Search Results

Search found 9156 results on 367 pages for 'partial match'.

Page 15/367 | < Previous Page | 11 12 13 14 15 16 17 18 19 20 21 22  | Next Page >

  • Error when rendering a partial (RoR) passing the form as a local variable

    - by Dmitriy Likhten
    In my main template I have the following: <%= render :partial => "delivery_date", :collection => @brand.delivery_dates, :locals => {:form => f} %> However when the partial tries to use the form local variable, I get this error Showing app/views/brands/_delivery_date.html.erb where line #2 raised: wrong number of arguments (0 for 1) Extracted source (around line #2): 1: <%= delivery_date.id %> 2: <%= form.text_field :name %> 3: <% new_or_existing = delivery_date.new_record? ? 'new' : 'existing' %> 4: <% prefix = "brand[#{new_or_existing}_delivery_date_attributes][]" %> 5: <% fields_for prefix, delivery_date do |dd_f| %> Does anyone understand what this error means? Actually I want to do <% form.fields_for delivery_date do |dd_f| %> but that fails as well.

    Read the article

  • asp.net mvc 2 multiple partial view

    - by 303
    Hey Guys, I have a contoller that renders 3 different views. But I also have a common part (div) for every view. I thought that I can create an UserControl with own controller and include that control on my views (New controller and view as controll). How should I use that UserControl? Should it be a partial view? Or different approach - can I have multiple partial views on one page? I've been searching the web for the last view days and haven't found working solution that suits me. Also I want to use Strongly Typed views/data. Cheers

    Read the article

  • rsync --remove-source-files but only those that match a pattern

    - by user28146
    Is this possible with rsync? Transfer everything from src:path/to/dir to dest:/path/to/other/dir and delete some of the source files in src:path/to/dir that match a pattern (or size limit) but keep all other files. I couldn't find a way to limit --remove-source-files with a regexp or size limit. Update1 (clarification): I'd like all files in src:path/to/dir to be copied to dest:/path/to/other/dir. Once this is done, I'd like to have some files (those that match a regexp or size limit) in src:path/to/dir deleted but don't want to have anything deleted in dest:/path/to/other/dir. Update2 (more clarification): Unfortunately, I can't simply rsync everything and then manually delete the files matching my regexp from src:. The files to be deleted are continuously created. So let's say there are N files of the type I'd like to delete after the transfer in src: when rsync starts. By the time rsync finishes there will be N+M such files there. If I now delete them manually, I'll lose the M files that were created while rsync was running. Hence I'd like to have a solution that guarantees that the only files deleted from src: are those known to be successfully copied over to dest:. I could fetch a file list from dest: after the rsync is complete, and compare that list of files with what I have in src:, and then do the removal manually. But I was wondering if rsync can do this by itself.

    Read the article

  • Using perl's Regexp::Grammars, how do I make a capture dependent on $MATCH?

    - by Evan Carroll
    I've got a token like such: <delim2=((?{ $MATCH{delim} }))> and what I want to happen is for delim2 to capture and be set to the value of delim. When I run this, delim2 is set, but the capture is never done. I think this is an error in my reasoning: I'm trying to chain this form: <ALIAS= ( PATTERN )> Match pattern, save match in $MATCH{ALIAS} and this form: (?{ MATCH{delim} }) into something like this <ALIAS= ( (?{MATCH{delim}) )> Matches the value of $MATCH{delim} save to $MATCH{delim2} but this simply doesn't seem valid. I can verify my original token works <delim2=((?{ die $MATCH{delim} }))> will die with the value, and, if I hard code it, I get the right capture and everything works <delim2=(')>? So how do I go about achieving sane results, while having a dynamic pattern?

    Read the article

  • Upgrade problem - "dependency problems prevent configuration of libnih-dbus1"

    - by raycho
    I have a problem with the upgrading.... When i write sudo dpkg --configure -a , this is what happens... : dependency problems prevent configuration of libnih-dbus1: libnih-dbus1 depends on libnih1 (= 1.0.3-4ubuntu9); however: Version of libnih1 on system is 1.0.3-4ubuntu2. libnih-dbus1 depends on libc6 (>= 2.3.4); however: Package libc6 is not installed. dpkg: error processing libnih-dbus1 (--configure): dependency problems - leaving unconfigured Errors were encountered while processing: libnih-dbus1 Please help

