Search Results

Search found 10046 results on 402 pages for 'repository pattern'.

Page 153/402 | < Previous Page | 149 150 151 152 153 154 155 156 157 158 159 160  | Next Page >

  • How to sort my paws?

    - by Ivo Flipse
    In my previous question I got an excellent answer that helped me detect where a paw hit a pressure plate, but now I'm struggling to link these results to their corresponding paws: I manually annotated the paws (RF=right front, RH= right hind, LF=left front, LH=left hind). As you can see there's clearly a pattern repeating pattern and it comes back in aknist every measurement. Here's a link to a presentation of 6 trials that were manually annotated. My initial thought was to use heuristics to do the sorting, like: There's a ~60-40% ratio in weight bearing between the front and hind paws; The hind paws are generally smaller in surface; The paws are (often) spatially divided in left and right. However, I’m a bit skeptical about my heuristics, as they would fail on me as soon as I encounter a variation I hadn’t thought off. They also won’t be able to cope with measurements from lame dogs, whom probably have rules of their own. Furthermore, the annotation suggested by Joe sometimes get's messed up and doesn't take into account what the paw actually looks like. Based on the answers I received on my question about peak detection within the paw, I’m hoping there are more advanced solutions to sort the paws. Especially because the pressure distribution and the progression thereof are different for each separate paw, almost like a fingerprint. I hope there's a method that can use this to cluster my paws, rather than just sorting them in order of occurrence. So I'm looking for a better way to sort the results with their corresponding paw. For anyone up to the challenge, I have pickled a dictionary with all the sliced arrays that contain the pressure data of each paw (bundled by measurement) and the slice that describes their location (location on the plate and in time). To clarfiy: walk_sliced_data is a dictionary that contains ['ser_3', 'ser_2', 'sel_1', 'sel_2', 'ser_1', 'sel_3'], which are the names of the measurements. Each measurement contains another dictionary, [0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10] (example from 'sel_1') which represent the impacts that were extracted. Also note that 'false' impacts, such as where the paw is partially measured (in space or time) can be ignored. They are only useful because they can help recognizing a pattern, but won't be analyzed. And for anyone interested, I’m keeping a blog with all the updates regarding the project!

    Read the article

  • Adding Listeners at runtime? - Java MVC

    - by Halo
    My model in my MVC pattern, generates components at runtime and gives them to the View to be displayed on the screen through update() method (you know, model is the observable and the view is the observer). But I also need to add listeners to these components, and the controller has the listener methods (because they say the MVC pattern is like this) and it's not involved in this update process. So I can't add the listeners at runtime, but only in the controller's constructor at startup. I've got an idea, that is making the controller the observer and then giving the data to the view, as well as adding the listeners. Do you think this would be OK?

    Read the article

  • initial caps in actionScript using Regex

    - by Deyon
    I'm trying to do initial caps in actionScript with no loops but now i'm stuck. I wanted to select the first letter or every word then apply uppercase on that letter. Well I got the selection part right, but at a dead end right now, any ideas? I was trying to do this with out loops and cutting up strings. //replaces with x cant figure out how to replace with the found result as uppercase public function initialcaps():void { var pattern:RegExp=/\b[a-z]/g; var myString:String="yes that is my dog dancing on the stage"; var nuString:String=myString.replace(pattern,"x"); trace(nuString); }

    Read the article

  • Mercurial for Beginners: The Definitive Practical Guide

    - by Laz
    Inspired by Git for beginners: The definitive practical guide. This is a compilation of information on using Mercurial for beginners for practical use. Beginner - a programmer who has touched source control without understanding it very well. Practical - covering situations that the majority of users often encounter - creating a repository, branching, merging, pulling/pushing from/to a remote repository, etc. Notes: Explain how to get something done rather than how something is implemented. Deal with one question per answer. Answer clearly and as concisely as possible. Edit/extend an existing answer rather than create a new answer on the same topic. Please provide a link to the the Mercurial wiki or the HG Book for people who want to learn more. Questions: Installation/Setup How to install Mercurial? How to set up Mercurial? How do you create a new project/repository? How do you configure it to ignore files? Working with the code How do you get the latest code? How do you check out code? How do you commit changes? How do you see what's uncommitted, or the status of your current codebase? How do you destroy unwanted commits? How do you compare two revisions of a file, or your current file and a previous revision? How do you see the history of revisions to a file? How do you handle binary files (visio docs, for instance, or compiler environments)? How do you merge files changed at the "same time"? Tagging, branching, releases, baselines How do you 'mark' 'tag' or 'release' a particular set of revisions for a particular set of files so you can always pull that one later? How do you pull a particular 'release'? How do you branch? How do you merge branches? How do you merge parts of one branch into another branch? Other Good GUI/IDE plugin for Mercurial? Advantages/disadvantages? Any other common tasks a beginner should know? How do I interface with Subversion? Other Mercurial references Mercurial: The Definitive Guide Mercurial Wiki Meet Mercurial | Peepcode Screencast

