Search Results

Search found 8800 results on 352 pages for 'import'.

Page 153/352 | < Previous Page | 149 150 151 152 153 154 155 156 157 158 159 160  | Next Page >

  • MySQLdb not INSERTING, _mysql does fine.

    - by Mad_Casual
    Okay, I log onto the MySQL command-line client as root. I then open or otherwise run a python app using the MySQLdb module as root. When I check the results using python (IDLE), everything looks fine. When I use the MySQL command-line client, no INSERT has occurred. If I change things around to _mysql instead of MySQLdb, everything works fine. I'd appreciate any clarification(s). "Works" until IDLE/Virtual machine is reset: <pre><code>import MySQLdb db = MySQLdb.connect(user='root', passwd='*******',db='test') cursor = db.cursor() cursor.execute("""INSERT INTO test VALUES ('somevalue');""",)</code></end> Works: <pre><code>import _mysql db = _mysql.connect(user='root', passwd='*******',db='test') db.query("INSERT INTO test VALUES ('somevalue');")</code></end> System info: Intel x86 WinXP Python 2.5 MySQL 5.1.41 MySQL-Python 1.2.2

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • fastest in-memory cache for XslCompiledTransform

    - by rudnev
    I have a set of xslt stylesheet files. I need to produce the fastest performance of XslConpiledTransform, so i want to make in-memory representation of these stylesheets. I can load them to in-memory collection as IXpathNavigable on application start, and then load each IXPAthNavigable into singleton XslCompiledTransform on each request. But this works only for styleshhets without xsl:import or xsl:include. (Xsl:import is only for files). also i can load into cache many instances of XSLCompiledTransform for each template. Is it reasonable? Are there other ways? What is the best? what are another tips for improving performance MS Xslt processor?

    Read the article

  • pyplot: really slow creating heatmaps

    - by cvondrick
    I have a loop that executes the body about 200 times. In each loop iteration, it does a sophisticated calculation, and then as debugging, I wish to produce a heatmap of a NxM matrix. But, generating this heatmap is unbearably slow and significantly slow downs an already slow algorithm. My code is along the lines: import numpy import matplotlib.pyplot as plt for i in range(200): matrix = complex_calculation() plt.set_cmap("gray") plt.imshow(matrix) plt.savefig("frame{0}.png".format(i)) The matrix, from numpy, is not huge --- 300 x 600 of doubles. Even if I do not save the figure and instead update an on-screen plot, it's even slower. Surely I must be abusing pyplot. (Matlab can do this, no problem.) How do I speed this up?

    Read the article

  • Java: conditional initialization?

    - by HH
    Ruby has conditional initialization. Apparently, Java does not or does it? I try to write more succintly, to limit the range as small as possible. import java.io.*; import java.util.*; public class InitFor{ public static void main(String[] args){ for(int i=7,k=999;i+((String h="hello").size())<10;i++){} System.out.println("It should be: hello = "+h); } } Errors Press ENTER or type command to continue InitFor.java:8: ')' expected for(int i=7,k=999;i+((String h="hello").size())<10;i++){} ^

    Read the article

  • Hadoop in a RESTful Java Web Application - Conflicting URI templates

    - by user1231583
    I have a small Java Web Application in which I am using Jersey 1.12 and the Hadoop 1.0.0 JAR file (hadoop-core-1.0.0.jar). When I deploy my application to my JBoss 5.0 server, the log file records the following error: SEVERE: Conflicting URI templates. The URI template / for root resource class org.apache.hadoop.hdfs.server.namenode.web.resources.NamenodeWebHdfsMethods and the URI template / transform to the same regular expression (/.*)? To make sure my code is not the problem, I have created a fresh web application that contains nothing but the Jersey and Hadoop JAR files along with a small stub. My web.xml is as follows: <?xml version="1.0" encoding="UTF-8"?> <web-app version="2.5" xmlns="http://java.sun.com/xml/ns/javaee" xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xsi:schemaLocation="http://java.sun.com/xml/ns/javaee http://java.sun.com/xml/ns/javaee/web-app_2_5.xsd"> <servlet> <servlet-name>ServletAdaptor</servlet-name> <servlet-class>com.sun.jersey.spi.container.servlet.ServletContainer</servlet- class> <load-on-startup>1</load-on-startup> </servlet> <servlet-mapping> <servlet-name>ServletAdaptor</servlet-name> <url-pattern>/mytest/*</url-pattern> </servlet-mapping> <session-config> <session-timeout> 30 </session-timeout> </session-config> <welcome-file-list> <welcome-file>index.jsp</welcome-file> </welcome-file-list> </web-app> My simple RESTful stub is as follows: import javax.ws.rs.core.Context; import javax.ws.rs.core.UriInfo; import javax.ws.rs.Path; @Path("/mytest") public class MyRest { @Context private UriInfo context; public MyRest() { } } In my regular application, when I remove the Hadoop JAR files (and the code that is using Hadoop), everything works as I would expect. The deployment is successful and the remaining RESTful services work. I have also tried the Hadoop 1.0.1 JAR files and have had the same problems with the conflicting URL template in the NamenodeWebHdfsMethods class. Any suggestions or tips in solving this problem would be greatly appreciated.