    Read the article

  • Bug in Delphi XE RegularExpressions Unit

    - by Jan Goyvaerts
    Using the new RegularExpressions unit in Delphi XE, you can iterate over all the matches that a regex finds in a string like this: procedure TForm1.Button1Click(Sender: TObject); var RegEx: TRegEx; Match: TMatch; begin RegEx := TRegex.Create('\w+'); Match := RegEx.Match('One two three four'); while Match.Success do begin Memo1.Lines.Add(Match.Value); Match := Match.NextMatch; end end; Or you could save yourself two lines of code by using the static TRegEx.Match call: procedure TForm1.Button2Click(Sender: TObject); var Match: TMatch; begin Match := TRegEx.Match('One two three four', '\w+'); while Match.Success do begin Memo1.Lines.Add(Match.Value); Match := Match.NextMatch; end end; Unfortunately, due to a bug in the RegularExpressions unit, the static call doesn’t work. Depending on your exact code, you may get fewer matches or blank matches than you should, or your application may crash with an access violation. The RegularExpressions unit defines TRegEx and TMatch as records. That way you don’t have to explicitly create and destroy them. Internally, TRegEx uses TPerlRegEx to do the heavy lifting. TPerlRegEx is a class that needs to be created and destroyed like any other class. If you look at the TRegEx source code, you’ll notice that it uses an interface to destroy the TPerlRegEx instance when TRegEx goes out of scope. Interfaces are reference counted in Delphi, making them usable for automatic memory management. The bug is that TMatch and TGroupCollection also need the TPerlRegEx instance to do their work. TRegEx passes its TPerlRegEx instance to TMatch and TGroupCollection, but it does not pass the instance of the interface that is responsible for destroying TPerlRegEx. This is not a problem in our first code sample. TRegEx stays in scope until we’re done with TMatch. The interface is destroyed when Button1Click exits. In the second code sample, the static TRegEx.Match call creates a local variable of type TRegEx. This local variable goes out of scope when TRegEx.Match returns. Thus the reference count on the interface reaches zero and TPerlRegEx is destroyed when TRegEx.Match returns. When we call MatchAgain the TMatch record tries to use a TPerlRegEx instance that has already been destroyed. To fix this bug, delete or rename the two RegularExpressions.dcu files and copy RegularExpressions.pas into your source code folder. Make these changes to both the TMatch and TGroupCollection records in this unit: Declare FNotifier: IInterface; in the private section. Add the parameter ANotifier: IInterface; to the Create constructor. Assign FNotifier := ANotifier; in the constructor’s implementation. You also need to add the ANotifier: IInterface; parameter to the TMatchCollection.Create constructor. Now try to compile some code that uses the RegularExpressions unit. The compiler will flag all calls to TMatch.Create, TGroupCollection.Create and TMatchCollection.Create. Fix them by adding the ANotifier or FNotifier parameter, depending on whether ARegEx or FRegEx is being passed. With these fixes, the TPerlRegEx instance won’t be destroyed until the last TRegEx, TMatch, or TGroupCollection that uses it goes out of scope or is used with a different regular expression.

    Read the article

  • How to restart upgrade (from 11.04 to 12.04)

    - by Konoppo
    Yesterday I was making upgrade (from 11.04 to 12.04) when I have got power failure. I don't known where the installer was, because I wasn't in the front of computer at that moment. After restart Ubuntu started to version 12.04 and everything looks OK. But - I'm not sure if everything was installed correctly? How can I check it or how can I "restart" my automatic upgrade tool to do everything again and "to the end"? Some more infomations: lsb_release -a: No LSB modules are available. Distributor ID: Ubuntu Description: Ubuntu 12.04 LTS Release: 12.04 Codename: precise uname -r: 3.2.0-24-generic apt-get found five updates: linux-headers-3.2.0-24 linux-headers-3.2.0-24-generic linux-image-3.2.0-24-generic linux-libc-dev ubuntu-docs unity-scope-musicstores

    Read the article

  • GLIBC_2.8 not found

    - by Thomas Nilsson
    As a newbie I seem to have messed up my upgrade leaving my system in a very unstable state. I attempted an upgrade from 8.04LTS which ended in an error about libc and kernel upgrades. I tried to upgrade the kernel but am now unsure if that worked, because when I retried my dist-upgrade there was a lot of errors about pre-dependencies and leaving packages un-configured. Now I have a system that answers almost every command with: /lib/libc.so.6: version `GLIBC_2.8' not found (required by /lib/libselinux.so.1) I probably should try a complete re-installation, but I'm investigating if there is any possibility of getting a working glibc so that I at least can have some commands working to ensure that my backups are recent etc. before doing the clean install. not even 'ls' works without saying "glibc_2.8 not found".

    Read the article

  • What to do when 'dpkg --configure -a' fails with too many errors?

