Search Results

Search found 12683 results on 508 pages for 'row sun'.

Page 145/508 | < Previous Page | 141 142 143 144 145 146 147 148 149 150 151 152  | Next Page >

  • enable HeapDumpOnOutOfMemoryError in runtime

    - by Schildmeijer
    according to http://java.sun.com/javase/6/webnotes/trouble/TSG-VM/html/clopts.html it should be possible to enable -XX:+HeapDumpOnOutOfMemoryError using JConsole in runtime. How? I assume its somewhere under MBeans tab and the com.sun.management - HotSpotDiagnostic - Operations - setVMOptions ?

    Read the article

  • StaX: Content not allowed in prolog

    - by RalfB
    I have the following (test) XML file below and Java code that uses StaX. I want to apply this code to a file that is about 30 GB large but with fairly small elements, so I thought StaX is a good choice. I am getting the following error: Exception in thread "main" javax.xml.stream.XMLStreamException: ParseError at [row,col]:[1,1] Message: Content is not allowed in prolog at com.sun.org.apache.xerces.internal.impl.XMLStreamReaderImpl.next(XMLStreamReaderImpl.java:598) at at.tuwien.mucke.util.xml.staxtest.StaXTest.main(StaXTest.java:18) at sun.reflect.NativeMethodAccessorImpl.invoke0(Native Method) at sun.reflect.NativeMethodAccessorImpl.invoke(NativeMethodAccessorImpl.java:57) at sun.reflect.DelegatingMethodAccessorImpl.invoke(DelegatingMethodAccessorImpl.java:43) at java.lang.reflect.Method.invoke(Method.java:601) at com.intellij.rt.execution.application.AppMain.main(AppMain.java:120) <?xml version='1.0' encoding='utf-8'?> <catalog> <book id="bk101"> <author>Gambardella, Matthew</author> <title>XML Developer's Guide</title> <price>44.95</price> <description>An in-depth look at creating applications with XML.</description> </book> <book id="bk102"> <author>Ralls, Kim</author> <title>Midnight Rain</title> <price>5.95</price> <description>A former architect battles corporate zombies, an evil sorceress, and her own childhood to become queen of the world.</description> </book> </catalog> Here the code: package xml.staxtest; import java.io.*; import javax.xml.stream.*; public class StaXTest { public static void main(String[] args) throws Exception { XMLInputFactory xif = XMLInputFactory.newInstance(); XMLStreamReader streamReader = xif.createXMLStreamReader(new FileReader("D:/Data/testFile.xml")); while(streamReader.hasNext()){ int eventType = streamReader.next(); if(eventType == XMLStreamReader.START_ELEMENT){ System.out.println(streamReader.getLocalName()); } //... more to come here later ... } } }

    Read the article

  • Exception: Need to specify class name in environment or system property: java.naming.factory.initial

    - by DanDan
    When i run a JMS related application, i am encountering the following exception error. javax.naming.NoInitialContextException: Need to specify class name in environment or system property, or as an applet parameter, or in an application resource file: java.naming.factory.initial We are using Sun Application Server 9.1 Any idea what are we missing? I already tried adding the following but result still the same Properties env = new Properties(); env.put("java.naming.factory.initial","com.sun.jndi.cosnaming.CNCtxFactory"); Context ctx = new InitialContext(env);

    Read the article

  • Can i get the particular disk space(like C: ) using Jav program..?

    - by Venkats
    I used SystemEnvironment class in java for getting system information. In that i can get only RAM size, i can't get the specific disk space like c: and D: code is, com.sun.management.OperatingSystemMXBean mxbean = (com.sun.management.OperatingSystemMXBean)ManagementFactory.getOperatingSystemMXBean(); System.out.println("Total RAM:"+mxbean.getTotalSwapSpaceSize()/(1024*1024*1024)+""+"GB"); Can i get this using in java program?

    Read the article

  • Multiple certs with one private key on apache?

    - by tenbatsu
    Really fundamental question here, but nothing a quick google search is lending itself to. Do I need to generate a separate private key for each cert I use in apache? Server details: % /usr/sbin/httpd -v Server version: Apache/2.2.8 (Unix) Server built: Jan 24 2008 10:44:19 % uname -a Linux *.com 2.6.23.15-80.fc7 #1 SMP Sun Feb 10 17:29:10 EST 2008 i686 i686 i386 GNU/Linux % cat /proc/versionversion 2.6.23.15-80.fc7 ([email protected]) (gcc version 4.1.2 20070925 (Red Hat 4.1.2-27)) #1 SMP Sun Feb 10 17:29:10 EST 2008

    Read the article

  • Master Details and collectionViewSource in separate views cannot make it work.