    Read the article

  • Identifying that a variable is a new-style class in Python?

    - by Dave Johansen
    I'm using Python 2.x and I'm wondering if there's a way to tell if a variable is a new-style class? I know that if it's an old-style class that I can do the following to find out. import types class oldclass: pass def test(): o = oldclass() if type(o) is types.InstanceType: print 'Is old-style' else: print 'Is NOT old-style' But I haven't been able to find anything that works for new-style classes. I found this question, but the proposed solutions don't seem to work as expected, because simple values as are identified as classes. import inspect def newclass(object): pass def test(): n = newclass() if inspect.isclass(n): print 'Is class' else: print 'Is NOT class' if inspect.isclass(type(n)): print 'Is class' else: print 'Is NOT class' if inspect.isclass(type(1)): print 'Is class' else: print 'Is NOT class' if isinstance(n, object): print 'Is class' else: print 'Is NOT class' if isinstance(1, object): print 'Is class' else: print 'Is NOT class' So is there anyway to do something like this? Or is everything in Python just a class and there's no way to get around that?

    Read the article

  • iphone - UIViewController header view errors

    - by Fiona
    Hi there, So to give a little background: I've an app that has a UITableViewController- (ContactDetailViewController) In this view at the top, I require a few labels and buttons, followed by a group style tableview. So I've created a nib file containing these elements. (ContactHeaderView.xib) Then in the viewDidLoad of ContactDetailViewController I've loaded this nib as the headerView. See implementation file below: #import "ContactDetailViewController.h" #import "DisplayInfoViewController.h" #import "ActionViewController.h" @implementation ContactDetailViewController @synthesize name; @synthesize date; @synthesize nextAction; @synthesize nameLabel; @synthesize usernameLabel; @synthesize nextActionTextField; @synthesize dateLabel; @synthesize contactInfoButton; @synthesize backgroundInfoButton; @synthesize actionDoneButton; - (void)viewDidLoad { [super viewDidLoad]; } - (void)didReceiveMemoryWarning { // Releases the view if it doesn't have a superview. [super didReceiveMemoryWarning]; // Release any cached data, images, etc that aren't in use. } - (void)viewDidUnload { // Release any retained subviews of the main view. // e.g. self.myOutlet = nil; } #pragma mark Table view methods - (NSInteger)numberOfSectionsInTableView:(UITableView *)tableView { return 1; } // Customize the number of rows in the table view. - (NSInteger)tableView:(UITableView *)tableView numberOfRowsInSection:(NSInteger)section { return 3; } - (UIView *) tableView:(UITableView *)tableView viewForHeaderInSection:(NSInteger)section { if (section == 0){ UIViewController *chv = [[[UIViewController alloc] initWithNibName:@"ContactHeaderView" bundle:nil] autorelease]; // self.nameLabel.text = self.name; return chv.view; }else{ return nil; } } - (CGFloat)tableView:(UITableView *)tableView heightForHeaderInSection:(NSInteger)section{ return 300.0; } // Customize the appearance of table view cells. - (UITableViewCell *)tableView:(UITableView *)tableView cellForRowAtIndexPath:(NSIndexPath *)indexPath { static NSString *CellIdentifier = @"Cell"; UITableViewCell *cell = [tableView dequeueReusableCellWithIdentifier:CellIdentifier]; if (cell == nil) { cell = [[[UITableViewCell alloc] initWithStyle:UITableViewCellStyleDefault reuseIdentifier:CellIdentifier] autorelease]; } // Set up the cell... return cell; } - (void)tableView:(UITableView *)tableView didSelectRowAtIndexPath:(NSIndexPath *)indexPath { // Navigation logic may go here. Create and push another view controller. // AnotherViewController *anotherViewController = [[AnotherViewController alloc] initWithNibName:@"AnotherView" bundle:nil]; // [self.navigationController pushViewController:anotherViewController]; // [anotherViewController release]; } /* // Override to support conditional editing of the table view. - (BOOL)tableView:(UITableView *)tableView canEditRowAtIndexPath:(NSIndexPath *)indexPath { // Return NO if you do not want the specified item to be editable. return YES; } */ - (void)dealloc { [name release]; [date release]; [nextAction release]; [nameLabel release]; [usernameLabel release]; [nextActionTextField release]; [dateLabel release]; [contactInfoButton release]; [backgroundInfoButton release]; [actionDoneButton release]; [super dealloc]; } -(IBAction)displayContactInfo:(id)sender{ DisplayInfoViewController *divc = [[DisplayInfoViewController alloc] init]; divc.textView = self.nextAction; divc.title = @"Contact Info"; [self.navigationController pushViewController:divc animated:YES]; [divc release]; } -(IBAction)displayBackgroundInfo:(id)sender{ DisplayInfoViewController *divc = [[DisplayInfoViewController alloc] init]; divc.textView = self.nextAction; divc.title = @"Background Info"; [self.navigationController pushViewController:divc animated:YES]; [divc release]; } -(IBAction)actionDone:(id)sender{ ActionViewController *avc = [[ActionViewController alloc] init]; avc.title = @"Action"; avc.nextAction = self.nextAction; [self.navigationController pushViewController:avc animated:YES]; [avc release]; } @end Here's the Header File: #import <UIKit/UIKit.h> @interface ContactDetailViewController : UITableViewController { NSString *name; NSString *date; NSString *nextAction; IBOutlet UILabel *nameLabel; IBOutlet UILabel *usernameLabel; IBOutlet UITextField *nextActionTextField; IBOutlet UILabel *dateLabel; IBOutlet UIButton *contactInfoButton; IBOutlet UIButton *backgroundInfoButton; IBOutlet UIButton *actionDoneButton; } @property (nonatomic, retain) NSString *name; @property (nonatomic, retain) NSString *date; @property (nonatomic, retain) NSString *nextAction; @property (nonatomic, retain) IBOutlet UILabel *nameLabel; @property (nonatomic, retain) IBOutlet UILabel *usernameLabel; @property (nonatomic, retain) IBOutlet UITextField *nextActionTextField; @property (nonatomic, retain) IBOutlet UILabel *dateLabel; @property (nonatomic, retain) IBOutlet UIButton *contactInfoButton; @property (nonatomic, retain) IBOutlet UIButton *backgroundInfoButton; @property (nonatomic, retain) IBOutlet UIButton *actionDoneButton; -(IBAction)displayContactInfo: (id)sender; -(IBAction)displayBackgroundInfo: (id)sender; -(IBAction)actionDone: (id)sender; @end However when I run it, I get the following error message: * Terminating app due to uncaught exception 'NSUnknownKeyException', reason: '[ setValue:forUndefinedKey:]: this class is not key value coding-compliant for the key nameLabel.' In IB I've hooked up the labels/buttons/textbox to the File's Owner (set the File's Owner Class to: ContactDetailViewController) Anyone any idea what I'm doing wrong? Regards, Fiona

