Search Results

Search found 10046 results on 402 pages for 'repository pattern'.

Page 155/402 | < Previous Page | 151 152 153 154 155 156 157 158 159 160 161 162  | Next Page >

  • Maintaining both free and pro versions of an application

    - by Immortal
    I want to create a PRO version of my application for Android and was wondering how to structure my repository. For know I have a trunk and feature branches. I'd like to put a pro version in another branch but maybe there is a better way? For example, maybe I should create two branches - one for free version, the other for pro? Pro version will have additional features and will be ads-free, so eg. I don't want to include AdMob libraries in the pro version. Do you have any experience or suggestions as to what would be the best way to structure the repository in this case?

    Read the article

  • Can you use Github App with Beanstalk?

    - by mikemick
    Being new to Git, I wanted to use a GUI (Windows based) and preferred the Github App. However, I would like to integrate this site with a Beanstalkapp account. I'm pretty sure this is possible, but I can't figure it out. Inside of the Github app, I navigate to my repository. When I choose "Tools Settings...", I place the Git Clone URL for the repository provided by Beanstalk into the "Primary Remote (origin)" field in my Github app. Now when I click "Publish" (which says "Click to publish this branch to server" when I hover over it) it changes to "Publishing...". After a few seconds, I get this error: server failure The remote server disconnected. Try again later, or if this persists, contact [email protected] I am pretty sure I set the SSH keys up properly (never done this before). I added the key to both the Beanstalkapp and my Github web account.

    Read the article

  • How to display a DateTime with chosen date parts, but in the order of the FormatProvider?

    - by Stephane
    I want to display the date in the order that the culture provides, but with the elements I want only. The DateTime.Tostring() method has a list of patterns that are very useful but I would like a very small change in it. The CultureInfo used in the following the following code are chosen as example, I don't want to rely on a specific list of CultureInfo, if possible var now = DateTime.Now; string nowString = now.ToString("m", CultureInfo.GetCultureInfo("en-us")); Console.WriteLine(nowString); nowString = now.ToString("m", CultureInfo.GetCultureInfo("fr-FR")); Console.WriteLine(nowString); displays : April 12 12 avril I would like a pattern that display the abbreviation of the month and the day, but that keeps the correct order from the specified CultureInfo. using the pattern "MMM dd" will always display the month's abbreviation first, followed by the day, breaking the french order for example. Any way to achieve that without too much custom code?

    Read the article

  • NHibernate filters don't work with Session.Get

    - by Khash
    I'm trying to implement a Soft-deletable repository. Usually this can be easily done with a Delete Event listener. To filter out the deleted entities, I can add a Where attribute to my class mapping. However, I also need to implement two more methods in the repository for this entity: Restore and Purge. Restore will "undelete" entities and Purge will hard-delete them. This means I can't use Where attribute (since it block out soft-deleted entities to any access) I tried using filters instead. I can create a filter and enable or disable it within session to achieve the same result. But the problem is filters don't have any effect on Session.Get method (they only affect ICriteria based access). Any ideas as to how solve this problem? Thanks

    Read the article

  • Embedding mercurial revision information in Visual Studio c# projects automatically