    - by devnet247
    Hi all, I really cannot seem to make/understand how it works with separate views It all works fine if a bundle all together in a single window. I have a list of Countries-Cities-etc... When you select a country it should load it's cities. Works So I bind 3 listboxes successfully using collection sources and no codebehind more or less (just code to set the datacontext and selectionChanged). you can download the project here http://cid-9db5ae91a2948485.skydrive.live.com/self.aspx/PublicFolder/2MasterDetails.zip <Window.Resources> <CollectionViewSource Source="{Binding}" x:Key="cvsCountryList"/> <CollectionViewSource Source="{Binding Source={StaticResource cvsCountryList},Path=Cities}" x:Key="cvsCityList"/> <CollectionViewSource Source="{Binding Source={StaticResource cvsCityList},Path=Hotels}" x:Key="cvsHotelList"/> </Window.Resources> <Grid> <Grid.ColumnDefinitions> <ColumnDefinition/> <ColumnDefinition/> <ColumnDefinition/> </Grid.ColumnDefinitions> <Grid.RowDefinitions> <RowDefinition Height="Auto"/> <RowDefinition/> </Grid.RowDefinitions> <TextBlock Grid.Column="0" Grid.Row="0" Text="Countries"/> <TextBlock Grid.Column="1" Grid.Row="0" Text="Cities"/> <TextBlock Grid.Column="2" Grid.Row="0" Text="Hotels"/> <ListBox Grid.Column="0" Grid.Row="1" Name="lstCountries" IsSynchronizedWithCurrentItem="True" ItemsSource="{Binding Source={StaticResource cvsCountryList}}" DisplayMemberPath="Name" SelectionChanged="OnSelectionChanged"/> <ListBox Grid.Column="1" Grid.Row="1" Name="lstCities" IsSynchronizedWithCurrentItem="True" ItemsSource="{Binding Source={StaticResource cvsCityList}}" DisplayMemberPath="Name" SelectionChanged="OnSelectionChanged"/> <ListBox Grid.Column="2" Grid.Row="1" Name="lstHotels" ItemsSource="{Binding Source={StaticResource cvsHotelList}}" DisplayMemberPath="Name" SelectionChanged="OnSelectionChanged"/> </Grid> Does not work I am trying to implement the same using a view for each eg(LeftSideMasterControl -RightSideDetailsControls) However I cannot seem to make them bind. Can you help? I would be very grateful so that I can understand how you communicate between userControls You can download the project here. http://cid-9db5ae91a2948485.skydrive.live.com/self.aspx/PublicFolder/2MasterDetails.zip I have as follows LeftSideMasterControl.xaml <Grid> <ListBox Name="lstCountries" SelectionChanged="OnSelectionChanged" DisplayMemberPath="Name" ItemsSource="{Binding Countries}"/> </Grid> RightViewDetailsControl.xaml MainView.xaml <CollectionViewSource Source="{Binding}" x:Key="cvsCountryList"/> <CollectionViewSource Source="{Binding Source={StaticResource cvsCountryList},Path=Cities}" x:Key="cvsCityList"/> </UserControl.Resources> <Grid> <Grid.ColumnDefinitions> <ColumnDefinition/> <ColumnDefinition Width="3*"/> </Grid.ColumnDefinitions> <Views:LeftViewMasterControl x:Name="leftSide" Margin="5" Content="{Binding Source=}"/> <GridSplitter Grid.Column="0" Grid.Row="0" Background="LightGray"/> <Views:RightViewDetailsControl Grid.Column="1" x:Name="RightSide" Margin="5"/> </Grid> ViewModels public class CountryListVM : ViewModelBase { public CountryListVM() { Countries = new ObservableCollection<CountryVM>(); } public ObservableCollection<CountryVM> Countries { get; set; } private RelayCommand _loadCountriesCommand; public ICommand LoadCountriesCommand { get { return _loadCountriesCommand ?? (_loadCountriesCommand = new RelayCommand(x => LoadCountries(), x => CanLoadCountries)); } } private static bool CanLoadCountries { get { return true; } } private void LoadCountries() { var countryList = Repository.GetCountries(); foreach (var country in countryList) { Countries.Add(new CountryVM { Name = country.Name }); } } } public class CountryVM : ViewModelBase { private string _name; public string Name { get { return _name; } set { _name = value; OnPropertyChanged("Name"); } } } public class CityListVM : ViewModelBase { private CountryVM _selectedCountry; public CityListVM(CountryVM country) { SelectedCountry = country; Cities = new ObservableCollection<CityVM>(); } public ObservableCollection<CityVM> Cities { get; set; } public CountryVM SelectedCountry { get { return _selectedCountry; } set { _selectedCountry = value; OnPropertyChanged("SelectedCountry"); } } private RelayCommand _loadCitiesCommand; public ICommand LoadCitiesCommand { get { return _loadCitiesCommand ?? (_loadCitiesCommand = new RelayCommand(x => LoadCities(), x => CanLoadCities)); } } private static bool CanLoadCities { get { return true; } } private void LoadCities() { var cities = Repository.GetCities(SelectedCountry.Name); foreach (var city in cities) { Cities.Add(new CityVM() { Name = city.Name }); } } } public class CityVM : ViewModelBase { private string _name; public string Name { get { return _name; } set { _name = value; OnPropertyChanged("Name"); } } } Models ========= public class Country { public Country() { Cities = new ObservableCollection<City>(); } public string Name { get; set; } public ObservableCollection<City> Cities { get; set; } } public class City { public City() { Hotels = new ObservableCollection<Hotel>(); } public string Name { get; set; } public ObservableCollection<Hotel> Hotels { get; set; } } public class Hotel { public string Name { get; set; } }

    Read the article

  • Python - Converting CSV to Objects - Code Design

    - by victorhooi
    Hi, I have a small script we're using to read in a CSV file containing employees, and perform some basic manipulations on that data. We read in the data (import_gd_dump), and create an Employees object, containing a list of Employee objects (maybe I should think of a better naming convention...lol). We then call clean_all_phone_numbers() on Employees, which calls clean_phone_number() on each Employee, as well as lookup_all_supervisors(), on Employees. import csv import re import sys #class CSVLoader: # """Virtual class to assist with loading in CSV files.""" # def import_gd_dump(self, input_file='Gp Directory 20100331 original.csv'): # gd_extract = csv.DictReader(open(input_file), dialect='excel') # employees = [] # for row in gd_extract: # curr_employee = Employee(row) # employees.append(curr_employee) # return employees # #self.employees = {row['dbdirid']:row for row in gd_extract} # Previously, this was inside a (virtual) class called "CSVLoader". # However, according to here (http://tomayko.com/writings/the-static-method-thing) - the idiomatic way of doing this in Python is not with a class-fucntion but with a module-level function def import_gd_dump(input_file='Gp Directory 20100331 original.csv'): """Return a list ('employee') of dict objects, taken from a Group Directory CSV file.""" gd_extract = csv.DictReader(open(input_file), dialect='excel') employees = [] for row in gd_extract: employees.append(row) return employees def write_gd_formatted(employees_dict, output_file="gd_formatted.csv"): """Read in an Employees() object, and write out each Employee() inside this to a CSV file""" gd_output_fieldnames = ('hrid', 'mail', 'givenName', 'sn', 'dbcostcenter', 'dbdirid', 'hrreportsto', 'PHFull', 'PHFull_message', 'SupervisorEmail', 'SupervisorFirstName', 'SupervisorSurname') try: gd_formatted = csv.DictWriter(open(output_file, 'w', newline=''), fieldnames=gd_output_fieldnames, extrasaction='ignore', dialect='excel') except IOError: print('Unable to open file, IO error (Is it locked?)') sys.exit(1) headers = {n:n for n in gd_output_fieldnames} gd_formatted.writerow(headers) for employee in employees_dict.employee_list: # We're using the employee object's inbuilt __dict__ attribute - hmm, is this good practice? gd_formatted.writerow(employee.__dict__) class Employee: """An Employee in the system, with employee attributes (name, email, cost-centre etc.)""" def __init__(self, employee_attributes): """We use the Employee constructor to convert a dictionary into instance attributes.""" for k, v in employee_attributes.items(): setattr(self, k, v) def clean_phone_number(self): """Perform some rudimentary checks and corrections, to make sure numbers are in the right format. Numbers should be in the form 0XYYYYYYYY, where X is the area code, and Y is the local number.""" if self.telephoneNumber is None or self.telephoneNumber == '': return '', 'Missing phone number.' else: standard_format = re.compile(r'^\+(?P<intl_prefix>\d{2})\((?P<area_code>\d)\)(?P<local_first_half>\d{4})-(?P<local_second_half>\d{4})') extra_zero = re.compile(r'^\+(?P<intl_prefix>\d{2})\(0(?P<area_code>\d)\)(?P<local_first_half>\d{4})-(?P<local_second_half>\d{4})') missing_hyphen = re.compile(r'^\+(?P<intl_prefix>\d{2})\(0(?P<area_code>\d)\)(?P<local_first_half>\d{4})(?P<local_second_half>\d{4})') if standard_format.search(self.telephoneNumber): result = standard_format.search(self.telephoneNumber) return '0' + result.group('area_code') + result.group('local_first_half') + result.group('local_second_half'), '' elif extra_zero.search(self.telephoneNumber): result = extra_zero.search(self.telephoneNumber) return '0' + result.group('area_code') + result.group('local_first_half') + result.group('local_second_half'), 'Extra zero in area code - ask user to remediate. ' elif missing_hyphen.search(self.telephoneNumber): result = missing_hyphen.search(self.telephoneNumber) return '0' + result.group('area_code') + result.group('local_first_half') + result.group('local_second_half'), 'Missing hyphen in local component - ask user to remediate. ' else: return '', "Number didn't match recognised format. Original text is: " + self.telephoneNumber class Employees: def __init__(self, import_list): self.employee_list = [] for employee in import_list: self.employee_list.append(Employee(employee)) def clean_all_phone_numbers(self): for employee in self.employee_list: #Should we just set this directly in Employee.clean_phone_number() instead? employee.PHFull, employee.PHFull_message = employee.clean_phone_number() # Hmm, the search is O(n^2) - there's probably a better way of doing this search? def lookup_all_supervisors(self): for employee in self.employee_list: if employee.hrreportsto is not None and employee.hrreportsto != '': for supervisor in self.employee_list: if supervisor.hrid == employee.hrreportsto: (employee.SupervisorEmail, employee.SupervisorFirstName, employee.SupervisorSurname) = supervisor.mail, supervisor.givenName, supervisor.sn break else: (employee.SupervisorEmail, employee.SupervisorFirstName, employee.SupervisorSurname) = ('Supervisor not found.', 'Supervisor not found.', 'Supervisor not found.') else: (employee.SupervisorEmail, employee.SupervisorFirstName, employee.SupervisorSurname) = ('Supervisor not set.', 'Supervisor not set.', 'Supervisor not set.') #Is thre a more pythonic way of doing this? def print_employees(self): for employee in self.employee_list: print(employee.__dict__) if __name__ == '__main__': db_employees = Employees(import_gd_dump()) db_employees.clean_all_phone_numbers() db_employees.lookup_all_supervisors() #db_employees.print_employees() write_gd_formatted(db_employees) Firstly, my preamble question is, can you see anything inherently wrong with the above, from either a class design or Python point-of-view? Is the logic/design sound? Anyhow, to the specifics: The Employees object has a method, clean_all_phone_numbers(), which calls clean_phone_number() on each Employee object inside it. Is this bad design? If so, why? Also, is the way I'm calling lookup_all_supervisors() bad? Originally, I wrapped the clean_phone_number() and lookup_supervisor() method in a single function, with a single for-loop inside it. clean_phone_number is O(n), I believe, lookup_supervisor is O(n^2) - is it ok splitting it into two loops like this? In clean_all_phone_numbers(), I'm looping on the Employee objects, and settings their values using return/assignment - should I be setting this inside clean_phone_number() itself? There's also a few things that I'm sorted of hacked out, not sure if they're bad practice - e.g. print_employee() and gd_formatted() both use __dict__, and the constructor for Employee uses setattr() to convert a dictionary into instance attributes. I'd value any thoughts at all. If you think the questions are too broad, let me know and I can repost as several split up (I just didn't want to pollute the boards with multiple similar questions, and the three questions are more or less fairly tightly related). Cheers, Victor