    Read the article

  • How to draw the "trail" in a maze solving application

    - by snow-spur
    Hello i have designed a maze and i want to draw a path between the cells as the 'person' moves from one cell to the next. So each time i move the cell a line is drawn Also i am using the graphics module The graphics module is an object oriented library Im importing from graphics import* from maze import* my circle which is my cell center = Point(15, 15) c = Circle(center, 12) c.setFill('blue') c.setOutline('yellow') c.draw(win) p1 = Point(c.getCenter().getX(), c.getCenter().getY()) this is my loop if mazez.blockedCount(cloc)> 2: mazez.addDecoration(cloc, "grey") mazez[cloc].deadend = True c.move(-25, 0) p2 = Point(getX(), getY()) line = graphics.Line(p1, p2) cloc.col = cloc.col - 1 Now it says getX not defined every time i press a key is this because of p2???

    Read the article

  • Does AS3 show cacheasbitmap in preview?

    - by Fahim Akhter
    The following code shows me that cacheasbitmap is turning on and off like it is suppose to but, I never get to see it visually like I did in AS2. Is this a error or a change in actionscript? package { import flash.display.Sprite; import flash.events.MouseEvent; public class Bitmapascache extends Sprite { private var isOn:Boolean=false; private var box:mainBox; public function Bitmapascache() { box = new mainBox() box.addEventListener(MouseEvent.MOUSE_DOWN,click); this.addChild(box); } public function click(e:MouseEvent):void { trace("click :"+box.cacheAsBitmap); if(isOn){ box.cacheAsBitmap = false; isOn = false; } else{ box.cacheAsBitmap = true; isOn = true; } } } }

    Read the article

  • Can't run jUnit with Eclipse

    - by KimKha
    I use new Eclipse. Create demo test with jUnit (I added default jUnit library built-in Eclipse). Then I write this code: import junit.framework.*; import org.junit.Test; public class SimpleTest extends TestCase { public SimpleTest(String name) { super(name); } public final void main(String method){ } @Test public final void testSimpleTest() { int answer = 2; assertEquals((1+1), answer); } } But it doesn't run. In the Debug tab: org.eclipse.jdt.internal.junit.runner.RemoteTestRunner at localhost:52754 Thread [main] (Suspended (exception ClassNotFoundException)) URLClassLoader$1.run() line: not available [local variables unavailable] AccessController.doPrivileged(PrivilegedExceptionAction<T>, AccessControlContext) line: not available [native method] Launcher$AppClassLoader(URLClassLoader).findClass(String) line: not available Launcher$AppClassLoader(ClassLoader).loadClass(String, boolean) line: not available Launcher$AppClassLoader.loadClass(String, boolean) line: not available Launcher$AppClassLoader(ClassLoader).loadClass(String) line: not available How can I solve this?

    Read the article

  • read subprocess stdout line by line

    - by Caspin
    My python script uses subprocess to call a linux utility that is very noisy. I want to store all of the output to a log file, but only show some of it to the user. I thought the following would work, but the output does show up in my application until the utility has produced a significant amount of output. #fake_utility.py, just generates lots of output over time import time i = 0 while True: print hex(i)*512 i += 1 time.sleep(0.5) #filters output import subprocess proc = subprocess.Popen(['python','fake_utility.py'],stdout.subprocess.PIPE) for line in proc.stdout: #the real code does filtering here print "test:", line.rstrip() The behavior I really want is for the filter script to print each line as it is received from the subprocess. Sorta like what tee does but with python code. What am I missing? Is this even possible?