    - by Mark Booth
    Original Problem In building our projects, I want the mercurial id of each repository to be embedded within the product(s) of that repository (the library, application or test application). I find it makes it so much easier to debug an application ebing run by custiomers 8 timezones away if you know precisely what went into building the particular version of the application they are using. As such, every project (application or library) in our systems implement a way of getting at the associated revision information. I also find it very useful to be able to see if an application has been compiled with clean (un-modified) changesets from the repository. 'Hg id' usefully appends a + to the changeset id when there are uncommitted changes in a repository, so this allows is to easily see if people are running a clean or a modified version of the code. My current solution is detailed below, and fulfills the basic requirements, but there are a number of problems with it. Current Solution At the moment, to each and every Visual Studio solution, I add the following "Pre-build event command line" commands: cd $(ProjectDir) HgID I also add an HgID.bat file to the Project directory: @echo off type HgId.pre > HgId.cs For /F "delims=" %%a in ('hg id') Do <nul >>HgID.cs set /p = @"%%a" echo ; >> HgId.cs echo } >> HgId.cs echo } >> HgId.cs along with an HgId.pre file, which is defined as: namespace My.Namespace { /// <summary> Auto generated Mercurial ID class. </summary> internal class HgID { /// <summary> Mercurial version ID [+ is modified] [Named branch]</summary> public const string Version = When I build my application, the pre-build event is triggered on all libraries, creating a new HgId.cs file (which is not kept under revision control) and causing the library to be re-compiled with with the new 'hg id' string in 'Version'. Problems with the current solution The main problem is that since the HgId.cs is re-created at each pre-build, every time we need to compile anything, all projects in the current solution are re-compiled. Since we want to be able to easily debug into our libraries, we usually keep many libraries referenced in our main application solution. This can result in build times which are significantly longer than I would like. Ideally I would like the libraries to compile only if the contents of the HgId.cs file has actually changed, as opposed to having been re-created with exactly the same contents. The second problem with this method is it's dependence on specific behaviour of the windows shell. I've already had to modify the batch file several times, since the original worked under XP but not Vista, the next version worked under Vista but not XP and finally I managed to make it work with both. Whether it will work with Windows 7 however is anyones guess and as time goes on, I see it more likely that contractors will expect to be able to build our apps on their Windows 7 boxen. Finally, I have an aesthetic problem with this solution, batch files and bodged together template files feel like the wrong way to do this. My actual questions How would you solve/how are you solving the problem I'm trying to solve? What better options are out there than what I'm currently doing? Rejected Solutions to these problems Before I implemented the current solution, I looked at Mercurials Keyword extension, since it seemed like the obvious solution. However the more I looked at it and read peoples opinions, the more that I came to the conclusion that it wasn't the right thing to do. I also remember the problems that keyword substitution has caused me in projects at previous companies (just the thought of ever having to use Source Safe again fills me with a feeling of dread *8'). Also, I don't particularly want to have to enable Mercurial extensions to get the build to complete. I want the solution to be self contained, so that it isn't easy for the application to be accidentally compiled without the embedded version information just because an extension isn't enabled or the right helper software hasn't been installed. I also thought of writing this in a better scripting language, one where I would only write HgId.cs file if the content had actually changed, but all of the options I could think of would require my co-workers, contractors and possibly customers to have to install software they might not otherwise want (for example cygwin). Any other options people can think of would be appreciated. Update Partial solution Having played around with it for a while, I've managed to get the HgId.bat file to only overwrite the HgId.cs file if it changes: @echo off type HgId.pre > HgId.cst For /F "delims=" %%a in ('hg id') Do <nul >>HgId.cst set /p = @"%%a" echo ; >> HgId.cst echo } >> HgId.cst echo } >> HgId.cst fc HgId.cs HgId.cst >NUL if %errorlevel%==0 goto :ok copy HgId.cst HgId.cs :ok del HgId.cst Problems with this solution Even though HgId.cs is no longer being re-created every time, Visual Studio still insists on compiling everything every time. I've tried looking for solutions and tried checking "Only build startup projects and dependencies on Run" in Tools|Options|Projects and Solutions|Build and Run but it makes no difference. The second problem also remains, and now I have no way to test if it will work with Vista, since that contractor is no longer with us. If anyone can test this batch file on a Windows 7 and/or Vista box, I would appreciate hearing how it went. Finally, my aesthetic problem with this solution, is even strnger than it was before, since the batch file is more complex and this there is now more to go wrong. If you can think of any better solution, I would love to hear about them.

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • Python: using a regular expression to match one line of HTML

    - by skylarking
    This simple Python method I put together just checks to see if Tomcat is running on one of our servers. import urllib2 import re import sys def tomcat_check(): tomcat_status = urllib2.urlopen('http://10.1.1.20:7880') results = tomcat_status.read() pattern = re.compile('<body>Tomcat is running...</body>',re.M|re.DOTALL) q = pattern.search(results) if q == []: notify_us() else: print ("Tomcat appears to be running") sys.exit() If this line is not found : <body>Tomcat is running...</body> It calls : notify_us() Which uses SMTP to send an email message to myself and another admin that Tomcat is no longer runnning on the server... I have not used the re module in Python before...so I am assuming there is a better way to do this... I am also open to a more graceful solution with Beautiful Soup ... but haven't used that either.. Just trying to keep this as simple as possible...

    Read the article

  • subversion problem - commit access

    - by Calvin
    Hi everyone, I'm new to setting up subversion but originally when I made a repository, all my team members could update and commit without problem. There was a problem with it so we decided to recreate it, but now only I can commit changes to it. And my username/password doesn't work on their computers, so I'm sure it's something obvious and silly, but I just don't know enough to know what's causing it. The passwd and svnserve.conf files are the same as the original repository that worked for everyone. Any ideas? Thanks in advance.

    Read the article

  • Tortoise SVN revision history

    - by rahul
    I want to know for how long the tortoise svn keeps the revision history. Say I have a file which I deleted from repository through repo browser an year ago, will I be able to still recover that file? If I am able to recover, I also want to know the method to permanently delete that earlier copy of file and related revisions history so that in future nobody is able to access that file. Is it possible? I have run into problems in my organisation as I did frequent updations and deletions assuming that file was getting deleted permanently. The file system of repository has bloated now. Please suggest how to fix it.

