Search Results

Search found 9271 results on 371 pages for 'whole foods'.

Page 15/371 | < Previous Page | 11 12 13 14 15 16 17 18 19 20 21 22  | Next Page >

  • Window controls missing; Cannot maximise or minimize applications

    - by omg_scout
    Ubuntu 12.10 32 bits, fresh installation. How can I make Unity maximize or minimize a window? I see no button,option, anything, do I miss something big? Quick googling did not give me a piece of answer, too: On first screen, I have a terminal window. Only clue about maximizing it I found was pressing F11 which made it fullscreen, hiding left bar as well. I would prefer it to take whole free space instead of whole screen. How can I do that? On second screen, I have an opera browser which takes bigger part of the screen but I can't make it take whole screen. Restarting opera did not work. How do I minimize/maximize apps? Also, in case I would like to see the desktop, only solution I found was closing everything Help guys. I kind of like new GUI, but I can't have simplest tasks done there, I feel like I miss something big there.

    Read the article

  • css - use universal '*' selector vs. html or body selector?

    - by Michael Durrant
    Applying styles to the body tag will be applied to the whole page, so body { font-family: Verdana } will be applied to the whole page. This could also be done with * {font-family: Verdana} which would apply to all elements and so would seem to have the same effect. I understand the principle that in the first instance the style is being applied to one tag, body for the whole page whereas in the second example the font is being applied against each individual html elements. What I am asking is what is the practical difference in doing that, what are the implications and what is a reason, situation or best practice that leads to using one over another. One side-effect is certainly speed (+1 Rob). I am most interested in the actual reason to choose one over the other in terms of functionality.

    Read the article

  • Not assigning Bugs to a specific user

    - by user2977817
    My question: Is there a benefit to NOT assigning a Bug to a particular developer? Leaving it to the team as-a-whole? Our department has decided to be more Agile by not assigning Bugs/Defects to individuals. Using Team Foundation Server 2012, we'll place all Bugs in a development team's "Area" but leave the "Assigned To" field blank. The idea is that the team will create a Task work item which will be assigned to an individual and the Task will link to the Bug. The Team as a whole will therefore take responsibility for the Bug, not an individual, aligning to Scrum - apparently. I see the down side. The reporting tools built into TFS become less useful when you cannot sort by assigned vs unassigned, let alone sorting by which user Bugs are assigned. Is there a benefit I'm not seeing? Besides encouraging teamwork by putting the responsibility on the team-as-a-whole instead of an individual?

    Read the article

  • Do I need to do an "apt-get update" after adding a PPA?

    - by Sat93
    After adding a new ppa to the repository, is it necessary to update the whole database? By "whole database" I mean is it necessary to update index's of each and every packege? If it's not necessary, then how can I update only that specific package whose ppa I have just added into the repository. For example, if I add an ppa by typing the following in terminal, sudo add-apt-repository ppa:tiheum/equinox then we normally run the following command after it, sudo apt-get update But how can I update the only package which is associated with the above ppa, instead of updating the whole database.

    Read the article

  • Customizing UIPickerView in xcode

    - by Srinivas G
    Hi, I developed an application which consists of UIPickerView....It displays as default size in height of the UIPickerView.I want to display the UIPickerView as 320x480 size(iphone simulator size)..so the whole screen has the picker view without using transorm property,because it will stretched the whole view....its not looking good...even with selection indicator also stretched...I need not stretchable picker view..but need to show the picker view with the whole screen..We can control the width of the UIPickerView..But how can we control the height of the UIPickerView..... Thanks & Regards...

    Read the article

  • Ruby Programming Techniques: simple yet not so simple object manipulation

    - by Shyam
    Hi, I want to create an object, let's say a Pie. class Pie def initialize(name, flavor) @name = name @flavor = flavor end end But a Pie can be divided in 8 pieces, a half or just a whole Pie. For the sake of argument, I would like to know how I could give each Pie object a price per 1/8, 1/4 or per whole. I could do this by doing: class Pie def initialize(name, flavor, price_all, price_half, price_piece) @name = name @flavor = flavor @price_all = price_all @price_half = price_half @price_piece = price_piece end end But now, if I would create fifteen Pie objects, and I would take out randomly some pieces somewhere by using a method such as getPieceOfPie(pie_name) How would I be able to generate the value of all the available pies that are whole and the remaining pieces? Eventually using a method such as: myCurrentInventoryHas(pie_name) # output: 2 whole strawberry pies and 7 pieces. I know, I am a Ruby nuby. Thank you for your answers, comments and help!