    Read the article

  • Exposing headers on iPhone static library

    - by leolobato
    Hello guys, I've followed this tutorial for setting up a static library with common classes from 3 projects we are working on. It's pretty simple, create a new static library project on xcode, add the code there, a change some headers role from project to public. The tutorial says I should add my library folder to the header search paths recursively. Is this the right way to go? I mean, on my library project, I have files separated in folders like Global/, InfoScreen/, Additions/. I was trying to setup one LOKit.h file on the root folder, and inside that file #import everything I need to expose. So on my host project I don't need to add the folder recursively to the header search path, and would just #import "LOKit.h". But I couldn't get this to work, the host project won't build complaining about all the classes I didn't add to LOKit.h, even though the library project builds. So, my question is, what is the right way of exposing header files when I setup a Cocoa Touch Static Library project on xCode?

    Read the article

  • Flip clock showing time issue (animations invovled)

    - by Hwang
    I'm creating a flip clock (clock where you always see in airport), but I can't seems to get the time to show at the correct timing. After the flip, then will see the number changing. But I want it to change before it flips. Currently I'm not sure whether is the animation problem, or isit I have to do something else on the script. I've uploaded the FLA so that you could have a look on how I set up the flipping animation. http://www.mediafire.com/?nzmymjgtntz Below is the AS3 code: package { import flash.display.MovieClip; import flash.events.TimerEvent; import flash.utils.Timer; public class flipClock extends MovieClip { private var clock:clockMC=new clockMC(); //seconds private var secTop1=clock.second.top1.digit; private var secTop2=clock.second.top2.digit; private var secBot1=clock.second.bot1.digit; private var secBot2=clock.second.bot2.digit; private var seconds:Number; private var minutes:Number; private var hours:Number; private var days:Number; public function flipClock():void { decrease(); addChild(clock); } private function decrease():void { var countdownTimer:Timer=new Timer(1000); //Adding an event listener to the timer object countdownTimer.addEventListener(TimerEvent.TIMER,updateTime); //Initializing timer object countdownTimer.start(); } private function updateTime(event:TimerEvent):void { decreasTimerFunction(); updateSecond(); //updateMinute(); } private function updateSecond():void { clock.second.play(); secTop1.text=num2; secTop2.text=num1; if (num1<10) { num1="0"+num1; } if (num2<10) { num2="0"+num2; } if (num1==60) { num1=0; } if (num2==60) { num2=0; } secTop1.text=num1; secTop2.text=num2; //secBot1.text=num1; //secBot2.text=num2; } private function decreasTimerFunction():void { //Create a date object for Christmas Morning var endTime:Date=new Date(2010,4,26,0,0,0,0); //Current date object var now:Date=new Date(); // Set the difference between the two date and times in milliseconds var timeDiff:Number=endTime.getTime()-now.getTime(); seconds=Math.floor(timeDiff/1000); minutes=Math.floor(seconds/60); hours=Math.floor(minutes/60); days=Math.floor(hours/24); // Set the remainder of the division vars above hours%=24; minutes%=60; seconds%=60; } } }

    Read the article

  • How to load a springframework ApplicationContext from Jython

    - by staticman
    I have a class that loads a springframework application context like so: package com.offlinesupport; import org.springframework.context.ApplicationContext; import org.springframework.context.support.ClassPathXmlApplicationContext; public class OfflineScriptSupport { private static ApplicationContext appCtx; public static final void initialize() { appCtx = new ClassPathXmlApplicationContext( new String[] { "mycontext.spring.xml" } ); } public static final ApplicationContext getApplicationContext() { return appCtx; } public static final void main( String[] args ) { System.out.println( "Starting..." ); initialize(); System.out.println( "loaded" ); } } The class OfflineScriptSupport, and the file mycontext.spring.xml are each deployed into separate jars (along with other classes and resources in their respective modules). Lets say the jar files are OfflineScriptSupport.jar and *MyContext.jar". mycontext.spring.xml is put at the root of the jar. In a Jython script (*myscript.jy"), I try to call the initialize method to create the application context: from com.offlinesupport import OfflineScriptSupport OfflineScriptSupport.initialize(); I execute the Jython script with the following command (from Linux): jython -Dpython.path=spring.jar:OfflineScriptSupport.jar:MyContext.jar myscript.jy The Springframework application context cannot find the mycontext.spring.xml file. It displays the following error: java.io.FileNotFoundException: class path resource [mycontext.spring.xml] cannot be opened because it does not exist at org.springframework.core.io.ClassPathResource.getInputStream(ClassPathResource.java:137) at org.springframework.beans.factory.xml.XmlBeanDefinitionReader.loadBeanDefinitions(XmlBeanDefinitionReader.java:167) at org.springframework.beans.factory.xml.XmlBeanDefinitionReader.loadBeanDefinitions(XmlBeanDefinitionReader.java:148) at org.springframework.beans.factory.support.AbstractBeanDefinitionReader.loadBeanDefinitions(AbstractBeanDefinitionReader.java:126) at org.springframework.beans.factory.support.AbstractBeanDefinitionReader.loadBeanDefinitions(AbstractBeanDefinitionReader.java:142) at org.springframework.context.support.AbstractXmlApplicationContext.loadBeanDefinitions(AbstractXmlApplicationContext.java:113) at org.springframework.context.support.AbstractXmlApplicationContext.loadBeanDefinitions(AbstractXmlApplicationContext.java:81) at org.springframework.context.support.AbstractRefreshableApplicationContext.refreshBeanFactory(AbstractRefreshableApplicationContext.java:89) at org.springframework.context.support.AbstractApplicationContext.refresh(AbstractApplicationContext.java:269) at org.springframework.context.support.ClassPathXmlApplicationContext.<init>(ClassPathXmlApplicationContext.java:87) at org.springframework.context.support.ClassPathXmlApplicationContext.<init>(ClassPathXmlApplicationContext.java:72) at com.offlinesupport.OfflineScriptSupport.initialize(OfflineScriptSupport.java:27) at sun.reflect.NativeMethodAccessorImpl.invoke0(Native Method) at sun.reflect.NativeMethodAccessorImpl.invoke(NativeMethodAccessorImpl.java:39) at sun.reflect.DelegatingMethodAccessorImpl.invoke(DelegatingMethodAccessorImpl.java:25) at java.lang.reflect.Method.invoke(Method.java:597) If I run the jar directly from Java (using the main entry point in OfflineScriptSupport) it works and there is no error thrown. Is there something special about the way Jython handles classpaths making the Springframework's ClassPathXmlApplicationContext not work (i.e. not be able to find resource files in the classpath)?