    Read the article

  • WPF - Handling events from user control in View Model

    - by Vitaly
    I’m building a WPF application using MVVM pattern (both are new technologies for me). I use user controls for simple bits of reusable functionality that doesn’t contain business logic, and MVVM pattern to build application logic. Suppose a view contains my user control that fires events, and I want to add an event handler to that event. That event handler should be in the view model of the view, because it contains business logic. The question is – view and the view model are connected only by binding; how do I connect an event handler using binding? Is it even possible (I suspect not)? If not – how should I handle events from a control in the view model? Maybe I should use commands or INotifyPropertyChanged?

    Read the article

  • In C, how do you capture a group with regex?

    - by Sylvain
    Hi, I'm trying to extract a string from another using regex. I'm using the POSIX regex functions (regcomp, regexec ...), and I fail at capturing a group ... For instance, let the pattern be something as simple as "MAIL FROM:<(.*)>" (with REG_EXTENDED cflags) I want to capture everything between '<' and '' My problem is that regmatch_t gives me the boundaries of the whole pattern (MAIL FROM:<...) instead of just what's between the parenthesis ... What am I missing ? Thanks in advance,

    Read the article

  • Git: how do you merge with remote repo?

    - by Marco
    Please help me understand how git works. I clone my remote repository on two different machines. I edit the same file on both machines. I successfully commit and push the update from the first machine to the remote repository. I then try to push the update on the second machine, but get an error: ! [rejected] master -> master (non-fast-forward) I understand why I received the error. How can I merge my changes into the remote repo? Do I need to pull the remote repo first?

    Read the article

  • How do I branch an individual file in SVN?

    - by Michael Carman
    The subversion concept of branching appears to be focused on creating an [un]stable fork of the entire repository on which to do development. Is there a mechanism for creating branches of individual files? For a use case, think of a common header (*.h) file that has multiple platform-specific source (*.c) implementations. This type of branch is a permanent one. All of these branches would see ongoing development with occasional cross-branch merging. This is in sharp contrast to unstable development/stable release branches which generally have a finite lifespan. I do not want to branch the entire repository (cheap or not) as it would create an unreasonable amount of maintenance to continuously merge between the trunk and all the branches. At present I'm using ClearCase, which has a different concept of branching that makes this easy. I've been asked to consider transitioning to SVN but this paradigm difference is important. I'm much more concerned about being able to easily create alternate versions for individual files than about things like cutting a stable release branch.

    Read the article

  • Using free function as pseudo-constructors to exploit template parameter deduction

    - by Poita_
    Is it a common pattern/idiom to use free functions as pseudo-constructors to avoid having to explicitly specify template parameters? For example, everyone knows about std::make_pair, which uses its parameters to deduce the pair types: template <class A, class B> std::pair<A, B> make_pair(A a, B b) { return std::pair<A, B>(a, b); } // This allows you to call make_pair(1, 2), // instead of having to type pair<int, int>(1, 2) // as you can't get type deduction from the constructor. I find myself using this quite often, so I was just wondering if many other people use it, and if there is a name for this pattern?

    Read the article

  • Better exception for non-exhaustive patterns in case

    - by toofarsideways
    Is there a way to get GHCi to produce better exception messages when it finds at runtime that a call has produced value that does not match the function's pattern matching? It currently gives the line numbers of the function which produced the non-exhaustive pattern match which though helpful at times does require a round of debugging which at times I feel is doing the same set of things over and over. So before I tried to put together a solution I wanted to see if something else exists. An exception message that in addition to giving the line numbers shows what kind of call it attempted to make? Is this even possible?

    Read the article

  • Method hiding with interfaces

    - by fearofawhackplanet
    interface IFoo { int MyReadOnlyVar { get; } } class Foo : IFoo { int MyReadOnlyVar { get; set; } } public IFoo GetFoo() { return new Foo { MyReadOnlyVar = 1 }; } Is the above an acceptable way of implementing a readonly/immutable object? The immutability of IFoo can be broken with a temporary cast to Foo. In general (non-critical) cases, is hiding functionality through interfaces a common pattern? Or is it considered lazy coding? Or even an anti-pattern?

    Read the article

  • Using 'git pull' vs 'git checkout -f' for website deployment

    - by Michelle
    I've found two common approaches to automatically deploying website updates using a bare remote repo. The first requires that the repo is cloned into the document root of the webserver and in the post-update hook a git pull is used. cd /srv/www/siteA/ || exit unset GIT_DIR git pull hub master The second approach adds a 'detached work tree' to the bare repository. The post-receive hook uses git checkout -f to replicate the repository's HEAD into the work directory which is the webservers document root i.e. GIT_WORK_TREE=/srv/www/siteA/ git checkout -f The first approach has the advantage that changes made in the websites working directory can be committed and pushed back to the bare repo (however files should not be updated on the live server). The second approach has the advantage that the git directory is not within the document root but this is easily solved using htaccess. Is one method objectively better than the other in terms of best practice? What other advantages and disadvantages am I missing?