    Read the article

  • ASP.NET AJAX Partial Rendering

    - by AJ
    Hello, I have a question about how ASP.NET AJAX partial rendering actually works. Does it: 1) Renders the whole page on the server, transmits the whole page to the client, the client then merges just the area contained in the update panel. 2) Renders the whole page on the server, transmits and merges just the area contained by the update panel. 3) Renders, transmits and merges just the area contained by the update panel. Thanks, AJ

    Read the article

  • Designing a database file format

    - by RoliSoft
    I would like to design my own database engine for educational purposes, for the time being. Designing a binary file format is not hard nor the question, I've done it in the past, but while designing a database file format, I have come across a very important question: How to handle the deletion of an item? So far, I've thought of the following two options: Each item will have a "deleted" bit which is set to 1 upon deletion. Pro: relatively fast. Con: potentially sensitive data will remain in the file. 0x00 out the whole item upon deletion. Pro: potentially sensitive data will be removed from the file. Con: relatively slow. Recreating the whole database. Pro: no empty blocks which makes the follow-up question void. Con: it's a really good idea to overwrite the whole 4 GB database file because a user corrected a typo. I will sell this method to Twitter ASAP! Now let's say you already have a few empty blocks in your database (deleted items). The follow-up question is how to handle the insertion of a new item? Append the item to the end of the file. Pro: fastest possible. Con: file will get huge because of all the empty blocks that remain because deleted items aren't actually deleted. Search for an empty block exactly the size of the one you're inserting. Pro: may get rid of some blocks. Con: you may end up scanning the whole file at each insert only to find out it's very unlikely to come across a perfectly fitting empty block. Find the first empty block which is equal or larger than the item you're inserting. Pro: you probably won't end up scanning the whole file, as you will find an empty block somewhere mid-way; this will keep the file size relatively low. Con: there will still be lots of leftover 0x00 bytes at the end of items which were inserted into bigger empty blocks than they are. Rigth now, I think the first deletion method and the last insertion method are probably the "best" mix, but they would still have their own small issues. Alternatively, the first insertion method and scheduled full database recreation. (Probably not a good idea when working with really large databases. Also, each small update in that method will clone the whole item to the end of the file, thus accelerating file growth at a potentially insane rate.) Unless there is a way of deleting/inserting blocks from/to the middle of the file in a file-system approved way, what's the best way to do this? More importantly, how do databases currently used in production usually handle this?

    Read the article

  • When does a PHP script end?

    - by allyourcode
    In my mind, a web app something that runs continuously; therefore, I'm confused by documentation pages that talk about the "end" of a PHP script (eg this one). Such references seem to refer to the end of each web request, but if the script ends there, doesn't that mean that the OS has to setup a whole new process for each request? That seems unlikely, because spinning up a whole new process is expensive, and be very inefficient for the whole site.

    Read the article

  • Sprite Animation in Android with OpenGL ES

    - by lijo john
    How to do a sprite animation in android using OpenGL ES? What i have done : Now I am able to draw a rectangle and apply my texture(Spritesheet) to it What I need to know : Now the rectangle shows the whole sprite sheet as a whole How to show a single action from sprite sheet at a time and make the animation It will be very help full if anyone can share any idea's , links to tutorials and suggestions. Advanced Thanks to All

    Read the article

  • Snap Spiffy Linux Screenshots with Shutter

    <b>LinuxPlanet:</b> "Paul Ferrill introduces us to the Shutter screen grab for Linux application. Shutter offers a simple interface and a whole lot of functionality. including cursor capture, whole Web page capture, and annotations."