    - by rudivonstaden
    During an upgrade from lucid (10.04) to precise (12.04), the X session froze, and I have been trying to recover the upgrade to get a stable system. I have performed the following steps: Used ssh to log in to the stalled system over the network. Checked the contents of the /var/log/dist-upgrade directory. There was no activity on main.log, apt.log or term.log. top showed that process 'precise' was using about 3% CPU, but I could find no evidence that the upgrade process was still doing anything. 'dpkg' did not show up in top, but it came up with pgrep dpkg | xargs ps Killed the 'dpkg' and 'precise' processes Tried to recover the upgrade by running sudo fuser -vki /var/lib/dpkg/lock;sudo dpkg --configure -a. This was partially successful (some packages were configured), but failed with the message Processing was halted because there were too many errors. I ran the same command a few times, and each time some packages were configured but others failed. Tried running sudo apt-get -f install. It fails with similar errors to dpkg. The current situation is that dpkg --configure -a and sudo apt-get -f install fails with two kinds of error: Dependency issues, e.g.: dpkg: dependency problems prevent configuration of cifs-utils: cifs-utils depends on samba-common; however: Package samba-common is not configured yet. dpkg: error processing cifs-utils (--configure): dependency problems - leaving unconfigured Resource conflict, e.g.: debconf: DbDriver "config": /var/cache/debconf/config.dat is locked by another process: Resource temporarily unavailable Additionally, it seems there's reference to potential boot problems, so I'm not keen to reboot without fixing the install first: dpkg: too many errors, stopping Processing triggers for initramfs-tools ... update-initramfs: Generating /boot/initrd.img-3.2.0-25-generic cryptsetup: WARNING: failed to detect canonical device of /dev/sda1 cryptsetup: WARNING: could not determine root device from /etc/fstab So my question is, how to get a working install when dpkg --configure -a fails?

    Read the article

  • Installing g++ on 8.04

    - by mathematician1975
    I am running Ubuntu 8.04 (currently I do not have the option to upgrade due to hardware problems). I need to get g++ onto my installation but as this is no longer supported I am unable to use the traditional apt-get approach. What are my options? Are ubuntu packages configured specifically for each version? For example could I manually download a later version of gcc and g++ that do not originally ship with 8.04 (say the 10.04 version for example) and build them from scratch? Do the compilers work in this way in the sense that they have a version PER ubuntu version or are they maintained as separate entities?? I do not know enough about ubuntu internals really and always use apt-get to obtain/update any packages I need. If it is possible to do it this way is there a way to be certain that I have everything I need with regards to utility packages needed by g++ for the installation??

    Read the article

  • Address Match Key Algorithm

    - by sestocker
    I have a list of addresses in two separate tables that are slightly off that I need to be able to match. For example, the same address can be entered in multiple ways: 110 Test St 110 Test St. 110 Test Street Although simple, you can imagine the situation in more complex scenerios. I am trying to develop a simple algorithm that will be able to match the above addresses as a key. For example. the key might be "11TEST" - first two of 110, first two of Test and first two of street variant. A full match key would also include first 5 of the zipcode as well so in the above example, the full key might look like "11TEST44680". I am looking for ideas for an effective algorithm or resources I can look at for considerations when developing this. Any ideas can be pseudo code or in your language of choice. We are only concerned with US addresses. In fact, we are only looking at addresses from 250 zip codes from Ohio and Michigan. We also do not have access to any postal software although would be open to ideas for cost effective solutions (it would essentially be a one time use). Please be mindful that this is an initial dump of data from a government source so suggestions of how users can clean it are helpful as I build out the application but I would love to have the best initial I possibly can by being able to match addresses as best as possible.

    Read the article

  • C# Regex - Match and replace, Auto Increment

    - by Marc Still
    I have been toiling with a problem and any help would be appreciated. Problem: I have a paragraph and I want to replace a variable which appears several times (Variable = @Variable). This is the easy part, but the portion which I am having difficulty is trying to replace the variable with different values. I need for each occurrence to have a different value. For instance, I have a function that does a calculation for each variable. What I have thus far is below: private string SetVariables(string input, string pattern){ Regex rx = new Regex(pattern); MatchCollection matches = rx.Matches(input); int i = 1; if(matches.Count > 0) { foreach(Match match in matches) { rx.Replace(match.ToString(), getReplacementNumber(i)); i++ } } I am able to replace each variable that I need to with the number returned from getReplacementNumber(i) function, but how to I put it back into my original input with the replaced values, in the same order found in the match collection? Thanks in advance! Marcus