    Read the article

  • AIR:- Desktop Application related to Window Component (Need some work around)

    - by Mahesh Parate
    Create custom component which contains Combobox and Datagrid. Application conations two button 1) Same Window and 2) New Window. (Label of two button) When you click on “Same Window” button your custom component should get added dynamically in your application. And when you click on “New Window” button your custom component should get open in different window (it should get shifted from application and should appear in Window component). Issue faced:- Clicking on Combobox, list is not getting open as change event doesn’t get fired in Native Window as it looses reference from main application. Issue with DataGrid in Native window (AIR). • DataGridEvent.COLUMN_STRETCH event get affected if try to open datagrid in Native Window. • DataGridEvent get fired but takes long time or even stuck while column stretch Note: Application is an Desktop Application. Only one instance is created in Application for your custom component to preserve current state on your custom component it can be Style, data, or other subcomponent state of your custom component (as above mentioned 2 component are just sample). Please find sample code below:- DataGridStretchIssue.mxml:- < ?xml version="1.0" encoding="utf-8"? < mx:WindowedApplication xmlns:mx="http://www.adobe.com/2006/mxml" layout="absolute" xmlns:local="*" width="800" height="500" < mx:Script < ![CDATA[ import mx.events.FlexEvent; import mx.core.Window; private var dgComp:DataGridComp = new DataGridComp(); private var win:Window; private function clickHandler(event:Event):void{ dgComp.percentWidth = 100; dgComp.percentHeight = 100; dgComp.x = 50; dgComp.y = 100; if(win){ win.close(); } this.addChild(dgComp); } private function openClickHandler(event:MouseEvent):void{ dgComp.x = 50; dgComp.y = 100; win = new Window();; win.width = 800; win.height = 500; win.addChild(dgComp); dgComp.percentWidth = 100; dgComp.percentHeight = 100; dgComp.x = 50; dgComp.y = 100; win.open(true) } ]]> < /mx:Script < mx:HBox <mx:Button id="btnID" click="clickHandler(event)" label="Same Window"/> <mx:Button id="btnIDOpen" click="openClickHandler(event)" label="New Window"/> < /mx:HBox < /mx:WindowedApplication DataGridComp.mxml < ?xml version="1.0" encoding="utf-8"? < mx:Canvas xmlns:mx="http://www.adobe.com/2006/mxml" width="100%" height="100%" <mx:Script> <![CDATA[ import mx.events.DataGridEvent; import mx.collections.ArrayCollection; [Bindable] public var cards:ArrayCollection = new ArrayCollection( [ {label:"Visa", data:1}, {label:"MasterCard", data:2}, {label:"American Express", data:3} ]); private function stretchFn(event:DataGridEvent):void{ trace("--- Stretched---") } ]]> </mx:Script> <mx:HBox> <mx:ComboBox dataProvider="{cards}" width="150"/> <mx:DataGrid columnStretch="stretchFn(event)" > <mx:ArrayCollection> <mx:Object> <mx:Artist>Pavement</mx:Artist> <mx:Price>11.99</mx:Price> <mx:Album>Slanted and Enchanted</mx:Album> </mx:Object> <mx:Object> <mx:Artist>Pavement</mx:Artist> <mx:Album>Brighten the Corners</mx:Album> <mx:Price>11.99</mx:Price> </mx:Object> </mx:ArrayCollection> </mx:DataGrid> </mx:HBox> < /mx:Canvas Can any one suggest me some work around to make my code workable... :)