    Read the article

  • Fetch image from folder via datatable does not work after placing image in subdirectory

    - by Arnold Bishkoff
    I am having trouble wrapping my head around the following I have code that fetches an image via smarty in a line img src="getsnap.php?picid={$data[$smarty.section.sec.index].picno|default:$nextpic}&typ=pic&width={$config.disp_snap_width}&height={$config.disp_snap_height}" class="smallpic" alt="" / this works if i pull the image from /temp/userimages/userid/imageNo.ext but because an OS can segfault if you store too many folders or images in a directory i have code that assigns the user image to a subdirectory based upon division of a subdir per 1000 userids. so in thise case i have user id 94 whos images get stored in /siteroot/temp/userimages/000000/94/pic_1.jpg (through 10) or tn_1 (through 10).jpg here is the code for getsnap.php <?php ob_start(); if ( !defined( 'SMARTY_DIR' ) ) { include_once( 'init.php' ); } include('core/snaps_functions.php'); if (isset($_REQUEST['username']) && $_REQUEST['username'] != '') { $userid = $osDB-getOne('select id from ! where username = ?',array(USER_TABLE, $_REQUEST['username']) ); } else { // include ( 'sessioninc.php' ); if( !isset($_GET['id']) || (isset($_GET['id'])&& (int)$_GET['id'] <= 0 ) ) { $userid = $_SESSION['UserId']; } else { $userid = $_GET['id']; } } if (!isset($_GET['picid']) ) { if ((isset($_REQUEST['type']) && $_REQUEST['type'] != 'gallery') || !isset($_REQUEST['type']) ) { $defpic = $osDB-getOne('select picno from ! where userid = ? and ( album_id is null or album_id = ?) and default_pic = ? and active = ? ',array(USER_SNAP_TABLE, $userid,'0','Y','Y' ) ); if ($defpic != '') { $picid = $defpic; } else { $picid = $osDB-getOne('select picno from ! where userid = ? and ( album_id is null or album_id = ?) and active=? order by rand()',array(USER_SNAP_TABLE, $userid,'0','Y' ) ); } unset( $defpic); } } else { $picid = $_GET['picid']; } $typ = isset( $_GET['typ'])?$_GET['typ']:'pic' ; $cond = ''; if ( ($config['snaps_require_approval'] == 'Y' || $config['snaps_require_approval'] == '1') && $userid != $_SESSION['UserId'] ) { $cond = " and active = 'Y' "; } $sql = 'select * from ! where userid = ? and picno = ? '.$cond; //Get the pic $row =& $osDB-getRow ( $sql, array( USER_SNAP_TABLE, $userid, $picid ) ); //Okay pic was found in the DB, Lets actually do something // $id = $userid; $dir = str_pad(($id - ($id % 1000))/100000,6,'0',STR_PAD_LEFT); $zimg = USER_IMAGES_DIR.$dir; $img = getPicture($zimg, $userid, $picid, $typ, $row); //$img = getPicture($userid, $picid, $typ, $row); //$img = getPicture($dir, $userid, $picid, $typ, $row); $ext = ($typ = 'tn')?$row['tnext']:$row['picext']; // Now pic is built as // something pic_x.ext ie pic_2.jpg if ( $img != '' && ( ( hasRight('seepictureprofile') && ( $config['snaps_require_approval'] == 'Y' && $row['active'] == 'Y' ) ||$config['snaps_require_approval'] == 'N' ) || $userid == $_SESSION['UserId'] ) ) { $img2 = $img; //$img2 = $dir.'/'.$img; } else { $gender = $osDB-getOne( 'select gender from ! where id = ?', array( USER_TABLE, $userid ) ) ; if ($gender == 'M') { $nopic = SKIN_IMAGES_DIR.'male.jpg'; } elseif ($gender == 'F') { $nopic = SKIN_IMAGES_DIR.'female.jpg'; } elseif ($gender == 'D') { $nopic = SKIN_IMAGES_DIR.'director.jpg'; } $img2 = imagecreatefromjpeg($nopic); $ext = 'jpg'; } ob_end_clean(); header("Pragma: public"); header("Content-Type: image/".$ext); header("Content-Transfer-Encoding: binary"); header("Cache-Control: must-revalidate"); $ExpStr = "Expires: " . gmdate("D, d M Y H:i:s", time() - 30) . " GMT"; header($ExpStr); $id = $userid; $dir = str_pad(($id - ($id % 1000))/100000,6,'0',STR_PAD_LEFT); $zimg = USER_IMAGES_DIR.$dir; //header("Content-Disposition: attachment; filename=profile_".$userid."_".$typ.".".$ext); //header("Content-Disposition: attachment; filename=$dir.'/'.profile_".$userid."".$typ.".".$ext); //header("Content-Disposition: attachment; filename=profile"$dir".'/'.".$userid."_".$typ.".".$ext); header("Content-Disposition: attachment; filename=profile_".$userid."_".$typ.".".$ext); /* if ($_SESSION['browser'] != 'MSIE') { header("Content-Disposition: inline" ); } */ if ($ext == 'jpg') { imagejpeg($img2); } elseif ($ext == 'gif') { imagegif($img2); } elseif ($ext == 'png') { imagepng($img2); } elseif ($ext == 'bmp') { imagewbmp($img2); } imagedestroy($img2); ?