    Read the article

  • DOS batch command to read some info from text file

    - by Ray
    Hello All, I am trying to read some info from a text file by using windows command line, and save it to a variable just like "set info =1234" Below is the content of the txt file, actually I just need the revision number, and the location of it is always the same line 5, and from column 11 to 15. In the sample it's 1234, and I am wondering is there a way to save it to a variable in Dos command line. Thanks a lot! svninfo.txt: Path: . URL: https://www.abc.com Repository Root: https://www.abc.com/svn Repository UUID: 12345678-8b61-fa43-97dc-123456789 Revision: 1234 Node Kind: directory Schedule: normal Last Changed Author: abc Last Changed Rev: 1234 Last Changed Date: 2010-04-01 18:19:54 -0700 (Thu, 01 Apr 2010)

    Read the article

  • Downloading Eclipse's Source Code

    - by digiarnie
    I'm doing a study on large Java projects and would like to view the source code for Eclipse. I have gone to this url (http://wiki.eclipse.org/index.php/CVS_Howto) and figured that the most useful cvs repository for me to look at would be this one: :pserver:[email protected]:/cvsroot/eclipse (The Eclipse platform project) However, when looking at this repository, it has so many modules! Which modules should I be trying to check out? I don't necessarily want to build the IDE from source, however, I just want to get the core Eclipse code base to perform some analysis. Would I just check out any modules starting with "org.eclipse..."? Should I be checking out any of the others? Or is there an easier way to get the source? I read somewhere that you can get the source from the binary version of Eclipse but I am unsure where to find the source.

    Read the article

  • Subversion terminology. Difference between projects, modules and root directories

    - by aioobe
    I'm setting up a repository for me and some colleagues. I have a subversion repository at hand, and all required rights. The usual directory-skeleton has been set up for me (branches, tags and trunk). Now I'm about to create a directory for me and my colleagues to put our files in. I'm quite sure the right place to put it is in trunk. Now here and there in tutorials, I see terms like "modules" and "projects" such as in Checking Out a Project - svn checkout svn checkout http://host_name/svn_dir/repository_name/project/trunk proj Is proj in the above line some glorified directory in trunk? Should I do something else than a checkout on trunk, mkdir and then commit when creating a directory for me and my colleagues? Whats the difference between a project, a directory in trunk and a module?

    Read the article

  • StackOverflowError occured as using java.util.regex.Matcher

    - by Captain Kidd
    Hi guys I try to catch text by Regular Expression. I list codes as follows. Pattern p=Pattern.compile("<@a>(?:.|\\s)+?</@a>"); Matcher m = p.matcher(fileContents.toString()); while(m.find()) { //Error will be thrown at this point System.out.println(m.group()); } If the length of text I want to catch is too long, system will throw me a StackOverflowError. Otherwise, the codes work well. Please help me how to solve this problem.

    Read the article

  • .Net Regular expression - how to do an exact match exclusion on a full string?

    - by Nathan Ridley
    I need a .Net regular expression that matches anything OTHER than the exact full string match specified. So basically: ^Index$ ... is the only exclusion I care about. Strings can start with, finish with or contain "Index", but not match exactly. My brain doesn't seem to be working today and I'm failing to work this one out. EDIT The answer MUST be via the pattern itself, as I am passing an argument to a third party library and do not have control over the process other than via the Regex pattern.