    Read the article

  • Keeping the meshes "thickness" the same when scaling an object

    - by user1806687
    I've been bashing my head for the past couple of weeks trying to find a way to help me accomplish, on first look very easy task. So, I got this one object currently made out of 5 cuboids (2 sides, 1 top, 1 bottom, 1 back), this is just for an example, later on there will be whole range of different set ups. Now, the thing is when the user chooses to scale the whole object this is what should happen: X scale: top and bottom cuboids should get scaled by a scale factor, sides should get moved so they are positioned just like they were before(in this case at both ends of top and bottom cuboids), back should get scaled so it fits like before(if I simply scale it by a scale factor it will leave gaps on each side). Y scale: sides should get scaled by a scale factor, top and bottom cuboid should get moved, and back should also get scaled. Z scale: sides, top and bottom cuboids should get scaled, back should get moved. Hope you can help, EDIT: So, I've decided to explain the situation once more, this time more detailed(hopefully). I've also made some pictures of how the scaling should look like, where is the problem and the wrong way of scaling. I this example I will be using a thick walled box, with one face missing, where each wall is made by a cuboid(but later on there will be diffrent shapes of objects, where a one of the face might be roundish, or triangle or even under some angle), scaling will be 2x on X axis. 1.This is how the default object without any scaling applied looks like: http://img856.imageshack.us/img856/4293/defaulttz.png 2.If I scale the whole object(all of the meshes) by some scale factor, the problem becomes that the "thickness" of the object walls also change(which I do not want): http://img822.imageshack.us/img822/9073/wrongwaytoscale.png 3.This is how the correct scaling should look like. Appropriate faces gets caled in this case where the scale is on X axis(top, bottom, back): http://imageshack.us/photo/my-images/163/rightwayxscale1.png/ 4.But the scale factor might not be the same for all object all of the times. In this case the back has to get scaled a bit more or it leaves gaps: http://imageshack.us/photo/my-images/9/problemwhenscaling.png/ 5.If everything goes well this is how the final object should look like: http://imageshack.us/photo/my-images/856/rightwayxscale2.png/ So, as you have might noticed there are quite a bit of things to look out when scaling. I am asking you, if any of you have any idea on how to accomplish this scaling. I have tried whole bunch of things, from scaling all of the object by the same scale factor, to subtracting and adding sizes to get the right size. But nothing I tried worked, if one mesh got scaled correctly then others didnt. Donwload the example object. English is not my first language, so I am really sorry if its hard to understand what I am saying.

    Read the article

  • SDL libraries are missing

    - by user287570
    ~/vidmodel/wvsn-model-omnetpp-v4/geometry/Triangle.o ~/vidmodel/wvsn-model-omnetpp-v4/geometry/Polygon.o ~/vidmodel/wvsn-model-omnetpp-v4/geometry/triangulation.o -Wl,--no-as-needed -Wl,--whole-archive -lSDL -lpng -ljpeg -lz -lSDL_image -Wl,--no-whole-archive -L"/home/sreeram/omnetpp-4.2.2/lib/gcc" -L"/home/sreeram/omnetpp-4.2.2/lib" -loppmain -u _cmdenv_lib -Wl,--no-as-needed -loppcmdenv -loppenvir -loppsim -ldl -lstdc++ /usr/bin/ld: cannot find -lSDL /usr/bin/ld: cannot find -lpng /usr/bin/ld: cannot find -ljpeg /usr/bin/ld: cannot find -lSDL_image collect2: ld returned 1 exit can any one please help me

    Read the article

  • Getting the newest version of Ubuntu from 9.04

    - by user286985
    Okay so im new to this whole linux/ubuntu stuff. I need a step by step answer to how to get the newest version of ubuntu from my 9.04 version on my laptop. I was given this laptop as a gift and im still learning this step by step since i have been useing windows my whole life. I heard that i cant update since i have to go version to version so if someone could tell me how to just install the newest version while running 9.04. Thank you(:

