Search Results

Search found 12765 results on 511 pages for 'format()'.

Page 140/511 | < Previous Page | 136 137 138 139 140 141 142 143 144 145 146 147  | Next Page >

  • How to convert raw_input() into a directory?

    - by Azeworai
    Hi everyone, I just picked up IronPython and I've been trying to get this IronPython script going but I'm stuck at trying to get a Path input from raw_input to be a directory path. The first block of code is the broken one that I'm working on. import System from System import * from System.IO import * from System.Diagnostics import * inputDirectory = raw_input("Enter Input Directory's full path [eg. c:\\vid\\]: ") print ("In: "+inputDirectory) outputDirectory = inputDirectory +"ipod\\" print ("Out: "+outputDirectory) #create the default output directory for s in DirectoryInfo(inputDirectory).GetFiles("*.avi"): print s.FullName arg = String.Format('-i "{0}" -t 1 -c 1 -o "{1}" --preset="iPod"' , s.FullName, outputDirectory + s.Name.Replace(".avi", ".mp4")) print arg proc = Process.Start("C:\\Program Files\\Handbrake\\HandBrakeCLI.exe", arg) #path to handbrake goes here proc.WaitForExit() The following code block is what I have working at the moment. import System from System import * from System.IO import * from System.Diagnostics import * for s in DirectoryInfo("F:\\Tomorrow\\").GetFiles("*.avi"): arg = String.Format('-i "{0}" -t 1 -c 1 -o "{1}" --preset="iPod"' , s.FullName, "F:\\Tomorrow\\ipod\\" + s.Name.Replace(".avi", ".mp4")) print arg proc = Process.Start("C:\\Program Files\\Handbrake\\HandBrakeCLI.exe", arg) #path to handbrake goes here proc.WaitForExit() PS: Credit for the above working code goes to Joseph at jcooney.net

    Read the article

  • Convert any currency string to double

    - by James
    I need to store multiple currencies in SQL server. I understand that SQL won't support all different types of currencies (unless I store it as a string, but I don't want to do that). My idea was to convert all the values from their currency format to a standard double and store that instead. Then just re-format based on the culture info when displaying. However, I have tried doing something like e.g. var cultureInfo = new System.Globalization.CultureInfo("en-US"); double plain = return Double.Parse("$20,000.00", cultureInfo); This doesn't ever seem to work it always throws a FormatException. Even removing the currency symbol and just trying to do this based on the number alone does the same thing. This is just an example I want to support pretty much any type of currency. Is there a standard way of stripping out currency and getting the value as a double?

    Read the article

  • mmap() for large file I/O?

    - by Boatzart
    I'm creating a utility in C++ to be run on Linux which can convert videos to a proprietary format. The video frames are very large (up to 16 megapixels), and we need to be able to seek directly to exact frame numbers, so our file format uses libz to compress each frame individually, and append the compressed data onto a file. Once all frames are finished being written, a journal which includes meta data for each frame (including their file offsets and sizes) is written to the end of the file. I'm currently using ifstream and ofstream to do the file i/o, but I am looking to optimize as much as possible. I've heard that mmap() can increase performance in a lot of cases, and I'm wondering if mine is one of them. Our files will be in the tens to hundreds of gigabytes, and although writing will always be done sequentially, random access reads should be done in constant time. Any thoughts as to whether I should investigate this further, and if so does anyone have any tips for things to look out for? Thanks!

    Read the article

  • The dictionary need to add every word in SpellingMistakes and the line number but it only adds the l

    - by Will Boomsight
    modules import sys import string Importing and reading the files form the Command Prompt Document = open(sys.argv[1],"r") Document = open('Wc.txt', 'r') Document = Document.read().lower() Dictionary = open(sys.argv[2],"r") Dictionary = open('Dict.txt', 'r') Dictionary = Dictionary.read() def Format(Infile): for ch in string.punctuation: Infile = Infile.replace(ch, "") for no in string.digits: Infile = Infile.replace(no, " ") Infile = Infile.lower() return(Infile) def Corrections(Infile, DictWords): Misspelled = set([]) Infile = Infile.split() DictWords = DictWords.splitlines() for word in Infile: if word not in DictWords: Misspelled.add(word) Misspelled = sorted(Misspelled) return (Misspelled) def Linecheck(Infile,ErrorWords): Infile = Infile.split() lineno = 0 Noset = list() for line in Infile: lineno += 1 line = line.split() for word in line: if word == ErrorWords: Noset.append(lineno) sorted(Noset) return(Noset) def addkey(error,linenum): Nodict = {} for line in linenum: Nodict.setdefault(error,[]).append(linenum) return Nodict FormatDoc = Format(Document) SpellingMistakes = Corrections(FormatDoc,Dictionary) alp = str(SpellingMistakes) for word in SpellingMistakes: nSet = str(Linecheck(FormatDoc,word)) nSet = nSet.split() linelist = addkey(word, nSet) print(linelist) # # for word in Nodict.keys(): # Nodict[word].append(line) Prints each incorrect word on a new line