    Read the article

  • Find ASCII "arrows" in text

    - by ulver
    I'm trying to find all the occurrences of "Arrows" in text, so in "<----=====><==->>" the arrows are: "<----", "=====>", "<==", "->", ">" This works: String[] patterns = {"<=*", "<-*", "=*>", "-*>"}; for (String p : patterns) { Matcher A = Pattern.compile(p).matcher(s); while (A.find()) { System.out.println(A.group()); } } but this doesn't: String p = "<=*|<-*|=*>|-*>"; Matcher A = Pattern.compile(p).matcher(s); while (A.find()) { System.out.println(A.group()); } No idea why. It often reports "<" instead of "<====" or similar. What is wrong?

    Read the article

  • Problem with truncation of floating point values in DBSlayer.

    - by chrisdew
    When I run a query through DBslayer http://code.nytimes.com/projects/dbslayer the floating point results are truncated to a total of six digits (plus decimal point and negative sign when needed). { ... "lat":52.2228,"lng":-2.19906, ... } When I run the same query in MySQL, the results are as expected. | 52.22280884 | -2.19906425 | Firstly, am I correct in identifying DBSlayer as the cause of this effect? (Or the JSON library it uses, etc.) Secondly, is this floating point precision configurable within DBSlayer? Thanks, Chris. P.S. Ubuntu 9.10, x86_64 Path: . URL: http://dbslayer.googlecode.com/svn/trunk Repository Root: http://dbslayer.googlecode.com/svn Repository UUID: 5df2be84-4748-0410-afd4-f777a056bd0c Revision: 65 Node Kind: directory Schedule: normal Last Changed Author: dgottfrid Last Changed Rev: 65 Last Changed Date: 2008-03-28 22:52:46 +0000 (Fri, 28 Mar 2008)

    Read the article

  • spring 3 mvc requestmapping dynamic param problem

    - by Faisal khan
    I have the following code which works fine with http://localhost:8080/HelloWorldSpring3/forms/helloworld but i want to have url have some thing like this http://localhost:8080/HelloWorldSpring3/forms/helloworld/locname_here/locid_here I found that adding this @RequestMapping("/helloworld/**") will work but when i try to access http://localhost:8080/HelloWorldSpring3/forms/helloworld/locname_here/locid_here it is not found. Web.xml entry as follows <servlet-mapping> <servlet-name>dispatcher</servlet-name> <url-pattern>/forms/*</url-pattern> </servlet-mapping> Mapping bean entry @RequestMapping("/helloworld/**") public ModelAndView helloWord(){ String message = "Hello World, Spring 3.0!"; return new ModelAndView("helloworld", "message",message); }

    Read the article

  • Fixing warning from git

    - by japancheese
    I've been doing a workflow of making a git repository on a remote central repository, cloning that repo on my local dev machine, doing some work, and then pushing the changes back to the same repo on the remote server. However, and I believe this was after an update I did to git recently, after pushing up a change, I'm getting the following warning: Counting objects: 2724, done. Delta compression using up to 2 threads. Compressing objects: 100% (2666/2666), done. Writing objects: 100% (2723/2723), 5.90 MiB | 313 KiB/s, done. Total 2723 (delta 219), reused 0 (delta 0) warning: updating the currently checked out branch; this may cause confusion, as the index and working tree do not reflect changes that are now in HEAD. Can someone explain to me exactly what this warning means, and what I'm doing wrong in my workflow to not receive this warning?

    Read the article

  • NSPredicate error/behaving differently on 10.5 vs 10.6

    - by Tristan
    I am using a NSPredicate to determine if an entered email address is valid. On 10.6 it works perfectly as expected. I recently decided to get my app going on 10.5 and this is the only thing that doesn't work. The error i get is as follows: "Can't do regex matching, reason: Can't open pattern U_MALFORMED_SET (string [email protected], pattern ([\w-+]+(?:\.[\w-+]+)*@(?:[\w-]+\.)+[a-zA-Z]{2,7}), case 0, canon 0)" The code im using is as follows: NSString *regex = @"([\\w-+]+(?:\\.[\\w-+]+)*@(?:[\\w-]+\\.)+[a-zA-Z]{2,7})"; NSPredicate *regextest = [NSPredicate predicateWithFormat:@"SELF MATCHES %@", regex]; if ([regextest evaluateWithObject:[userEmail objectValue]] == YES) Does anyone know why this isn't working on 10.5? And how I might get it working or be able to do this test in a way compatible for both 10.5 and 10.6?