    Read the article

  • LINQ-To-SQL and Mapping Table Deletions

    - by Jake
    I have a many-to-many relationship between two tables, let's say Friends and Foods. If a friend likes a food I stick a row into the FriendsFoods table, like this: ID Friend Food 1 'Tom' 'Pizza' FriendsFoods has a Primary Key 'ID', and two non-null foreign keys 'Friend' and 'Food' to the 'Friends' and 'Foods' tables, respectively. Now suppose I have a Friend tom .NET object corresponding to 'Tom', and Tom no longer likes pizza (what is wrong with him?) FriendsFoods ff = tblFriendsFoods.Where(x => x.Friend.Name == 'Tom' && x.Food.Name == 'Pizza').Single(); tom.FriendsFoods.Remove(ff); pizza.FriendsFoods.Remove(ff); If I try to SubmitChanges() on the DataContext, I get an exception because it attempts to insert a null into the Friend and Food columns in the FriendsFoods table. I'm sure I can put together some kind of convoluted logic to track changes to the FriendsFoods table, intercept SubmitChanges() calls, etc to try and get this to work the way I want, but is there a nice, clean way to remove a Many-To-Many relationship with LINQ-To-SQL?

    Read the article

  • Which Single Source Publishing tools and strategies are available?

    - by Another Registered User
    I'm about to write a 1000-Pages Documentation about a huge programming framework. The goal is to bring this documentation online into an web platform, so that online users can search through it and read it online. At the same time, the text has to be made public in PDF format for download. And at the same time, the whole thing needs to go into a printed book as well (print on demand, they want a giant PDF file with the whole book). The PDF files: The whole content is divided into several chapters. Every chapter will be available as a standalone PDF eBook. And finally, all chapters will be available in one huge printed book. Is LaTeX capable for something like that? Can it be used for Single Source Publishing? Or would I have to take a look at other technologies like DocBook, etc.?

    Read the article

  • forced reformat without login / and bootcamp

    - by debug
    ok.. im pretty good with stuff like this, but I have a question. I have mac mini with 10.5.(x) on one partition, and bootcamp (windows) on the other. My boss wants me to reformat the whole mac (10.6 (x)), which is usually easy. He does not remember his password to login, which means I cannot log in and allocate the bootcamp back to one partition using Disk Utility, then reformat the whole drive. When I insert the Snow leopard CD, I can only wipe out one partition, my question is: Is there a way to force a wipe out of both drives in the boot sequence? Any help to wipe out this whole drive and do a clean install would be helpful.. Thanks superusers!

    Read the article

  • How does MySQL 5.5 and InnoDB on Linux use RAM?

    - by Loren
    Does MySQL 5.5 InnoDB keep indexes in memory and tables on disk? Does it ever do it's own in-memory caching of part or whole tables? Or does it completely rely on the OS page cache (I'm guessing that it does since Facebook's SSD cache that was built for MySQL was done at the OS-level: https://github.com/facebook/flashcache/)? Does Linux by default use all of the available RAM for the page cache? So if RAM size exceeds table size + memory used by processes, then when MySQL server starts and reads the whole table for the first time it will be from disk, and from that point on the whole table is in RAM? So using Alchemy Database (SQL on top of Redis, everything always in RAM: http://code.google.com/p/alchemydatabase/) shouldn't be much faster than MySQL, given the same size RAM and database?

    Read the article

  • Command to see all Windows commands

    - by open_sourse
    When I type help in windows command line, it lists a whole bunch of commands. However I find that there is a whole set of commands that do not appear in this list, for e.g. many networking commands such as ping, tracert, arp, netstat, net etc. I am sure that there is also a whole bunch of non-networking command which is also not listed. So my question is this. Why are these additional commands not shown in help? Is there a subset/group of commands only that help shows? Is there any command/method to list all the commands that can be executed in windows? (I am not talking about additional .exes that get added to path when some new software is installed..)

    Read the article

  • Convert text to table

    - by Quattro
    I would like convert text into a table. Here is a link to the text http://www.tcdb.org/public/tcdb Short example: >gnl|TC-DB|A0CIB0|1.A.17.3.1 Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1 MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI >gnl|TC-DB|A0CS82|9.B.82.1.5 Chromosome undetermined scaffold_26, whole genome shotgun sequence - Paramecium tetraurelia. MIIEEQIEEKMIYKAIHRVKVNYQKKIDRYILYKKSRWFFNLLLMLLYAYRIQNIGGFYI VTYIYCVYQLQLLIDYFTPLGLPPVNLEDEEEDDDQFQNDFSELPTTLSNKNELNDKEFR PLLRTTSEFKVWQKSVFSVIFAYFCTYIPIWDIPVYWPFLFCYFFVIVGMSIRKYIKHMK KYGYTILDFTKKK I wanted to have columns for example delimited with pipe | or ; |>gnl|TC-DB|A0CIB0|1.A.17.3.1| Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1| MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI I am working with Windows and I don't know how to do it I just know every row starts with > I want to substitute the first whitespace in a row with a delimiter like | or ; after the first regular expression new line in a row, I want also a delimiter everything between the regular expression first new line and > should go into a new column (it's a sequence of a protein)