    Read the article

  • How to bring out checboxes based on drop down list selection from DB

    - by user2199877
    I got stuck again. Can't overcome this step: loop through (in a form of checkboxes) pallets based on the lot drop down list selection, so it can be further submitted to complete the table. Please, please help. So, basically, first submit button (drop down menu) brings into the table lot number and description and also checkboxes to choose pallets. Second submit button (checboxes) brings into the table pallets numbers and weights. Thank you for any help. <?php mysql_connect('localhost','user',''); mysql_select_db('base'); $query="SELECT DISTINCT lot_number FROM pl_table"; $result=mysql_query($query); ?> <form action="" method="POST"> <select name="option_chosen"> <option>-- Select lot --</option> <?php while(list($lot_number)=mysql_fetch_row($result)) { echo "<option value=\"".$lot_number."\">".$lot_number."</option>"; } ?> </select> <input type='submit' name='submitLot' value='Submit' /> </form> <!-- need help here <h4>-- Select pallets --</h4> <form action="" method="POST"> <input type='submit' name='submitPal' value='Submit'/> </form> --> <table border="1" id="table"> <tr> <th width=80 height=30>Lot<br/>number</th> <th width=110 height=30>Description</th> <th width=90 height=30>Pallet<br/>number</th> <th width=60 height=30>Net</th> <th width=60 height=30>Gross</th> </tr> <?php if($_SERVER['REQUEST_METHOD'] =='POST') {$option_chosen=$_POST['option_chosen']; $query="SELECT * FROM pl_table WHERE lot_number='$option_chosen'"; $run=mysql_query($query); $row=mysql_fetch_array($run, MYSQLI_ASSOC); echo "<tr><td>".''."</td>"; echo "<td rowspan='5'>".$row['descr']."</td>"; echo "<td><b>".'Total weight'."<b></td>"; echo "<td>".''."</td><td>".''."</td></tr>"; echo "<td>".$row['lot_number']."</td>"; echo "<td colspan='3'>".''."</td>"; //This to be echoed when "select pallets" submited //echo "<tr><td>".$row['lot_number']."</td>"; //echo "<td>".$row['pallet_number']."</td>"; //echo "<td>".$row['net']."</td><td>".$row['gross']."</td></tr>"; } ?> </table> the table +--------------------------+-------------------------+---------+-------+ | id | lot_number | descr | pallet_number | net | gross | +--------------------------+-------------------------+---------+-------+ | 1 | 111 | black | 1 | 800 | 900 | | 2 | 111 | black | 2 | 801 | 901 | | 3 | 111 | black | 3 | 802 | 902 | | 4 | 222 | white | 1 | 800 | 900 | | 5 | 222 | white | 2 | 801 | 901 | | 6 | 222 | white | 3 | 802 | 902 | +--------------------------+-------------------------+---------+-------+

    Read the article

  • Which workaround to use for the following SQL deadlock?