    Read the article

  • iPhone OpenGLES textures - colour banding

    - by chicknstu
    I've got a problem with openGL on iPhone which I'm sure must have a simple solution! When I load a texture and display it, I get a lot of what I believe is called 'Colour Banding', whereby the colours, particularly on gradients, seem to get automatically 'optimized'. Just to demonstrate that this wasn't anything wrong with my own code, I downloaded the iPhone 'Crashlanding' app and replaced the background image, and as you can see in the image below (Taken from the simulator), the exact same thing happens. The image on the left is the original PNG, and on the right is it in the game. It's almost as if it's palette is being downsized to a 256 colour one. Screenshot I'm sure this is related to the format I'm saving the image as, although it doesn't just happen with PNG's, it seems to happen no matter what image format I chose. Doing my head in! If you want to recreate this, simply download the crash landing app, and replace the background. Thanks so much in advance for any help.

    Read the article

  • Convert Date to Datetime field.

    - by infant programmer
    The argument my C# function is getting is a string which is merely a Date or a DateTime. I am suppose to convert this String to DateTime, to carry on furthure calculation. Now I need to test whether the incoming data is a Date, if it is date(examle:"12/31/2009"), then I need to add "00:00:00" (24 hours format) to it, so that it will become "12/31/2009 00:00:00". If string manipulation is one possible way, I want to confirm whether there is some other way where we can automate the testing and conversion within DateTime.TryParseExact() method. This is my sample C# code : (which is now only able to convert string of format "MM/dd/yyyy HH:mm:ss" to DateTime.) private static string[] formats = new string[] { "MM/dd/yyyy HH:mm:ss" }; public string date_conv(string date_str) { DateTime date_value; DateTime.TryParseExact(date_str, formats, new global::System.Globalization.CultureInfo("en-US"), global::System.Globalization.DateTimeStyles.None, out date_value); /*Some useful instruction to use date_value*/ return(date_value.ToString("MM/dd/yyyy HH:mm:ss")); }

    Read the article

  • How to get JSON back from HTTP POST Request (to another domain)

    - by roman m
    I'm trying to use the API on a website, here's the part of the manual: Authenticated Sessions (taken from here) To create an authenticated session, you need to request an authToken from the '/auth' API resource. URL: http://stage.amee.com/auth (this is not my domain) Method: POST Request format: application/x-www-form-urlencoded Response format: application/xml, application/json Response code: 200 OK Response body: Details of the authenticated user, including API version. Extra data: "authToken" cookie and header, containing the authentication token that should be used for subsequent calls. Parameters: username / password Example Request POST /auth HTTP/1.1 Accept: application/xml Content-Type: application/x-www-form-urlencoded username=my_username&password=my_password Response HTTP/1.1 200 OK Set-Cookie: authToken=1KVARbypAjxLGViZ0Cg+UskZEHmqVkhx/Pm...; authToken: 1KVARbypAjxLGViZ0Cg+UskZEHmqVkhx/PmEvzkPGp...== Content-Type: application/xml; charset=UTF-8 QUESTION: How do I get that to work? I tried jQuery, but it seems to have problem with XSS. Actual code snippet would be greatly appreciated. p.s. All I was looking for was WebClient class in C#

    Read the article

  • Loop over a file and write the next line if a condition is met

    - by 111078384259264152964
    Having a hard time fixing this or finding any good hints about it. I'm trying to loop over one file, modify each line slightly, and then loop over a different file. If the line in the second file starts with the line from the first then the following line in the second file should be written to a third file. !/usr/bin/env python with open('ids.txt', 'rU') as f: with open('seqres.txt', 'rU') as g: for id in f: id=id.lower()[0:4]+'_'+id[4] with open(id + '.fasta', 'w') as h: for line in g: if line.startswith(''+ id): h.write(g.next()) All the correct files appear, but they are empty. Yes, I am sure the if has true cases. :-) "seqres.txt" has lines with an ID number in a certain format, each followed by a line with data. The "ids.txt" has lines with the ID numbers of interest in a different format. I want each line of data with an interesting ID number in its own file. Thanks a million to anyone with a little advice!