    Read the article

  • Match subpatterns in any order

    - by Yaroslav
    I have long regexp with two complicated subpatters inside. How i can match that subpatterns in any order? Simplified example: /(apple)?\s?(banana)?\s?(orange)?\s?(kiwi)?/ and i want to match both of apple banana orange kiwi apple orange banana kiwi It is very simplified example. In my case banana and orange is long complicated subpatterns and i don't want to do something like /(apple)?\s?((banana)?\s?(orange)?|(orange)?\s?(banana)?)\s?(kiwi)?/ Is it possible to group subpatterns like chars in character class? UPD Real data as requested: 14:24 26,37 Mb 108.53 01:19:02 06.07 24.39 19:39 46:00 my strings much longer, but it is significant part. Here you can see two lines what i need to match. First has two values: length (14 min 24 sec) and size 26.37 Mb. Second one has three values but in different order: size 108.53 Mb, length 01 h 19 m 02 s and date June, 07 Third one has two size and length Fourth has only length There are couple more variations and i need to parse all values. I have a regexp that pretty close except i can't figure out how to match patterns in different order without writing it twice. (?<size>\d{1,3}\[.,]\d{1,2}\s+(?:Mb)?)?\s? (?<length>(?:(?:01:)?\d{1,2}:\d{2}))?\s* (?<date>\d{2}\.\d{2}))? NOTE: that is only part of big regexp that forks fine already.

    Read the article

  • MySQL "OR MATCH" hangs (very slow) on multiple tables

    - by Kerry
    After learning how to do MySQL Full-Text search, the recommended solution for multiple tables was OR MATCH and then do the other database call. You can see that in my query below. When I do this, it just gets stuck in a "busy" state, and I can't access the MySQL database. SELECT a.`product_id`, a.`name`, a.`slug`, a.`description`, b.`list_price`, b.`price`, c.`image`, c.`swatch`, e.`name` AS industry, MATCH( a.`name`, a.`sku`, a.`description` ) AGAINST ( '%s' IN BOOLEAN MODE ) AS relevance FROM `products` AS a LEFT JOIN `website_products` AS b ON (a.`product_id` = b.`product_id`) LEFT JOIN ( SELECT `product_id`, `image`, `swatch` FROM `product_images` WHERE `sequence` = 0) AS c ON (a.`product_id` = c.`product_id`) LEFT JOIN `brands` AS d ON (a.`brand_id` = d.`brand_id`) INNER JOIN `industries` AS e ON (a.`industry_id` = e.`industry_id`) WHERE b.`website_id` = %d AND b.`status` = %d AND b.`active` = %d AND MATCH( a.`name`, a.`sku`, a.`description` ) AGAINST ( '%s' IN BOOLEAN MODE ) OR MATCH ( d.`name` ) AGAINST ( '%s' IN BOOLEAN MODE ) GROUP BY a.`product_id` ORDER BY relevance DESC LIMIT 0, 9 Any help would be greatly appreciated. EDIT All the tables involved are MyISAM, utf8_general_ci. Here's the EXPLAIN SELECT statement: id select_type table type possible_keys key key_len ref rows Extra 1 PRIMARY a ALL NULL NULL NULL NULL 16076 Using temporary; Using filesort 1 PRIMARY b ref product_id product_id 4 database.a.product_id 2 1 PRIMARY e eq_ref PRIMARY PRIMARY 4 database.a.industry_id 1 1 PRIMARY <derived2> ALL NULL NULL NULL NULL 23261 1 PRIMARY d eq_ref PRIMARY PRIMARY 4 database.a.brand_id 1 Using where 2 DERIVED product_images ALL NULL NULL NULL NULL 25933 Using where I don't know how to make that look neater -- sorry about that UPDATE it returns the query after 196 seconds (I think correctly). The query without multiple tables takes about .56 seconds (which I know is really slow, we plan on changing to solr or sphinx soon), but 196 seconds?? If we could add a number to the relevance if it was in the brand name ( d.name ), that would also work

    Read the article

  • xsl:template match doesn't find matches

    - by dmo
    I'm trying to convert some Xaml to HTML using the .NET XslCompiledTransform and am running into difficulties getting the xslt to match Xaml tags. For instance with this Xaml input: <FlowDocument PagePadding="5,0,5,0" AllowDrop="True" NumberSubstitution.CultureSource="User" xmlns="http://schemas.microsoft.com/winfx/2006/xaml/presentation"> <Paragraph>a</Paragraph> </FlowDocument> And this xslt: <?xml version="1.0" encoding="utf-8"?> <xsl:stylesheet version="1.0" xmlns:xsl="http://www.w3.org/1999/XSL/Transform" xmlns:msxsl="urn:schemas-microsoft-com:xslt" exclude-result-prefixes="msxsl" > <xsl:output method="html" indent="yes"/> <xsl:template match="/"> <html> <body> <xsl:apply-templates /> </body> </html> </xsl:template> <xsl:template match="FlowDocument"> <xsl:apply-templates /> </xsl:template> <xsl:template match="Paragraph" > <p> <xsl:apply-templates /> </p> </xsl:template> I get this output: <html> <body> a </body> </html> Rather than the expected: <html> <body> <p>a</p> </body> </html> Could this be a problem with the namespace? This is my first attempt at an xsl transform, so I'm at a loss.