    - by Marko
    I found a SQL deadlock scenario in my application during concurrency. I belive that the two statements that cause the deadlock are (note - I'm using LINQ2SQL and DataContext.ExecuteCommand(), that's where this.studioId.ToString() comes into play): exec sp_executesql N'INSERT INTO HQ.dbo.SynchronizingRows ([StudioId], [UpdatedRowId]) SELECT @p0, [t0].[Id] FROM [dbo].[UpdatedRows] AS [t0] WHERE NOT (EXISTS( SELECT NULL AS [EMPTY] FROM [dbo].[ReceivedUpdatedRows] AS [t1] WHERE ([t1].[StudioId] = @p0) AND ([t1].[UpdatedRowId] = [t0].[Id]) ))',N'@p0 uniqueidentifier',@p0='" + this.studioId.ToString() + "'; and exec sp_executesql N'INSERT INTO HQ.dbo.ReceivedUpdatedRows ([UpdatedRowId], [StudioId], [ReceiveDateTime]) SELECT [t0].[UpdatedRowId], @p0, GETDATE() FROM [dbo].[SynchronizingRows] AS [t0] WHERE ([t0].[StudioId] = @p0)',N'@p0 uniqueidentifier',@p0='" + this.studioId.ToString() + "'; The basic logic of my (client-server) application is this: Every time someone inserts or updates a row on the server side, I also insert a row into the table UpdatedRows, specifying the RowId of the modified row. When a client tries to synchronize data, it first copies all of the rows in the UpdatedRows table, that don't contain a reference row for the specific client in the table ReceivedUpdatedRows, to the table SynchronizingRows (the first statement taking part in the deadlock). Afterwards, during the synchronization I look for modified rows via lookup of the SynchronizingRows table. This step is required, otherwise if someone inserts new rows or modifies rows on the server side during synchronization I will miss them and won't get them during the next synchronization (explanation scenario to long to write here...). Once synchronization is complete, I insert rows to the ReceivedUpdatedRows table specifying that this client has received the UpdatedRows contained in the SynchronizingRows table (the second statement taking part in the deadlock). Finally I delete all rows from the SynchronizingRows table that belong to the current client. The way I see it, the deadlock is occuring on tables SynchronizingRows (abbreviation SR) and ReceivedUpdatedRows (abbreviation RUR) during steps 2 and 3 (one client is in step 2 and is inserting into SR and selecting from RUR; while another client is in step 3 inserting into RUR and selecting from SR). I googled a bit about SQL deadlocks and came to a conclusion that I have three options. Inorder to make a decision I need more input about each option/workaround: Workaround 1: The first advice given on the web about SQL deadlocks - restructure tables/queries so that deadlocks don't happen in the first place. Only problem with this is that with my IQ I don't see a way to do the synchronization logic any differently. If someone wishes to dwelve deeper into my current synchronization logic, how and why it is set up the way it is, I'll post a link for the explanation. Perhaps, with the help of someone smarter than me, it's possible to create a logic that is deadlock free. Workaround 2: The second most common advice seems to be the use of WITH(NOLOCK) hint. The problem with this is that NOLOCK might miss or duplicate some rows. Duplication is not a problem, but missing rows is catastrophic! Another option is the WITH(READPAST) hint. On the face of it, this seems to be a perfect solution. I really don't care about rows that other clients are inserting/modifying, because each row belongs only to a specific client, so I may very well skip locked rows. But the MSDN documentaion makes me a bit worried - "When READPAST is specified, both row-level and page-level locks are skipped". As I said, row-level locks would not be a problem, but page-level locks may very well be, since a page might contain rows that belong to multiple clients (including the current one). While there are lots of blog posts specifically mentioning that NOLOCK might miss rows, there seems to be none about READPAST (never) missing rows. This makes me skeptical and nervous to implement it, since there is no easy way to test it (implementing would be a piece of cake, just pop WITH(READPAST) into both statements SELECT clause and job done). Can someone confirm whether the READPAST hint can miss rows? Workaround 3: The final option is to use ALLOW_SNAPSHOT_ISOLATION and READ_COMMITED_SNAPSHOT. This would seem to be the only option to work 100% - at least I can't find any information that would contradict with it. But it is a little bit trickier to setup (I don't care much about the performance hit), because I'm using LINQ. Off the top of my head I probably need to manually open a SQL connection and pass it to the LINQ2SQL DataContext, etc... I haven't looked into the specifics very deeply. Mostly I would prefer option 2 if somone could only reassure me that READPAST will never miss rows concerning the current client (as I said before, each client has and only ever deals with it's own set of rows). Otherwise I'll likely have to implement option 3, since option 1 is probably impossible... I'll post the table definitions for the three tables as well, just in case: CREATE TABLE [dbo].[UpdatedRows]( [Id] [uniqueidentifier] NOT NULL ROWGUIDCOL DEFAULT NEWSEQUENTIALID() PRIMARY KEY CLUSTERED, [RowId] [uniqueidentifier] NOT NULL, [UpdateDateTime] [datetime] NOT NULL, ) ON [PRIMARY] GO CREATE NONCLUSTERED INDEX IX_RowId ON dbo.UpdatedRows ([RowId] ASC) WITH (STATISTICS_NORECOMPUTE = OFF, IGNORE_DUP_KEY = OFF, ALLOW_ROW_LOCKS = ON, ALLOW_PAGE_LOCKS = ON) ON [PRIMARY] GO CREATE TABLE [dbo].[ReceivedUpdatedRows]( [Id] [uniqueidentifier] NOT NULL ROWGUIDCOL DEFAULT NEWSEQUENTIALID() PRIMARY KEY NONCLUSTERED, [UpdatedRowId] [uniqueidentifier] NOT NULL REFERENCES [dbo].[UpdatedRows] ([Id]), [StudioId] [uniqueidentifier] NOT NULL REFERENCES, [ReceiveDateTime] [datetime] NOT NULL, ) ON [PRIMARY] GO CREATE CLUSTERED INDEX IX_Studios ON dbo.ReceivedUpdatedRows ([StudioId] ASC) WITH (STATISTICS_NORECOMPUTE = OFF, IGNORE_DUP_KEY = OFF, ALLOW_ROW_LOCKS = ON, ALLOW_PAGE_LOCKS = ON) ON [PRIMARY] GO CREATE TABLE [dbo].[SynchronizingRows]( [StudioId] [uniqueidentifier] NOT NULL [UpdatedRowId] [uniqueidentifier] NOT NULL REFERENCES [dbo].[UpdatedRows] ([Id]) PRIMARY KEY CLUSTERED ([StudioId], [UpdatedRowId]) ) ON [PRIMARY] GO PS! Studio = Client. PS2! I just noticed that the index definitions have ALLOW_PAGE_LOCK=ON. If I would turn it off, would that make any difference to READPAST? Are there any negative downsides for turning it off?

    Read the article

  • Need help... how to add md5 to password field in php?

    - by jones
    Hi mates, i looking some help and nice attention here.. i bought some php script many years ago and now no suport anymore... i just want to add md5 to password field.. here my form: <?php $SQL = "SELECT * from USERS WHERE USERNAME = '$_SESSION[username]'"; $result = @mysql_query( $SQL ); $row = @mysql_fetch_array( $result ); include 'menu.php'; ?> <FORM METHOD="post" ACTION="?page=query_client"> <INPUT TYPE="hidden" NAME="controller" VALUE="USERS~update~account_details&up=1~<?php echo $row[ID]; ?>"> <TABLE CLASS="basictable"> <TR> <TD CLASS="tdmenu" WIDTH="40%">Username</TD> <TD CLASS="tdmenu" WIDTH="60%"> <b><?php echo $row[USERNAME]; ?></b> </TD> </TR> <TR> <TD CLASS="tdmenu" WIDTH="40%">Password *</TD> <TD CLASS="tdmenu" WIDTH="60%"> <INPUT TYPE="PASSWORD" NAME="PASSWORD" SIZE="40" VALUE="<?php echo $row[PASSWORD]; ?>"> </TD> </TR> <TR> <TD CLASS="tdmenu" WIDTH="40%">Email Address *</TD> <TD CLASS="tdmenu" WIDTH="60%"> <INPUT TYPE="text" NAME="EMAIL" SIZE="40" VALUE="<?php echo $row[EMAIL]; ?>"> </TD> </TR> <TR> <TD CLASS="tdmenu" WIDTH="40%">Full Name *</TD> <TD CLASS="tdmenu" WIDTH="60%"> <INPUT TYPE="text" NAME="FULLNAME" SIZE="40" VALUE="<?php echo $row[FULLNAME]; ?>"> </TD> <TR> <TD CLASS="tdmenu" WIDTH="40%">Address *</TD> <TD CLASS="tdmenu" WIDTH="60%"> <INPUT TYPE="text" NAME="ADDRESS1" SIZE="40" VALUE="<?php echo $row[ADDRESS1]; ?>"> </TD> </TR> <BR> <TABLE CLASS="basictable"> <TR> <TD CLASS="tdhead2" > <DIV ALIGN="CENTER"><B> <INPUT TYPE="submit" NAME="Submit" VALUE="Submit"> </B></DIV> </TD> </TR> </TABLE> </FORM> and the it self as query_client.php inside look like: <?PHP @session_start(); $controller = $_POST['controller']; $pieces = explode("~", $controller); $table = $pieces[0]; $qt = $pieces[1]; $return = $pieces[2]; $id = $pieces[3]; $hack = $pieces[4]; if ($qt == insert) $qt = 'INSERT INTO'; if ($qt == update) { $qt = 'UPDATE'; $end = "WHERE ID = '$id'"; } $pre = array_keys( $_POST ); mysql_query ("CREATE TABLE IF NOT EXISTS `$table` (`ID` INT NOT NULL AUTO_INCREMENT , PRIMARY KEY ( `id` ) )"); $count = count($pre); $count = $count - 2; $sql = "$qt $table SET"; for ($i=0; $i < $count; $i++) { $x=$i+1; $y = $_POST[$pre[$x]]; $d = $y; mysql_query ("ALTER TABLE `$table` ADD `$pre[$x]` TEXT NOT NULL"); $sql .= " `$pre[$x]` = '$d',"; } $sql .= " ID = '$id' $end"; $query = mysql_query($sql) or die("$sql_error" . mysql_error()); if (empty($hack)) { } else { $pieces = explode("/", $hack); $h0 = $pieces[0]; $h1 = $pieces[1]; $h2 = $pieces[2]; $h3 = $pieces[3]; $h4 = $pieces[4]; $h5 = $pieces[5]; mysql_query ("ALTER TABLE `$table` $h0 $h1 $h2 $h3 $h4 $h5"); $query = mysql_query($sql) or die("$sql_error" . mysql_error()); } if (isset($_GET[inc])) include "$_GET[inc].php"; ?> so please help me how to add md5 in PASSWORD field? thanks in advance..

