Windows 7: Home Premium Can some one tell me how do I turn on my webcam and record videos? Or is there some sort of a software? I tend to read stuff I wrote in Word, so if there is a program I need it to be in the tray dock and not to bug me, while I am moving between different documents/web pages.

  Read the article

• Convert text to table

  - by Quattro

  I would like convert text into a table. Here is a link to the text http://www.tcdb.org/public/tcdb Short example: >gnl|TC-DB|A0CIB0|1.A.17.3.1 Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1 MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI >gnl|TC-DB|A0CS82|9.B.82.1.5 Chromosome undetermined scaffold_26, whole genome shotgun sequence - Paramecium tetraurelia. MIIEEQIEEKMIYKAIHRVKVNYQKKIDRYILYKKSRWFFNLLLMLLYAYRIQNIGGFYI VTYIYCVYQLQLLIDYFTPLGLPPVNLEDEEEDDDQFQNDFSELPTTLSNKNELNDKEFR PLLRTTSEFKVWQKSVFSVIFAYFCTYIPIWDIPVYWPFLFCYFFVIVGMSIRKYIKHMK KYGYTILDFTKKK I wanted to have columns for example delimited with pipe | or ; |>gnl|TC-DB|A0CIB0|1.A.17.3.1| Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1| MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI I am working with Windows and I don't know how to do it I just know every row starts with > I want to substitute the first whitespace in a row with a delimiter like | or ; after the first regular expression new line in a row, I want also a delimiter everything between the regular expression first new line and > should go into a new column (it's a sequence of a protein)

  Read the article

• second monitor wont display [closed]

  - by Ryan

  hi all my problem is this: i have one video card (radeon hd 4350) and 2 monitors (dell). the first monitor works using dvi-to-dvi. the second does not, using hdmi-to-dvi. the monitor does not register any input. however when i use vga-to-vga, the second monitor does work, with a typically low vga resolution. we have tested the hdmi-to-dvi cable, so why does the monitor not register any input? using windows vista. i have installed all the lastest drivers, done all the basic stuff etc. any help at all would be appreciated. thanks

  Read the article

• PowerISO for Mac can't convert .img

  - by None

  I have a bootable .img file that I want to convert to a bootable .iso file. I downloaded poweriso for Mac and used this command: poweriso convert MyOS.img -o MyOS.iso -ot iso which returned this output: PowerISO Copyright(C) 2004-2008 PowerISO Computing, Inc Type poweriso -? for help MyOS.img: The file format is invalid or unsupported. I thought PowerISO could convert .img to .iso. Was I incorrect, or did I use the wrong commands or something like that?

  Read the article

• Convert file from VOC to MP3

  - by Thomas

  I would like to convert a sound file (from a digital voice recorder) with the extension .voc to an .mp3 file or some other common sound files. I am on Windows 7 64 bit. I have tried the program voc2wav but it gives me an error message saying that the program isn't 64 bit. The program has to be free and able to run without installing. (The voice recorder did come with a program that I could install, but I would like to avoid that).

  Read the article

• 1080p HD TV + what is minimum spec pc required to stream HD movie files to it?

  - by rutherford

  I want to stream hi-def (non flash-based) movies from my future minimum spec pc to my network-ready HDTV. What I want to know is a) when streaming from a computer (local wifi network), is the computer's cpu/video/ram resources used to the same extent as it would be if playing back on the computers local screen? If not what are the differences? b) So with streaming hd content what is the minimum spec processor I should go for, if i) only one TV is acting as client ii) two TVs are simultaneous clients.

  Read the article

• Importer or converter for ClarisWorks cwk format?

  - by Justin Dearing

  I have several ClarisWorks documents (*.CWK) that I'd like to import into a more modern format like Microsoft Word or Open Office. It seems Star Office can apparently open cwk files, but the product is discontinued and cannot be downloaded any more. There has been a feature request to add a cwk importer to OpenOffice since 2002, so I doubt that OpenOffice will support cwk files any time soon. Are there any utilities that can open a cwk file besides ClarisWorks itself?

  Read the article

• How to run a command from anywhere in Mac OS X

  - by pabloruiz55

  I need to use a command for converting my images to pvrtc. It is located in /Developer/Platforms/iPhoneOS.platform/Developer/usr/bin/texturetool. Right now I have to be inside that folder to be able to use the command. How can I set it up so I can run this command from anywhere? Thanks

  Read the article

• Flatten Word document

  - by user126389

  I have a document with some precise formatting, created in Word. This doc was converted to PDF for distribution. Now the original is lost, and reconverting to Word using a PDF to word add-on from Microsoft results in many text boxes in the new DOC file. How can I 'flatten' this to remove the text boxes and retain most of the formatting in order to update the contents? Recreating the original formatting would take a long time.

  Read the article

• Does the size of the monitor Matter?