    Read the article

  • How do I delete a child entity from a parent collection with Entity Framework 4?

    - by simonjreid
    I'm using Entity Framework 4 and have a one-to-many relationship between a parent and child entity. I'm trying to delete a child using the parent repository by removing it from the parent's children collection: public virtual void RemoveChild(Child child) { children.Remove(child); } When I try to save the changes I get the following error: A relationship from the 'ParentChild' AssociationSet is in the 'Deleted' state. Given multiplicity constraints, a corresponding 'Child' must also in the 'Deleted' state. Surely I don't have to delete the child entity explicitly using a child repository!

    Read the article

  • [C#, Regex] EOL Special Char not matching

    - by Aurélien Ribon
    Hello, I am trying to find every "a - b, c, d" pattern in an input string. The pattern I am using is the following : "^[ \t]*(\\w+)[ \t]*->[ \t]*(\\w+)(,[ \t]*\\w+)*$" The input is : a -> b b -> c c -> d The function is : private void ParseAndBuildGraph(String input) { MatchCollection mc = Regex.Matches(input, "^[ \t]*(\\w+)[ \t]*->[ \t]*(\\w+)(,[ \t]*\\w+)*$", RegexOptions.Multiline); foreach (Match m in mc) { Debug.WriteLine(m.Value); } } The output is : c -> d Actually, there is a problem with the line ending "$" special char. If I insert a "\r" before "$", it works, but I thought "$" would match any line termination (with the Multiline option), especially a \r\n in a Windows environment. Is it not the case ?

    Read the article

  • git-svn branching

    - by slayerIQ
    Hello, I am using git with an svn repository everything is going fine I did all my branching with git so I did not branch on svn but I branched with git and pushed those branches to a separate location. Then I commited changed from the branch when needed. But now I want to create some branches that actually exist on svn I tried: $ git svn branch someFeature -m "message" ,and I got this: $ git svn branch someFeature -m "message" Multiple branch paths defined for Subversion repository. You must specify where you want to create the branch with the --destination argument. How should I specify the destination I cant figure this out and the man page isn't that clear also.

    Read the article

  • How to implement SVN pre-commit hook with best performance?

    - by mliebelt
    We have the following tools in place: Subversion (Version 1.5.9) Polarion (version 3.2.2) Polarion is based on Subversion, so on every action that changes anything (which is often the case), Polarion will use a Subversion commit to change anything. All things are currently stored in one and only one repository, so every commit of every user (some 100-200 on the same repository) will trigger the pre-commit hook. So what is the best strategy to provide pre-commit hooks that will trigger only for some, but not all projects run as fast as possible, because every pre-commit hook will block all other commits. We have tried to implement pre-commit hooks with Java (using SVNKit), but this will start on every commit a Java VM. So any ideas how to implement that nicely?

    Read the article

  • Hudson build defaults

    - by toluju
    This has been a fairly long-standing problem for us with our Hudson installation, and searching around the Hudson Wiki / Issue Tracker hasn't yielded any insight to this. The question: Is it possible to set certain default values for a maven2 build in Hudson? For example, we want all our projects to run the "clean" goal before a build, we want all our builds to poll the SCM hourly, and we want all our builds to deploy to our maven repository on build success. Right now, we have to manually set these setting for every project individually, which can be rather time consuming as we have 30+ different projects all being managed by Hudson. This is especially annoying if we need to change a particular setting that will affect all projects (e.g. change the repository URL). Given that I couldn't find any mention of this on the Wiki or Issue Tracker leads me to believe that I'm missing something obvious, but I cannot find an answer on my own.

    Read the article

  • Git pre-receive hook

    - by Ralphz
    Hi When you enable pre-receive hook for git repository: It takes no arguments, but for each ref to be updated it receives on standard input a line of the format: < old-value SP < new-value SP < ref-name LF where < old-value is the old object name stored in the ref, < new-value is the new object name to be stored in the ref and is the full name of the ref. When creating a new ref, < old-value is 40 0. Does anyone can explain me how do I examine all the files that will be changed in the repository if i allow this commit? I'd like to run that files through some scripts to check syntax and so on. Thanks.