    Read the article

  • Refreshing a binding that uses a value converter

    - by Hadi Eskandari
    I have a WPF UI that is bound to an object. I'm using a ValueConverter to convert a property to a specific image by a business rule: public class ProposalStateImageConverter : IValueConverter { public object Convert(object value, Type targetType, object parameter, CultureInfo culture) { var proposal = value as Proposal; var basePath = "pack://application:,,,/ePub.Content;component/Images/General/Flag_{0}.png"; string imagePath; if(proposal.Invoice != null) { imagePath = string.Format(basePath, "Good"); } else { imagePath = string.Format(basePath, "Warning"); } var uri = new Uri(imagePath); var src = uri.GetImageSource(); //Extention method return src; } } It is working fine, but later, when the object's state changes, I want to refresh the image and make the value converter reevaluate. How is this possible?

    Read the article

  • PHP Fomatting Regex - BBCode

    - by Wayne
    To be honest, I suck at regex so much, I would use RegexBuddy, but I'm working on my Mac and sometimes it doesn't help much (for me). Well, for what I need to do is a function in php function replaceTags($n) { $n = str_replace("[[", "<b>", $n); $n = str_replace("]]", "</b>", $n); } Although this is a bad example in case someone didn't close the tag by using ]] or [[, anyway, could you help with regex of: [[ ]] = Bold format ** ** = Italic format (( )) = h2 heading Those are all I need, thanks :) P.S - Is there any software like RegexBuddy available for Mac (Snow Leopard)?

    Read the article

  • current_date casting

    - by Armen Mkrtchyan
    Hi. string selectSql = "update " + table + " set state_" + mode + "_id=1 WHERE stoping_" + mode + " < current_date;"; when i call current_date, it return yyyy-MM-dd format, but i want to return dd.MM.yyyy format, how can i do that. please help. my program works fine when i am trying string selectSql = "update " + table + " set state_" + mode + "_id=1 WHERE stoping_" + mode + " < '16.04.2010';";

    Read the article

  • Python Imaging: YCbCr problems

    - by daver
    Hi, I'm doing some image processing in Python using PIL, I need to extract the luminance layer from a series of images, and do some processing on that using numpy, then put the edited luminance layer back into the image and save it. The problem is, I can't seem to get any meaningful representation of my Image in a YCbCr format, or at least I don't understand what PIL is giving me in YCbCr. PIL documentation claims YCbCr format gives three channels, but when I grab the data out of the image using np.asarray, I get 4 channels. Ok, so I figure one must be alpha. Here is some code I'm using to test this process: import Image as im import numpy as np pengIm = im.open("Data\\Test\\Penguins.bmp") yIm = pengIm.convert("YCbCr") testIm = np.asarray(yIm) grey = testIm[:,:,0] grey = grey.astype('uint8') greyIm = im.fromarray(grey, "L") greyIm.save("Data\\Test\\grey.bmp") I'm expecting a greyscale version of my image, but what I get is this jumbled up mess: http://i.imgur.com/zlhIh.png Can anybody explain to me where I'm going wrong? The same code in matlab works exactly as I expect.

    Read the article

  • java version of python-dateutil

    - by elhefe
    Python has a very handy package that can parse nearly any unambiguous date and provides helpful error messages on a parse failure, python-dateutil. Comparison to the SimpleDateFormat class is not favorable - AFAICT SimpleDateFormat can only handle one exact date format and the error messages have no granularity. I've looked through the Joda API but it appears Joda is the same way - only one explicit format can be parsed at a time. Is there any package or library that reproduces the python-dateutil behavior? Or am I missing something WRT Joda/SimpleDateFormat?

    Read the article

  • Why must "stride" in the System.Drawing.Bitmap constructor be a multiple of 4?

    - by Gorchestopher H
    I am writing an application that requires me to take a proprietary bitmap format (an MVTec Halcon HImage) and convert it into a System.Drawing.Bitmap in C#. The only proprietary functions given to me to help me do this involve me writing to file, except for the use of a "get pointer" function. This function is great, it gives me a pointer to the pixel data, the width, the height, and the type of the image. My issue is that when I create my System.Drawing.Bitmap using the constructor: new System.Drawing.Bitmap(width, height, stride, format, scan) I need to specify a "stride" that is a multiple of 4. This may be a problem as I am unsure what size bitmap my function will be hit with. Supposing I end up with a bitmap that is 111x111 pixels, I have no way to run this function other than adding a bogus column to my image or subtracting 3 columns. Is there a way I can sneak around this limitation?