  - by Arsheep

  I have a old computer, and I want to buy a big LCD. The best I've found so far is Viewsonic's 24" LCD TFT monitor. So will it run without any problems, or do I need to upgrade the video cards or something as well? The computer is not too old: it has P4 board and celeron processor, with 128 graphics memory. And in display properties, it says that the maxium that I can use is 1280 x 1024 resolution. I am noob hardware-wise, so need help on this stuff. Thanks

  Read the article

• Does the size of the monitor Matter?

  - by Arsheep

  I have a old computer, and I want to buy a big LCD. The best I've found so far is Viewsonic's 24" LCD TFT monitor. So will it run without any problems, or do I need to upgrade the video cards or something as well? The computer is not too old: it has P4 board and celeron processor, with 128 graphics memory. And in display properties, it says that the maxium that I can use is 1280 x 1024 resolution. I am noob hardware-wise, so need help on this stuff. Thanks

  Read the article

• Does the size of the monitor Matter?

  - by Arsheep

  I have a old computer, and I want to buy a big LCD. The best I've found so far is Viewsonic's 24" LCD TFT monitor. So will it run without any problems, or do I need to upgrade the video cards or something as well? The computer is not too old: it has P4 board and celeron processor, with 128 graphics memory. And in display properties, it says that the maxium that I can use is 1280 x 1024 resolution. I am noob hardware-wise, so need help on this stuff. Thanks

  Read the article

• PDF - re/generate image using stream content

  - by tom_tap

  I have pdf file with 8 content streams (bytes) which behave like image layers (but they are not layers that I can turn off/on in Adobe Reader). I would like to extract these images separately, because they overlap each other (thus I am not able to "Take a Snapshot" or "Copy File to Clipboard"). So now I have these streams in below format: <Start Stream> q 599.7601 0 0 71.99921 5951.03423 4282.48177 cm /Im0 Do Q q 599.7601 0 0 71.99921 5951.03432 4210.48177 cm /Im1 Do Q q 599.7601 0 0 71.99921 5951.03441 4138.48177 cm /Im2 Do [...] My question is: how to use these data to generate or regenerate these images to be able to save it as raster or vector file? I have already tried pstoedit, but it doesn't work properly beacuse of these multi streams. Same with PDFedit.

  Read the article

• How to convert media using VLC?

  - by Lawand

  How can I use VLC to convert media? for instance WAV to MP3. I searched the internet and all the tutorials I found describe the process on older VLC versions (my version is 1.0.0)

  Read the article

• How to convert a power point pdf to a pdf that is easy to read on kindle?

  - by SpaceTrucker

  I have several power point presentations as pdfs. I would like to read them on the original kindle in landscape format. When I read the original on the kindle then a single slide won't fit on the kindles display. I thought the easiest way to convert the pdf was to repring it with a pdf printer. However I don't know the paper size to use. I already tried using Calibre as suggested by this question. However the output is not usable because of formatting issues. So what paper size should I use for the pdf printer to reprint them in landscape format or are there any other tools I could use for that task?

  Read the article

• How to convert a 1 page PDF to a 2 page per sheet PDF?

  - by mokasin

  I would like to print a PDF so that on the front of the first page are the first two pages, on the back the 3rd and 4th and so on. ----------------- ----------------- | | | | | | | | | | | | | 1 | 2 | | 3 | 4 | . . . | | | | | | |_______|_______| |_______|_______| page 1 - front page 1 - front Because my printer using Linux fails to support manual duplex printing I'd thought, maybe I could edit the pdf in a according way. But how?

  Read the article

• FFMPEG Splitting MP4 with Same Quality

  - by Pragmatic

  I have one large MP4 file. I am attempting to split it into smaller files. ffmpeg -i largefile.mp4 -sameq -ss 00:00:00 -t 00:50:00 smallfile.mp4 I thought using -sameq would keep the same quality settings. However, I must not understand what that does. I'm looking to keep the same quality (audio/video) and compression with the split files. However, this setting makes the split files much larger. What flag(s) do I need to set to keep the same quality and attributes in the split files while maintaining the same quality to size ratio? For instance if my original file is about 12 GB and is 1920x1080 with a bitrate of 10617kbps and a framerate of 23 frames/sec and 6 channel audio with 317kbps, I would like the split files to be the same only a third of this size (if i split it into three pieces).

  Read the article

• Nvidia driver on Windows 7 causing black screen

  - by inKit

  I have just installed Windows 7 on a desktop machine and for the first time ever have had a really tough time doing so, its normally a nice smooth install. This time I found that the monitor would simply go black after completing the installation. I tried reinstalling about 3 times and this did not help. After much searching I discovered that it was the nvidia drivers that were playing up with win 7, so i booted into safe mode, disabled the device, then rebooted to complete the installation. Windows 7 now works fine as long as the nvidia 9600 gt video card is disabled. The moment I enable it, the system requires a reboot and the screen will go black before even getting to the log in screen. I have tried downloading the latest driver and installing it manually, I have also tried uninstalling the device and allowing windows 7 to install it itself. Nothing seems to work. any clues?