    Read the article

  • Rails app deployment challenge, not finding database table in production.log

    - by Stefan M
    I'm trying to setup PasswordPusher as my first ruby app ever. Building and running the webrick server as instructed in README works fine. It was only when I tried to add Apache ProxyPass and ProxyPassReverse that the page load slowed down to several minutes. So I gave mod_passenger a whirl but now it's unable to find the password table. Here's what I get in log/production.log. Started GET "/" for 10.10.2.13 at Sun Jun 10 08:07:19 +0200 2012 Processing by PasswordsController#new as HTML Completed 500 Internal Server Error in 1ms ActiveRecord::StatementInvalid (Could not find table 'passwords'): app/controllers/passwords_controller.rb:77:in `new' app/controllers/passwords_controller.rb:77:in `new' While in log/private.log I get a lot more output so here's just a snippet but it looks to me like it's working with the database. Edit: This was actually old log output, maybe from db:create. Migrating to AddUserToPassword (20120220172426) (0.3ms) ALTER TABLE "passwords" ADD "user_id" integer (0.0ms) PRAGMA index_list("passwords") (0.2ms) CREATE INDEX "index_passwords_on_user_id" ON "passwords" ("user_id") (0.7ms) INSERT INTO "schema_migrations" ("version") VALUES ('20120220172426') (0.1ms) select sqlite_version(*) (0.1ms) SELECT "schema_migrations"."version" FROM "schema_migrations" (0.0ms) PRAGMA index_list("passwords") (0.0ms) PRAGMA index_info('index_passwords_on_user_id') (4.6ms) PRAGMA index_list("rails_admin_histories") (0.0ms) PRAGMA index_info('index_rails_admin_histories') (0.0ms) PRAGMA index_list("users") (4.8ms) PRAGMA index_info('index_users_on_unlock_token') (0.0ms) PRAGMA index_info('index_users_on_reset_password_token') (0.0ms) PRAGMA index_info('index_users_on_email') (0.0ms) PRAGMA index_list("views") In my vhost I have it set to use RailsEnv private. <VirtualHost *:80> # ProxyPreserveHost on # # ProxyPass / http://10.220.100.209:180/ # ProxyPassReverse / http://10.220.100.209:180/ DocumentRoot /var/www/pwpusher/public <Directory /var/www/pwpusher/public> allow from all Options -MultiViews </Directory> RailsEnv private ServerName pwpush.intranet ErrorLog /var/log/apache2/error.log LogLevel debug CustomLog /var/log/apache2/access.log combined </VirtualHost> My passenger.conf in mods-enabled is default for Debian. <IfModule mod_passenger.c> PassengerRoot /usr PassengerRuby /usr/bin/ruby </IfModule> In the apache error.log I get something more cryptic to me. [Sun Jun 10 06:25:07 2012] [notice] Apache/2.2.16 (Debian) Phusion_Passenger/2.2.11 PHP/5.3.3-7+squeeze9 with Suhosin-Patch mod_ssl/2.2.16 OpenSSL/0.9.8o configured -- resuming normal operations /var/www/pwpusher/vendor/bundle/ruby/1.8/bundler/gems/modernizr-rails-09e9e6a92d67/lib/modernizr/rails/version.rb:3: warning: already initialized constant VERSION cache: [GET /] miss [Sun Jun 10 08:07:19 2012] [debug] mod_deflate.c(615): [client 10.10.2.13] Zlib: Compressed 728 to 423 : URL / /var/www/pwpusher/vendor/bundle/ruby/1.8/bundler/gems/modernizr-rails-09e9e6a92d67/lib/modernizr/rails/version.rb:3: warning: already initialized constant VERSION cache: [GET /] miss [Sun Jun 10 10:17:16 2012] [debug] mod_deflate.c(615): [client 10.10.2.13] Zlib: Compressed 728 to 423 : URL / Maybe that's routine stuff. I can see the rake command create files in the relative app root db/. I have private.sqlite3, production.sqlite3 among others. And here's my config/database.yml. base: &base adapter: sqlite3 timeout: 5000 development: database: db/development.sqlite3 <<: *base test: database: db/test.sqlite3 <<: *base private: database: db/private.sqlite3 <<: *base production: database: db/production.sqlite3 <<: *base I've tried setting absolute paths in it but that did not help.