    Read the article

  • Proper way to use Linq with WPF

    - by Ingó Vals
    I'm looking for a good guide into the right method of using Linq to Sql together with WPF. Most guides only go into the bare basics like how to show data from a database but noone I found goes into how to save back to the database. Can you answer or point out to me a guide that can answer these questions. I have a separate Data project because the same data will also be used in a web page so I have the repository method. That means I have a seperate class that uses the DataContext and there are methods like GetAllCompanies() and GetCompanyById ( int id ). 1) Where there are collections is it best to return as a IQueryable or should I return a list? Inside the WPF project I have seen reccomendations to wrap the collection in a ObservabgleCollection. 2) Why should I use ObservableCollection and should I use it even with Linq / IQueryable Some properties of the linq entities should be editable in the app so I set them to two-way mode. That would change the object in the observableCollection. 3) Is the object in the ObservableCollection still a instance of the original linq entity and so is the change reflected in the database ( when submitchanges is called ) I should have somekind of save method in the repository. But when should I call it? What happens if someone edits a field but decides not to save it, goes to another object and edits it and then press save. Doesn't the original change also save? When does it not remember the changes to a linq entity object anymore. Should I instance the Datacontext class in each method so it loses scope when done. 4) When and how to call the SubmitChanges method 5) Should I have the DataContext as a member variable of the repository class or a method variable To add a new row I should create a new object in a event ( "new" button push ) and then add it to the database using a repo method. 6) When I add the object to the database there will be no new object in the ObservableCollection. Do I refresh somehow. 7) I wan't to reuse the edit window when creating new but not sure how to dynamically changing from referencing selected item from a listview to this new object. Any examples you can point out.

    Read the article

  • Static Access To Multiple Instance Variable

    - by Qua
    I have a singleton instance that is referenced throughout the project which works like a charm. It saves me the trouble from having to pass around an instance of the object to every little class in the project. However, now I need to manage multiple instances of the previous setup, which means that the singleton pattern breaks since each instance would need it's own singleton instance. What options are there to still maintain static access to the singleton? To be more specific, we have our game engine and several components and plugins reference the engine through a static property. Now our server needs to host multiple game instances each having their own engine, which means that on the server side the singleton pattern breaks. I'm trying to avoid all the classes having the engine in the constructor.

    Read the article

  • Regular Expression Help in .NET

    - by Matt H.
    I have a simple pattern I am trying to match, any characters captured between parenthesis at the end of an HTML paragraph. I am running into trouble any time there is additional parentheticals in that paragraph: i.e. If the input string is "..... (321)</p" i want to get the value (321) However, if the paragraph has this text: "... (123) (321)</p" my regex is returning "(123) (321)" (everything between the opening "(" and closing ")" I am using the regex pattern "\s(.+)</p" How can I grab the correct value (using VB.NET) This is what I'm doing so far: Dim reg As New Regex("\s\(.+\)</P>", RegexOptions.IgnoreCase) Dim matchC As MatchCollection = reg.Matches(su.Question) If matchC.Count > 0 Then Dim lastMatch As Match = matchC(matchC.Count - 1) Dim DesiredValue As String = lastMatch.Value End If

    Read the article

  • PrincipalPermission - roles seperate from permissions

    - by Leblanc Meneses
    I've been using PrincipalPermission for a while in wcf services. [PrincipalPermission(SecurityAction.Demand, Role = SecurityRoles.CanManageUsers)] although now i have a requirement to simplify roles by business unit. - currently aspnet_roles has fine grained can* permissions. Here is my approach and wanted to see if anyone can provide feedback, code review before i implement my suggestion. 1) aspnet_roles - business unit role 2) create permission table and Role_Permission table and User_Permission table (many to many) 3) create custom CodeAccessSecurityAttribute + that looks at new tables [CustomPermissionCheck(Security.Demand, HasPermission="can*")] first iteration i'll statically new the dependent repository.. ideally i would like an aop style attribute that has repository injected IPermissionRepository.HasPermission(...); If i approach new aop way i probably will stop inheriting from CodeAccessSecurityAttribute -- what do the security guys have to say about this? has anyone else solved this, is there something in the framework that i've missed?

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

< Previous Page | 149 150 151 152 153 154 155 156 157 158 159 160  | Next Page >