    Read the article

  • API for accessing PHP documentation?

    - by Chad Johnson
    I'm done some Googling, and I've found nothing. I'm scoping out writing a plugin for an editor I use, and I am wondering whether there is a way I can access the PHP documentation via an API? For instance, I'd like to get raw access to the information (besides the comments) located here: http://php.net/file_exists. php.net seemingly uses MediaWiki which provides an API. The tutorial provides the example URL, http://en.wikipedia.org/w/api.php?action=login&format=xml. This does not work for php.net, however (http://php.net/w/api.php?action=login&format=xml). I'm just looking for a little information on how to interface with the PHP documentation.

    Read the article

  • How to send a Timestamp field to Oracle stored proc. from Java despite the DB config?

    - by Alfabravo
    I'm making a request from a java webapp to an Oracle' stored procedure which happens to have a Timestamp IN parameter. In the testing environment, it works sending: SimpleDateFormat dateFormat = new SimpleDateFormat("dd-MMM-yyyy hh:mm:ss a"); input.setTimestampField(dateFormat.format(new Date())); But in the production environment, it raises an exception ORA-01830: date format picture ends before converting entire input string. I know the testing environment should be a replica of the production site, but it is not in my hands to set them properly. And I need to send the Timestamp field despite the way they setup the database. Any ideas? Thanks in advance.

    Read the article

  • R: Using sapply on vector of POSIXct

    - by Chris
    I have what may be a very simple question. I want to process a column of POSIXct objects from a dataframe and generate a vector of datetime strings. I tried to use the following sapply call dt <- sapply(df$datetime, function(x) format(x,"%Y-%m-%dT%H:%M:%S")) but to no avail. I keep getting the following error Error in prettyNum(.Internal(format(x, trim, digits, nsmall, width, 3L, : invalid 'trim' argument When I apply this function to a single POSIXct object from the column, I have no problem. So I'm stumped at the moment about what the problem is. Do I need to do something special with POSIXct objects?

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • rails, rest, render different action with responds to

    - by Sam
    Maybe my logic is not restful or know if this is how you would do it but this is what I am trying to do. I'm getting a category inside a category controller and then once I get that category I want to return to an index page in a different controller but keep that @category and the Category.busineses. Before rest I would have just done this: render :controller = "businesses" and it would have rendered the view of the index action in that controller. now in my respond_to block I have this format.html {redirect_to(business_path)} # index.html.erb format.xml { render :xml => @businesses } but of course with a render it looses the instance variable and starts with a new action. So what I want to do is render the action instead of redirecting to that action. is this possible?

    Read the article

  • Use boost date_time to parse and create HTTP-dates

    - by John Price
    I'm writing a kind of HTTP proxy, so I need to be able to do 3 things: Parse an HTTP-date given any of the 3 formats specified in RFC 2616, sec 3.3, Convert a file date-time to an HTTP-date string, and Output the date to a string. For reference, theses are examples of the date-times I need to parse. I will output only the first format: Sun, 06 Nov 1994 08:49:37 GMT ; RFC 822, updated by RFC 1123 Sunday, 06-Nov-94 08:49:37 GMT ; RFC 850, obsoleted by RFC 1036 Sun Nov 6 08:49:37 1994 ; ANSI C's asctime() format I'm pretty sure Boost date_time can do all of this, but I'm having some trouble with number 1. Does anyone already have code to do this? Perhaps I'm not using google proficiently, but I can't find an example of how to do this with boost anywhere. Thanks for any help!

    Read the article

  • Subversion pre-commit hook to clean XML from WebDAV autocommit client

    - by rjmunro
    I know that it isn't normally safe to modify a commit from a pre-commit hook in Subversion because SVN clients will not see the version that has been committed, and will cache the wrong thing, but I'd like to clean the code from a versioning-naïve WebDAV client that won't keep a local cached copy. The idea is that when I look at the repository with an SVN client, the diffs are clean. The client, by the way is MS Word, using 2003 XML format files. We're already using this format in a WebDAV system, but we'd like to add a versioning capability for expert users. Everywhere I look for documentation on how to modify the code in a pre-commit hook, I get the answer "Don't do this", not the answer "Here's how to do this, but it's reccomeded you don't", so I can't even easily try it to see if it's going to cause me problems.

    Read the article

< Previous Page | 136 137 138 139 140 141 142 143 144 145 146 147  | Next Page >