    Read the article

  • BizTalk: History of one project architecture

    - by Leonid Ganeline
    "In the beginning God made heaven and earth. Then he started to integrate." At the very start was the requirement: integrate two working systems. Small digging up: It was one system. It was good but IT guys want to change it to the new one, much better, chipper, more flexible, and more progressive in technologies, more suitable for the future, for the faster world and hungry competitors. One thing. One small, little thing. We cannot turn off the old system (call it A, because it was the first), turn on the new one (call it B, because it is second but not the last one). The A has a hundreds users all across a country, they must study B. A still has a lot nice custom features, home-made features that cannot disappear. These features have to be moved to the B and it is a long process, months and months of redevelopment. So, the decision was simple. Let’s move not jump, let’s both systems working side-by-side several months. In this time we could teach the users and move all custom A’s special functionality to B. That automatically means both systems should work side-by-side all these months and use the same data. Data in A and B must be in sync. That’s how the integration projects get birth. Moreover, the specific of the user tasks requires the both systems must be in sync in real-time. Nightly synchronization is not working, absolutely.   First draft The first draft seems simple. Both systems keep data in SQL databases. When data changes, the Create, Update, Delete operations performed on the data, and the sync process could be started. The obvious decision is to use triggers on tables. When we are talking about data, we are talking about several entities. For example, Orders and Items [in Orders]. We decided to use the BizTalk Server to synchronize systems. Why it was chosen is another story. Second draft   Let’s take an example how it works in more details. 1.       User creates a new entity in the A system. This fires an insert trigger on the entity table. Trigger has to pass the message “Entity created”. This message includes all attributes of the new entity, but I focused on the Id of this entity in the A system. Notation for this message is id.A. System A sends id.A to the BizTalk Server. 2.       BizTalk transforms id.A to the format of the system B. This is easiest part and I will not focus on this kind of transformations in the following text. The message on the picture is still id.A but it is in slightly different format, that’s why it is changing in color. BizTalk sends id.A to the system B. 3.       The system B creates the entity on its side. But it uses different id-s for entities, these id-s are id.B. System B saves id.A+id.B. System B sends the message id.A+id.B back to the BizTalk. 4.       BizTalk sends the message id.A+id.B to the system A. 5.       System A saves id.A+id.B. Why both id-s should be saved on both systems? It was one of the next requirements. Users of both systems have to know the systems are in sync or not in sync. Users working with the entity on the system A can see the id.B and use it to switch to the system B and work there with the copy of the same entity. The decision was to store the pairs of entity id-s on both sides. If there is only one id, the entities are not in sync yet (for the Create operation). Third draft Next problem was the reliability of the synchronization. The synchronizing process can be interrupted on each step, when message goes through the wires. It can be communication problem, timeout, temporary shutdown one of the systems, the second system cannot be synchronized by some internal reason. There were several potential problems that prevented from enclosing the whole synchronization process in one transaction. Decision was to restart the whole sync process if it was not finished (in case of the error). For this purpose was created an additional service. Let’s call it the Resync service. We still keep the id pairs in both systems, but only for the fast access not for the synchronization process. For the synchronizing these id-s now are kept in one main place, in the Resync service database. The Resync service keeps record as: ·       Id.A ·       Id.B ·       Entity.Type ·       Operation (Create, Update, Delete) ·       IsSyncStarted (true/false) ·       IsSyncFinished (true/false0 The example now looks like: 1.       System A creates id.A. id.A is saved on the A. Id.A is sent to the BizTalk. 2.       BizTalk sends id.A to the Resync and to the B. id.A is saved on the Resync. 3.       System B creates id.B. id.A+id.B are saved on the B. id.A+id.B are sent to the BizTalk. 4.       BizTalk sends id.A+id.B to the Resync and to the A. id.A+id.B are saved on the Resync. 5.       