    Read the article

  • Converting IPv4 or IPv6 address to a long for comparisons

    - by Justin Akehurst
    In order to check if an IPv4 or IPv6 address is within a certain range, I've got code that takes an IPv4 address, turns that into a long, then does that same conversion on the upper/lower bound of the subnet, then checks to see if the long is between those values. I'd like to be able to do the same thing for IPv6, but saw nothing in the Python 2.6 standard libraries to allow me to do this, so I wrote this up: import socket, struct from array import array def ip_address_to_long(address): ip_as_long = None try: ip_as_long = socket.ntohl(struct.unpack('L', socket.inet_pton(socket.AF_INET, address))[0]) except socket.error: # try IPv6 try: addr = array('L', struct.unpack('!4L', socket.inet_pton(socket.AF_INET6, address))) addr.reverse() ip_as_long = sum(addr[i] << (i * 32) for i in range(len(addr))) except socket.error as se: raise ValueError('Invalid address') except Exception as e: print str(e) return ip_as_long My question is: Is there a simpler way to do this that I am missing? Is there a standard library call that can do this for me?

    Read the article

  • Enable PyGTK Eventbox motion-notify-event while is a Layout child

    - by mkotechno
    I noticed when a Eventbox is added into a Layout some events are missed, this does not happend for example adding it to a Fixed (very similar widget), I tried to restore the event mask in this way with no sucess: import pygtk import gtk def foo(widget, event): print event pygtk.require('2.0') window = gtk.Window(gtk.WINDOW_TOPLEVEL) window.connect('destroy', lambda x: gtk.main_quit()) eventbox = gtk.EventBox() eventbox.connect('button-press-event', foo) # works eventbox.connect('motion-notify-event', foo) # fail eventbox.set_events( gtk.gdk.BUTTON_MOTION_MASK| # restoring missed masks gtk.gdk.BUTTON1_MOTION_MASK| gtk.gdk.BUTTON2_MOTION_MASK| gtk.gdk.BUTTON3_MOTION_MASK) layout = gtk.Layout() image = gtk.image_new_from_file('/home/me/picture.jpg') layout.add(image) eventbox.add(layout) window.add(eventbox) window.show_all() gtk.main() How should I restore the missed event/mask?

    Read the article

  • How can I set controls for a web page ??

    - by Rami Jarrar
    I have this login page with https, and i reach to this approach:: import ClientForm import urllib2 request = urllib2.Request("http://ritaj.birzeit.edu") response = urllib2.urlopen(request) forms = ClientForms.ParseResponseEx(response) response.close() f = forms[0] username = str(raw_input("Username: ")) password = str(raw_input("Password: ")) ## Here What To Do request2 = form.click() i get the controls of that page >>> f = forms[0] >>> [c.name for c in f.controls] ['q', 'sitesearch', 'sa', 'domains', 'form:mode', 'form:id', '__confirmed_p', '__refreshing_p', 'return_url', 'time', 'token_id', 'hash', 'username', 'password', 'persistent_p', 'formbutton:ok'] so how can i set the username and password controls of the "non-form form" f ??? and i have another problem,, how to know if its the right username and password ??

    Read the article

  • Importing a spreadsheet into an asp.net program and listing the worksheets

    - by Bob Avallone
    I have to import the contents of a spreadsheet in my asp.net project. The code behind is c#. I figured out how to locate the spreadsheet on the user's computer and how to import the data from a given worksheet into a datable. The problem is I may not know the name of the worksheet ahead of time. I want to present the user with a list of available worksheets and have them pick one. That is the piece I don't know how to do. Thanks in advance. Bob Avallone

    Read the article

  • Multi-part template issue with Jinja2

    - by Alan Harris-Reid
    Hi, When creating templates I typically have 3 separate parts (header, body, footer) which I combine to pass a singe string to the web-server (CherryPy in this case). My first approach is as follows... from jinja2 import Environment, FileSystemLoader env = Environment(loader=FileSystemLoader('')) tmpl = env.get_template('Body.html') page_body = tmpl.render() tmpl = env.get_template('Header.html') page_header = tmpl.render() tmpl = env.get_template('Footer.html') page_footer = tmpl.render() page_code = page_header + page_body + page_footer but this contains repetitious code, so my next approach is... def render_template(html_file): from jinja2 import Environment, FileSystemLoader env = Environment(loader=FileSystemLoader('')) tmpl = env.get_template(html_file) return tmpl.render() page_header = render_template('Header.html') page_body = render_template('Body.html') page_footer = render_template('Footer.html) However, this means that each part is created in its own environment - can that be a problem? Are there any other downsides to this approach? I have chosen the 3-part approach over the child-template approach because I think it may be more flexible (and easier to follow), but I might be wrong. Anyone like to convince me that using header, body and footer blocks might be better? Any advice would be appreciated. Alan

    Read the article

  • Is it possible to access variable of subclass using object of superclass in polymorphism