    Read the article

  • How to correctly use DERIVE or COUNTER in munin plugins

    - by Johan
    I'm using munin to monitor my server. I've been able to write plugins for it, but only if the graph type is GAUGE. When I try COUNTER or DERIVE, no data is logged or graphed. The plugin i'm currently stuck on is for monitoring bandwidth usage, and is as follows: /etc/munin/plugins/bandwidth2 #!/bin/sh if [ "$1" = "config" ]; then echo 'graph_title Bandwidth Usage 2' echo 'graph_vlabel Bandwidth' echo 'graph_scale no' echo 'graph_category network' echo 'graph_info Bandwidth usage.' echo 'used.label Used' echo 'used.info Bandwidth used so far this month.' echo 'used.type DERIVE' echo 'used.min 0' echo 'remain.label Remaining' echo 'remain.info Bandwidth remaining this month.' echo 'remain.type DERIVE' echo 'remain.min 0' exit 0 fi cat /var/log/zen.log The contents of /var/log/zen.log are: used.value 61.3251953125 remain.value 20.0146484375 And the resulting database is: <!-- Round Robin Database Dump --><rrd> <version> 0003 </version> <step> 300 </step> <!-- Seconds --> <lastupdate> 1269936605 </lastupdate> <!-- 2010-03-30 09:10:05 BST --> <ds> <name> 42 </name> <type> DERIVE </type> <minimal_heartbeat> 600 </minimal_heartbeat> <min> 0.0000000000e+00 </min> <max> NaN </max> <!-- PDP Status --> <last_ds> 61.3251953125 </last_ds> <value> NaN </value> <unknown_sec> 5 </unknown_sec> </ds> <!-- Round Robin Archives --> <rra> <cf> AVERAGE </cf> <pdp_per_row> 1 </pdp_per_row> <!-- 300 seconds --> <params> <xff> 5.0000000000e-01 </xff> </params> <cdp_prep> <ds> <primary_value> NaN </primary_value> <secondary_value> NaN </secondary_value> <value> NaN </value> <unknown_datapoints> 0 </unknown_datapoints> </ds> </cdp_prep> <database> <!-- 2010-03-28 09:15:00 BST / 1269764100 --> <row><v> NaN </v></row> <!-- 2010-03-28 09:20:00 BST / 1269764400 --> <row><v> NaN </v></row> <!-- 2010-03-28 09:25:00 BST / 1269764700 --> <row><v> NaN </v></row> <snip> The value for last_ds is correct, it just doesn't seem to make it into the actual database. If I change DERIVE to GAUGE, it works as expected. munin-run bandwidth2 outputs the contents of /var/log/zen.log I've been all over the (sparse) docs for munin plugins, and can't find my mistake. Modifying an existing plugin didn't work for me either.

    Read the article

  • why use mixed-based replication for mysql

    - by Alistair Prestidge
    I am in the process of configuring MySQL replication and am intending to use row-based-replication but I was also reading up about mixed-based replication. This is where statement-based is the default and then for certain circumstances (http://dev.mysql.com/doc/refman/5.1/en/binary-log-mixed.html) MySQL will switch to row-based. The list is quit vast on when it will switch to row-based. My questions are: Does any one use mixed? If yes why did you chose this over just using one or the other? Thanks in advance

    Read the article

  • conditional formatting for subsequent rows or columns

    - by Trailokya Saikia
    I have data in a range of cells (say six columns and one hundred rows). The first four column contains data and the sixth column has a limiting value. For data in every row the limiting value is different. I have one hundred such rows. I am successfully using Conditional formatting (e.g. cells containing data less than limiting value in first five columns are made red) for 1st row. But how to copy this conditional formatting so that it is applicable for entire hundred rows with respective limiting values. I tried with format painter. But it retains the same source cell (here limiting value) for the purpose of conditional formatting in second and subsequent rows. So, now I am required to use conditional formatting for each row separately s

    Read the article

  • Merging multiple versions of same excel spreadsheet

    - by GrinReaper
    So here's the situation: I have multiple versions of the same spreadsheet-- each one has the exact same row and column labels. The difference between any two given spreadsheets is that data in one spreadsheet shouldn't be in the other (but sometimes it might.) Is there anyway to merge all of them into a "master copy" (or just a blank version) of the spreadsheet? (basically, using the data from various versions of that worksheet to fill out the main one) Copy-pasting is extremely tedious, and doesn't allow me to copy blocks of rows IF the row numbering is non-contiguous. (For example, Rows 1, 2, 3, 6 are in a block, but row 4 and 5 just don't exist.) Ideas? Googling hasn't turned up anything that seemed directly relevant to this problem.

    Read the article

  • In Excel, given a worksheet "A", how do you create a sheet "B" that has a subset of the rows in "A"?

    - by user32706
    In Excel 2007, I have a sheet full of data "A". One of the columns in sheet "B" is called "Valid" and has either "yes" or "no". I've created a second sheet "B". It's easy to make each row in "A" appear in "B" if the row is valid using an 'if' statement in each cell. But if it's invalid, there's a blank row. I need "B" to show only the rows from "A" that are valid. TWO BIG CAVEATS: - No macros - No filtering (for long and complicated reasons). I feel like it might be possible with vlookup used cleverly, but so far, I'm stumped.

    Read the article

  • Nested IF's in Excel

    - by user1590499
    I have two columns with the following possibilities (0 for first column, and then 0 or 1 for second column; or a string for first column, and a 0 or 1 for second column). name,flag 0,0 david,0 0,1 sammy,1 How would I create a third column that looks like the following: name+flag 0 david 1 sammy Basically, if there are 2 0's in the two columns in a row, put a 0 in the new column. if there is a string in the first column in the row, no matter what the second column in the row says, put the string in the new column. and if there is a 0 in the first column and a 1 on the second column, put a 1 in the third column. Can I do this best with nested-if's? I tried something like name, flag, name+flag 0,0,=IF(A2<>0,A2,IF(B2=1,B2,0),0) But it didn't seem to work for me...

    Read the article

  • How do I extract excel data from multiple worksheets and put into one sheet?

    - by user167210
    In a workbook I have 7 sheets(Totals and then Mon to Sat),I want to extract rows which have the word "CHEQ" in its cell (this is a dropdown list with two options-CHEQ/PAID)from all sheets. On my front sheet I used this formula: =IF(ROWS(A$13:A13)>$C$10,"",INDEX(Monday!A$3:A$62,SMALL(IF(Monday[Paid]=$A$10,ROW(Monday[Paid])-ROW(Monday!$I$3)+1),ROWS(A$13:A13)))) This formula works fine for one worksheet (eg. Monday) but is it possible to show the extracted rows from all 6 sheets on the front page? I only have Excel NOT Access. These are the 12 headers on row A12 Col Name Cod House Car Date Discount 2nd Paid Extra Letter Posted The exported data appears like this (this just an example): Col Name Cod House Car Date Discount 2nd Paid Extra Letter Posted 12 Robbs 1244 Ren 11/10 10% 5 CHEQ 0 0 No 15 Jones 7784 Ren 12/10 15% 1 CHEQ 0 0 No 18 Doese 1184 Ren 12/11 12% 1 CHEQ 0 0 No Any ideas on what to do to this formula? I am using Excel 2010.

    Read the article

  • Can't insert cells in Excel 2010 - "operation not allowed" error message

    - by Force Flow
    I was working on a spreadsheet in Excel 2010, and all of a sudden when I attempted to insert a new row of cells, I saw that the insert and delete options were grayed out. I attempted to copy a different row and insert it as a new row, but I got the error message: "This operation is not allowed. The operation is attempting to shift cells in a table on your worksheet." I have not merged or hidden any cells/rows/columns. There are no formulas. There is no data verification. I tried closing and re-opening the spreadsheet. Searching for answers brings up nothing useful.