id.A+id.B are saved on the B. Resync changes the IsSyncStarted and IsSyncFinished flags accordingly. The Resync service implements three main methods: ·       Save (id.A, Entity.Type, Operation) ·       Save (id.A, id.B, Entity.Type, Operation) ·       Resync () Two Save() are used to save id-s to the service storage. See in the above example, in 2 and 4 steps. What about the Resync()? It is the method that finishes the interrupted synchronization processes. If Save() is started by the trigger event, the Resync() is working as an independent process. It periodically scans the Resync storage to find out “unfinished” records. Then it restarts the synchronization processes. It tries to synchronize them several times then gives up.     One more thing, both systems A and B must tolerate duplicates of one synchronizing process. Say on the step 3 the system B was not able to send id.A+id.B back. The Resync service must restart the synchronization process that will send the id.A to B second time. In this case system B must just send back again also created id.A+id.B pair without errors. That means “tolerate duplicates”. Fourth draft Next draft was created only because of the aesthetics. As it always happens, aesthetics gave significant performance gain to the whole system. First was the stupid question. Why do we need this additional service with special database? Can we just master the BizTalk to do something like this Resync() does? So the Resync orchestration is doing the same thing as the Resync service. It is started by the Id.A and finished by the id.A+id.B message. The first works as a Start message, the second works as a Finish message.     Here is a diagram the whole process without errors. It is pretty straightforward. The Resync orchestration is waiting for the Finish message specific period of time then resubmits the Id.A message. It resubmits the Id.A message specific number of times then gives up and gets suspended. It can be resubmitted then it starts the whole process again: waiting [, resubmitting [, get suspended]], finishing. Tuning up The Resync orchestration resubmits the id.A message with special “Resubmitted” flag. The subscription filter on the Resync orchestration includes predicate as (Resubmit_Flag != “Resubmitted”). That means only the first Sync orchestration starts the Resync orchestration. Other Sync orchestration instantiated by the resubmitting can finish this Resync orchestration but cannot start another instance of the Resync   Here is a diagram where system B was inaccessible for some period of time. The Resync orchestration resubmitted the id.A two times. Then system B got the response the id.A+id.B and this finished the Resync service execution. What is interesting about this, there were submitted several identical id.A messages and only one id.A+id.B message. Because of this, the system B and the Resync must tolerate the duplicate messages. We also told about this requirement for the system B. Now the same requirement is for the Resunc. Let’s assume the system B was very slow in the first response and the Resync service had time to resubmit two id.A messages. System B responded not, as it was in previous case, with one id.A+id.B but with two id.A+id.B messages. First of them finished the Resync execution for the id.A. What about the second id.A+id.B? Where it goes? So, we have to add one more internal requirement. The whole solution must tolerate many identical id.A+id.B messages. It is easy task with the BizTalk. I added the “SinkExtraMessages” subscriber (orchestration with one receive shape), that just get these messages and do nothing. Real design Real architecture is much more complex and interesting. In reality each system can submit several id.A almost simultaneously and completely unordered. There are not only the “Create entity” operation but the Update and Delete operations. And these operations relate each other. Say the Update operation after Delete means not the same as Update after Create. In reality there are entities related each other. Say the Order and Order Items. Change on one of it could start the series of the operations on another. Moreover, the system internals are the “black boxes” and we cannot predict the exact content and order of the operation series. It worth to say, I had to spend a time to manage the zombie message problems. The zombies are still here, but this is not a problem now. And this is another story. What is interesting in the last design? One orchestration works to help another to be more reliable. Why two orchestration design is more reliable, isn’t it something strange? The Synch orchestration takes all the message exchange between systems, here is the area where most of the errors could happen. The Resync orchestration sends and receives messages only within the BizTalk server. Is there another design? Sure. All Resync functionality could be implemented inside the Sync orchestration. Hey guys, some other ideas?

    Read the article

< Previous Page | 11 12 13 14 15 16 17 18 19 20 21 22  | Next Page >