    - by fari
    how can i access state varibale of class keyboard with object of class kalaplayer /** * An abstract class representing a player in Kala. Extend this class * to make your own players (e.g. human players entering moves at the keyboard * or computer players with programmed strategies for making moves). */ public abstract class KalaPlayer { /** * Method by which a player selects a move. * @param gs The current game state * @return A side pit number in the range 1-6 * @throws NoMoveAvailableException if all side pits for the player are empty * (i.e. the game is over) */ public abstract int chooseMove(KalaGameState gs) throws NoMoveAvailableException; } public class KeyBoardPlayer extends KalaPlayer { /** * Method by which a player selects a move. * @param gs The current game state * @return A side pit number in the range 1-6 * @throws NoMoveAvailableException if all side pits for the player are empty * (i.e. the game is over) */ public KalaGameState state; public KeyBoardPlayer() { System.out.println("Enter the number of stones to play with: "); try { BufferedReader br = new BufferedReader(new InputStreamReader(System.in)); int key = Integer.parseInt(br.readLine()); state=new KalaGameState(key); //key=player1.state.turn; } catch(IOException e) { System.out.println(e); } } public int chooseMove(KalaGameState gs) throws NoMoveAvailableException{ return 0; } } import java.io.IOException; import java.io.BufferedReader; import java.io.InputStreamReader; public class KalaGame { KalaPlayer player1,player2; public KalaGame(KeyBoardPlayer Player1,KeyBoardPlayer Player2) { //super(0); player1=new KeyBoardPlayer(); player2 = new KeyBoardPlayer(); //player1=Player1; //player2=Player2; //player1.state ****how can i access the stae variable from Keyboard CLass using object from KalaPlayer key=player1.state.turn; } public void play() { System.out.println("Enter the number of stones to play with: "); try { BufferedReader br = new BufferedReader(new InputStreamReader(System.in)); int key = Integer.parseInt(br.readLine()); System.out.println(key); KalaGameState state=new KalaGameState(key); printGame(); } catch(IOException e) { System.out.println(e); } }

    Read the article

  • iPhone: error: request for member 'table' in something not a structure or union

    - by Jack Griffiths
    Hi there, When it comes to compiling my application, I get the error mentioned in the title. How would I go about remedying this error? Basically, I want to get from one table to the other. Hierarchy, navigation. NextViewController.m #import "RootViewController.h" #import "NextViewController.h" @implementation NextViewController - (void)didReceiveMemoryWarning { [super didReceiveMemoryWarning]; // Releases the view if it doesn't have a superview // Release anything that's not essential, such as cached data } - (void)dealloc { [super dealloc]; } - (IBAction) changeTable:(NSString *)str{ tblCSS.table = str; } The last line contains the error. If you need any more code, just ask. I'll amend this post with it. Cheers, Jack

    Read the article

  • jcuda library usage problem

    - by user513164
    hi m very new to java and Linux i have a code which is taken from examples of jcuda.the code is following import jcuda.CUDA; import jcuda.driver.CUdevprop; import jcuda.driver.types.CUdevice; public class EnumDevices { public static void main(String args[]) { //Init CUDA Driver CUDA cuda = new CUDA(true); int count = cuda.getDeviceCount(); System.out.println("Total number of devices: " + count); for (int i = 0; i < count; i++) { CUdevice dev = cuda.getDevice(i); String name = cuda.getDeviceName(dev); System.out.println("Name: " + name); int version[] = cuda.getDeviceComputeCapability(dev); System.out.println("Version: " + String.format("%d.%d", version[0], version[1])); CUdevprop prop = cuda.getDeviceProperties(dev); System.out.println("Clock rate: " + prop.clockRate + " MHz"); System.out.println("Threads per block: " + prop.maxThreadsPerBlock); } } } I'm using Ubuntu as my operating system i compiled it with following command 1:-javac -cp /home/manish.yadav/Desktop/JCuda-All-0.3.2-bin-linux-x86_64 EnumDevices i got following error error: Class names, 'EnumDevices', are only accepted if annotation processing is explicitly requested 1 error i don't know what is the meaning of this error.what should i do to compile the program than i changed the compiling option which is javac -cp /home/manish.yadav/Desktop/JCuda-All-0.3.2-bin-linux-x86_64 EnumDevices.java than i got following error EnumDevices.java:36: clockRate is not public in jcuda.driver.CUdevprop; cannot be accessed from outside package System.out.println("Clock rate: " + prop.clockRate + " MHz"); ^ EnumDevices.java:37: maxThreadsPerBlock is not public in jcuda.driver.CUdevprop; cannot be accessed from outside package System.out.println("Threads per block: " + prop.maxThreadsPerBlock); ^ 2 errors Now I'm completely confused i don't know what to do? how to compile this program ? how to install the jcuda package or how to use it ? how to use package which have only jar files and .so files and the jar files don't having manifest file ? please help me

    Read the article

  • Complex sound handling (I.E. pitch change while looping)