  Read the article

• How to add watermarks/logos on videos with mencoder?

  - by Emenims

  How to add watermarks/logos on videos with mencoder?

  Read the article

• How to train users converting from PC to Mac/Apple at a small non profit?

  - by Everette Mills

  Background: I am part of a team that provides volunteer tech support to a local non profit. We are in the position to obtain a grant to update almost all of our computers (many of them 5 to 7 year old machines running XP), provide laptops for users that need them, etc. We are considering switching our users from PC (WinXP) to Macs. The technical aspects of switching will not be an issue for the team. We are in the process of planning data conversions, machine setup, server changes, etc regardless of whether we switch to Macs or much newer PCs. About 1/4 of the staff uses or has access to a Mac at home, these users already understand the basics of using the equipment. We have another set of (generally younger) users that are technically savvy and while slightly inconvenienced and slowed for a few days should be able to switch over quickly. Finally, several members of the staff are older and have many issues using there computers today. We think in the long run switching to Macs may provide a better user experience, fewer IT headaches, and more effective use of computers. The questions we have is what resources and training (webpages, Books, online training materials or online courses) do you recommend that we provide to users to enable the switchover to happen smoothly. Especially, with a focus on providing different levels of training and support to users with different skill levels. If you have done this in your own organization, what steps were successful, what areas were less successful?

  Read the article

• Why are my favorite websites becoming slower, over months?

  - by Wolfpack'08

  I spend a lot of my time at sites for watching online videos: youtube, gorillavid, thedailyshow.com etc. I used to watch the videos in full screen mode, and then that became very laggy. So, I started watching them with full-browser zooming. Then that became laggy. Recently, I've had to actually zoom out; otherwise, the video will lag so much that my PC locks. Could this be a symptom of my processor, RAM, or motherboard going bad? Has it, perhaps, anything to do with softwares like Chrome or the playeres the sites are using being updated?

  Read the article

• Nvidia driver on Windows 7 causing black screen

  - by inKit

  I have just installed Windows 7 on a desktop machine and for the first time ever have had a really tough time doing so, its normally a nice smooth install. This time I found that the monitor would simply go black after completing the installation. I tried reinstalling about 3 times and this did not help. After much searching I discovered that it was the nvidia drivers that were playing up with win 7, so i booted into safe mode, disabled the device, then rebooted to complete the installation. Windows 7 now works fine as long as the nvidia 9600 gt video card is disabled. The moment I enable it, the system requires a reboot and the screen will go black before even getting to the log in screen. I have tried downloading the latest driver and installing it manually, I have also tried uninstalling the device and allowing windows 7 to install it itself. Nothing seems to work. any clues?

  Read the article

• how can i edit my admission form which i filled wrong . their is no other form is avilable now ...what i do ??? [closed]

  - by user60065

  Hi, I am a 2nd year student in graduation. Recently I filled an admission form for final year admission but it came back to me after 2 days because I had entered wrong information. I want to edit the wrong information and I have scanned the form. I am looking for a good online site where I can upload the scanned document and convert same into an editable format. I don’t mind paying. If any can point to a good site will be great & thanks in advance

  Read the article

• FMS NetConnection.Connect.Close happening when starts and even in the middle of video in Flash with

  - by Sunil Kumar

  Hi I have developed a Flash Video player in Flash CS3 with Action Script 2.0 to play video from Adobe Flash Media Server 3.5. To play video from FMS 3.5, first I have to verify my swf file on FMS 3.5 server console so that it can be ensure that RTMP video URL only be play in verified SWF file. Right now I am facing problem of "NetConnection.Connect.Close" when I try to connect my NetConnection Object to FMS 3.5 to stream video from that server. So now I am getting this message "NetConnection.Connect.Close" from FMS 3.5. When this is happening in my office area at the same time when I am checking the the same video url from out side the office (With help of my friends who is in another office) area it is working fine. My friends naver faced even a single issue with NetConnection.Connect.Close. But in my office when I got message NetConnection.Connect.Close, I can play another streaming video very well like mtv.com jaman.com rajshri.com etc. Some time FMS works fine and video starts playing but in the middle of the video same thing happen "NetConnection.Connect.Close" There is no issue of Bandwidth in my office. I do't know why this is happening. Please see the message when I am getting "NetConnection.Connect.Close" message. NetConn == data: NetConn == objectEncoding: 0 NetConn == description: Connection succeeded. NetConn == code: NetConnection.Connect.Success NetConn == level: status NetConn == level: status NetConn == code: NetConnection.Connect.Closed Please help Thanks & regards Sunil Kumar

  Read the article

< Previous Page | 129 130 131 132 133 134 135 136 137 138 139 140  | Next Page >