    Read the article

  • How to link data in different worksheets

    - by user2961726
    I tried consolidation but I can not get the following to work as it keeps saying no data consolidated. Can somebody try this dummy application and if they figure out how to do the following below can give me a step by step guide so I can attempt myself to learn. I'm not sure if I need to use any coding for this: In the dummy application I have 2 worksheets. One known as "1st", the other "Cases". In the "1st" worksheet you can insert and delete records for the "Case" table at the bottom, what I want to do is insert a row into the Case Table in worksheet "1st" and enter in the data for that row. What should happen is that data should be automatically be updated in the table in the "Cases" worksheet. But I can't seem to get this to work. Also if I delete a row from the table in Worksheet "1st" it should automatically remove that record from the "Cases" worksheet table. Please help. Below is the spreadsheet: http://ge.tt/8sjdkVx/v/0

    Read the article

  • Repeat the csv header twice without "Append" (PowerShell 1.0)

    - by Mark
    I have prepared a PowerShell script to export a list of system users in CSV format. The script can output the users list with Export-csv with single header row (the header row at top). However my requirement is to repeat the header row twice in my file. It is easy to achieve in PowerShell 3.0 with "Append" (e.g. $header | out-file $filepath -Append) Our server envirnoment is running PowerShell 1.0. Hence I cannot do it. Is there any workaround? I cannot manually add it myself. Thank you.

    Read the article

  • Convert text to table

    - by Quattro
    I would like convert text into a table. Here is a link to the text http://www.tcdb.org/public/tcdb Short example: >gnl|TC-DB|A0CIB0|1.A.17.3.1 Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1 MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI >gnl|TC-DB|A0CS82|9.B.82.1.5 Chromosome undetermined scaffold_26, whole genome shotgun sequence - Paramecium tetraurelia. MIIEEQIEEKMIYKAIHRVKVNYQKKIDRYILYKKSRWFFNLLLMLLYAYRIQNIGGFYI VTYIYCVYQLQLLIDYFTPLGLPPVNLEDEEEDDDQFQNDFSELPTTLSNKNELNDKEFR PLLRTTSEFKVWQKSVFSVIFAYFCTYIPIWDIPVYWPFLFCYFFVIVGMSIRKYIKHMK KYGYTILDFTKKK I wanted to have columns for example delimited with pipe | or ; |>gnl|TC-DB|A0CIB0|1.A.17.3.1| Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1| MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI I am working with Windows and I don't know how to do it I just know every row starts with > I want to substitute the first whitespace in a row with a delimiter like | or ; after the first regular expression new line in a row, I want also a delimiter everything between the regular expression first new line and > should go into a new column (it's a sequence of a protein)

    Read the article

  • Hide/Unhide rows based on more than one cell value

    - by Mike
    Please help me I am using the following code to hide rows if cell values are 0: Private Sub Worksheet_Calculate() Dim LastRow As Long, c As Range Application.EnableEvents = False LastRow = Cells(Cells.Rows.Count, "I").End(xlUp).Row On Error Resume Next For Each c In Range("I9:I48") If c.Value = 0 Then c.EntireRow.Hidden = True ElseIf c.Value > 0 Then c.EntireRow.Hidden = False End If Next On Error GoTo 0 Application.EnableEvents = True End Sub It works perfectly, but I would like for the code to also check column K (the same range K9:K48) if both cells in a row are 0 then the row must be hidden. How can I change the code to do this?

    Read the article

  • C# Bind DataTable to Existing DataGridView Column Definitions

    - by Timothy
    I've been struggling with a NullReferenceException and hope someone here will be able to point me in the right direction. I'm trying to create and populate a DataTable and then show the results in a DataGridView control. The basic code follows, and Execution stops with a NullReferenceException at the point where I invoke the new UpdateResults_Delegate. Oddly enough, I can trace entries.Rows.Count successfully before I return it from QueryEventEntries, so I can at least show 1) entries is not a null reference, and 2) the DataTable contains rows of data. I know I have to be doing something wrong, but I just don't know what. private void UpdateResults(DataTable entries) { dataGridView.DataSource = entries; } private void button_Click(object sender, EventArgs e) { PerformQuery(); } private void PerformQuery() { DateTime start = new DateTime(dateTimePicker1.Value.Year, dateTimePicker1.Value.Month, dateTimePicker1.Value.Day, 0, 0, 0); DateTime stop = new DateTime(dateTimePicker2.Value.Year, dateTimePicker2.Value.Month, dateTimePicker2.Value.Day, 0, 0, 0); DataTable entries = QueryEventEntries(start, stop); UpdateResults(entries); } private DataTable QueryEventEntries(DateTime start, DateTime stop) { DataTable entries = new DataTable(); entries.Columns.AddRange(new DataColumn[] { new DataColumn("event_type", typeof(Int32)), new DataColumn("event_time", typeof(DateTime)), new DataColumn("event_detail", typeof(String))}); using (SqlConnection conn = new SqlConnection(DSN)) { using (SqlDataAdapter adapter = new SqlDataAdapter( "SELECT event_type, event_time, event_detail FROM event_log " + "WHERE event_time >= @start AND event_time <= @stop", conn)) { adapter.SelectCommand.Parameters.AddRange(new Object[] { new SqlParameter("@start", start), new SqlParameter("@stop", stop)}); adapter.Fill(entries); } } return entries; } Update I'd like to summarize and provide some additional information I've learned from the discussion here and debugging efforts since I originally posted this question. I am refactoring old code that retrieved records from a database, collected those records as an array, and then later iterated through the array to populate a DataGridView row by row. Threading was originally implemented to compensate and keep the UI responsive during the unnecessary looping. I have since stripped out Thread/Invoke; everything now occurs on the same execution thread (thank you, Sam). I am attempting to replace the slow, unwieldy approach using a DataTable which I can fill with a DataAdapter, and assign to the DataGridView through it's DataSource property (above code updated). I've iterated through the entries DataTable's rows to verify the table contains the expected data before assigning it as the DataGridView's DataSource. foreach (DataRow row in entries.Rows) { System.Diagnostics.Trace.WriteLine( String.Format("{0} {1} {2}", row[0], row[1], row[2])); } One of the column of the DataGridView is a custom DataGridViewColumn to stylize the event_type value. I apologize I didn't mention this before in the original post but I wasn't aware it was important to my problem. I have converted this column temporarily to a standard DataGridViewTextBoxColumn control and am no longer experiencing the Exception. The fields in the DataTable are appended to the list of fields that have been pre-specified in Design view of the DataGridView. The records' values are being populated in these appended fields. When the run time attempts to render the cell a null value is provided (as the value that should be rendered is done so a couple columns over). In light of this, I am re-titling and re-tagging the question. I would still appreciate it if others who have experienced this can instruct me on how to go about binding the DataTable to the existing column definitions of the DataGridView.

    Read the article

< Previous Page | 141 142 143 144 145 146 147 148 149 150 151 152  | Next Page >