    - by Matthew
    Hi everyone I've been meaning to learn Java for a while now (I usually keep myself in languages like C and Lua) but buying an android phone seems like an excellent time to start. now after going through the lovely set of tutorials and a while spent buried in source code I'm beginning to get the feel for it so what's my next step? well to dive in with a fully featured application with graphics, sound, sensor use, touch response and a full menu. hmm now there's a slight conundrum since i can continue to use cryptic references to my project or risk telling you what the application is but at the same time its going to make me look like a raving sci-fi nerd so bare with me for the brief... A semi-working sonic screwdriver (oh yes!) my grand idea was to make an animated screwdriver where sliding the controls up and down modulate the frequency and that frequency dictates the sensor data it returns. now I have a semi-working sound system but its pretty poor for what its designed to represent and I just wouldn't be happy producing a sub-par end product whether its my first or not. the problem : sound must begin looping when the user presses down on the control the sound must stop when the user releases the control when moving the control up or down the sound effect must change pitch accordingly if the user doesn't remove there finger before backing out of the application it must plate the casing of there device with gold (Easter egg ;P) now I'm aware of how monolithic the first 3 look and that's why I would really appreciate any help I can get. sorry for how bad this code looks but my general plan is to create the functional components then refine the code later, no good painting the walls if the roofs not finished. here's my user input, he set slide stuff is used in the graphics for the control @Override public boolean onTouchEvent(MotionEvent event) { //motion event for the screwdriver view if(event.getAction() == MotionEvent.ACTION_DOWN) { //make sure the users at least trying to touch the slider if (event.getY() > SonicSlideYTop && event.getY() < SonicSlideYBottom) { //power setup, im using 1.5 to help out the rate on soundpool since it likes 0.5 to 1.5 SonicPower = 1.5f - ((event.getY() - SonicSlideYTop) / SonicSlideLength); //just goes into a method which sets a private variable in my sound pool class thing mSonicAudio.setPower(1, SonicPower); //this handles the slides graphics setSlideY ( (int) event.getY() ); @Override public boolean onTouchEvent(MotionEvent event) { //motion event for the screwdriver view if(event.getAction() == MotionEvent.ACTION_DOWN) { //make sure the users at least trying to touch the slider if (event.getY() > SonicSlideYTop && event.getY() < SonicSlideYBottom) { //power setup, im using 1.5 to help out the rate on soundpool since it likes 0.5 to 1.5 SonicPower = 1.5f - ((event.getY() - SonicSlideYTop) / SonicSlideLength); //just goes into a method which sets a private variable in my sound pool class thing mSonicAudio.setPower(1, SonicPower); //this handles the slides graphics setSlideY ( (int) event.getY() ); //this is from my latest attempt at loop pitch change, look for this in my soundPool class mSonicAudio.startLoopedSound(); } } if(event.getAction() == MotionEvent.ACTION_MOVE) { if (event.getY() > SonicSlideYTop && event.getY() < SonicSlideYBottom) { SonicPower = 1.5f - ((event.getY() - SonicSlideYTop) / SonicSlideLength); mSonicAudio.setPower(1, SonicPower); setSlideY ( (int) event.getY() ); } } if(event.getAction() == MotionEvent.ACTION_UP) { mSonicAudio.stopLoopedSound(); SonicPower = 1.5f - ((event.getY() - SonicSlideYTop) / SonicSlideLength); mSonicAudio.setPower(1, SonicPower); } return true; } and here's where those methods end up in my sound pool class its horribly messy but that's because I've been trying a ton of variants to get this to work, you will also notice that I begin to hard code the index, again I was trying to get the methods to work before making them work well. package com.mattster.sonicscrewdriver; import java.util.HashMap; import android.content.Context; import android.media.AudioManager; import android.media.SoundPool; public class SoundManager { private float mPowerLvl = 1f; private SoundPool mSoundPool; private HashMap mSoundPoolMap; private AudioManager mAudioManager; private Context mContext; private int streamVolume; private int LoopState; private long mLastTime; public SoundManager() { } public void initSounds(Context theContext) { mContext = theContext; mSoundPool = new SoundPool(2, AudioManager.STREAM_MUSIC, 0); mSoundPoolMap = new HashMap<Integer, Integer>(); mAudioManager = (AudioManager)mContext.getSystemService(Context.AUDIO_SERVICE); streamVolume = mAudioManager.getStreamVolume(AudioManager.STREAM_MUSIC); } public void addSound(int index,int SoundID) { mSoundPoolMap.put(1, mSoundPool.load(mContext, SoundID, 1)); } public void playUpdate(int index) { if( LoopState == 1) { long now = System.currentTimeMillis(); if (now > mLastTime) { mSoundPool.play(mSoundPoolMap.get(1), streamVolume, streamVolume, 1, 0, mPowerLvl); mLastTime = System.currentTimeMillis() + 250; } } } public void stopLoopedSound() { LoopState = 0; mSoundPool.setVolume(mSoundPoolMap.get(1), 0, 0); mSoundPool.stop(mSoundPoolMap.get(1)); } public void startLoopedSound() { LoopState = 1; } public void setPower(int index, float mPower) { mPowerLvl = mPower; mSoundPool.setRate(mSoundPoolMap.get(1), mPowerLvl); } } ah ha! I almost forgot, that looks pretty ineffective but I omitted my thread which actuality updates it, nothing fancy it just calls : mSonicAudio.playUpdate(1); thanks in advance, Matthew

    Read the article

< Previous Page | 149 150 151 152 153 154 155 156 157 158 159 160  | Next Page >