    Read the article

  • Match Hard Disk Partition Table?

    - by MA1
    What is the most efficient way to match the partition tables on two different hard disks? I have saved the partition tables using dd command in linux. The partition tables are from a Windows system.

    Read the article

  • Match Hard Dusk Partition Table?

    - by MA1
    Hi All What is the efficient way to match the two different hard disk partition tables? I have save the partition tables using dd command in linux. The partition tables are from Windows system. Regards,

    Read the article

  • Compare 2 sets of data in Excel and returning a value when multiple columns match

    - by Susan C
    I have a data set for employees that contains name and 3 attributes (job function, job grade and location). I then have a data set for open positions that contains the requisition number and 3 attributes (job function, job grade and job location). For every employee, i would like the three attributes associated with them compared to the same three attributes of the open positions and have the cooresponding requisition numbers displayed for each employee where there is a match.

    Read the article

  • Iptables rule creation error: No chain/target/match by that name

    - by MikO
    I'm trying to create my first VPN on a VPS with CentOS 6, following this tutorial. When I have to create an iptables rule to allow proper routing of VPN subnet, with this command: iptables -t nat -A POSTROUTING -s 10.8.0.0/24 -o eth0 -j MASQUERADE It throws this error: iptables: No chain/target/match by that name I was searching and I've found that this error is usually thrown when you misspell something, but as far as I understand, the rule is correct...

    Read the article

  • PHP ssh2_fingerprint() does not match ssh-keygen -lf id_rsa.pub

    - by Justin
    I am using the lib ssh2 module with PHP and calling the function ssh2_fingerprint() to get the keys fingerprint. According to all resources on the internet, I can get the fingerprint of a public key by executing: ssh-keygen -lf id_rsa.pub Which outputs something like: 2048 d4:41:3b:45:00:49:4e:fc:2c:9d:3a:f7:e6:6e:bf:e7 id_rsa.pub (RSA) However, when I call ssh2_fingerprint($connection, SSH2_FINGERPRINT_HEX) in PHP with the same public key I get: dddddba52352e5ab95711c10fdd56f43 Shouldn't they match? What am I missing?

    Read the article

  • How to match against multiple value possiblities in Excel

    - by Henno
    I have list of person names in column A. I want to display "1" in column B for names which end with either "e" or "i" or "n". If there would be only one match to test against, I would write something like: =IF( MID(A1,FIND(" ",B1)-1,1) = "e", "1", "0") In PHP I would solve that like this: echo in_array( $names[$row_number], array('e', 'i', 'n') ) ? '1' : '0'; What formula should I use in column B in Excel?

    Read the article

  • MySQL Full Text Search Boolean Mode Partial Match

    - by Rob
    I've found boolean mode of MySQL full text search useful, however there are a couple of things I can't seem to figure out how to achieve. For instance imagine I have a full text column containing the words "Steve's Javascript Tutorial - Part One". I would like to match this for each of the following searches: "tutorials", "javascript tutorials", "java", "java script", "script" Imagine that each of those searches is simply assigned to a variable in whatever language may be being used (I always use PHP). How could I modify this to make sure that Steve's article is returned on each of those searches? MATCH (article_title) AGAINST ('"+$variable+"*' IN BOOLEAN MODE)

    Read the article

  • sed or grep or awk to match very very long lines

    - by yael
    more file param1=" 1,deerfntjefnerjfntrjgntrjnvgrvgrtbvggfrjbntr*rfr4fv*frfftrjgtrignmtignmtyightygjn 2,3,4,5,6,7,8, rfcmckmfdkckemdio8u548384omxc,mor0ckofcmineucfhcbdjcnedjcnywedpeodl40fcrcmkedmrikmckffmcrffmrfrifmtrifmrifvysdfn" need to match the content of $param1 in the file but its not work for example sed -n "/$param1/p" file or any grep $param1 file etc... any other solutions? maybe with perl?

    Read the article

< Previous Page | 11 12 13 14 15 16 17 18 19 20 21 22  | Next Page >