    Read the article

  • Java Time Zone When Parsing DateFormat

    - by shipmaster
    I had code that parses date as follows: String ALT_DATE_TIME_FORMAT = "yyyy-MM-dd'T'HH:mm:ss.SSSZ"; SimpleDateFormat sdf = new SimpleDateFormat( ALT_DATE_TIME_FORMAT); Date date = sdf.parse(requiredTimeStamp); And it was working fine, suddenly, this stopped working. It turns out an admin made some config changes on the server and the date is currently being returned as "2010-12-27T10:50:44.000-08:00" which is not parse-able by the above pattern. I have two questions: The first would be what pattern would parse the date being returned by the JVM in the format above (specifically, just '-08:00' as the time zone)? And second, where exactly would one change such settings on a linux RHEL 5 server so that we are aware of such changes in the future?

    Read the article

  • Find Methods in a c# File programmatically

    - by sajad
    Hi Friends, I want to write a code to search for method defination and methods called in a c# file. So obviously my pattern should search for text like 1.public void xyz(blahtype blahvalue); 2.string construct = SearchData(blahvalue); Has anyone done similar to this, is Regex helpful in this case. if yes provide me the pattern. Any other workarounds. I dont know reflection(will it help in my case) Thanks, you guys gave it a try, i did not know this wud be so complex. All i wanted to do was suppose i have method like this public method1(int val) { method2(); method3(); } void method2(int val2) { method4() } i wanted to construct a string as Method1:Method2:method4 and Method1:Method3.... I guess its really complex

    Read the article

  • linq-to-sql "an attempt has been made to attach or add an entity that is not new"?

    - by Curtis White
    I've been getting several errors: cannot add an entity with a key that is already in use An attempt has been made to attach or add an entity that is not new, perhaps having been loaded from another datacontext In case 1, this stems from trying to set the key for an entity versus the entity. In case 2, I'm not attaching an entity but I am doing this: MyParent.Child = EntityFromOtherDataContext; I've been using using the pattern of wrap everything with a using datacontext. In my case, I am using this in a web forms scenario, and obviously moving the datacontext object to a class wide member variables solves this. My questions are thus 2 fold: How can I get rid of these errors and not have to structure my program in an odd way or pass the datacontext around while keeping the local-wrap pattern? I assume I could make another hit to the database but that seems very inefficient. Would most people recommend that moving the datacontext to the class wide scope is desirable for web pages?

    Read the article

  • How to Command Query Responsibility Segregation (CQRS) with ASP.NET MVC?

    - by Jeffrey
    I have been reading about Command Query Responsibility Segregation (CQRS). I sort of wonder how would this work with ASP.NET MVC? I get the idea of CQRS conceptually it sounds nice and sure does introduce some complexities (event and messaging pattern) compared to the "normal/common" approach . Also the idea of CQRS sort of against the use of ORM in some ways. I am trying to think how I could use this pattern in the coming projects so if anyone has experience in combining CQRS with ASP.NET MVC and NHibernate please give some concrete examples to help me better understand CQRS and use with ASP.NET MVC. Thanks!

    Read the article

  • Is it possible to exclude some files from checkin (TFS) ?

    - by Thomas Wanner
    We use configuration files within various projects under source control (TFS), where each developer has to make some adjustments in his local copy to configure his environment. The build process takes care about replacing the config files with the server configuration as a part of the deployment, so it doesn't actually matter what is in the repository. However, we would anyway like to keep some kind of a default non-breaking version of config files in the repository, so that e.g. people not involved in the particular project won't run into troubles because of local misconfiguration. We tried to resolve this by introducing the check-in policy that simply forbids to check-in the config files. This works fine, but just because we're lazy to always uncheck those checkboxes in the pending changes window, the question comes : is it possible to transparently disable the check-in of particular files without keeping them out of source control (e.g. locking their current version) ?

    Read the article

  • Overwhelmed by design patterns... where to begin?

    - by Pete
    I am writing a simple prototype code to demonstrate & profile I/O schemes (HDF4, HDF5, HDF5 using parallel IO, NetCDF, etc.) for a physics code. Since focus is on IO, the rest of the program is very simple: class Grid { public: floatArray x,y,z; }; class MyModel { public: MyModel(const int &nip1, const int &njp1, const int &nkp1, const int &numProcs); Grid grid; map<string, floatArray> plasmaVariables; }; Where floatArray is a simple class that lets me define arbitrary dimensioned arrays and do mathematical operations on them (i.e. x+y is point-wise addition). Of course, I could use better encapsulation (write accessors/setters, etc.), but that's not the concept I'm struggling with. For the I/O routines, I am envisioning applying simple inheritance: Abstract I/O class defines read & write functions to fill in the "myModel" object HDF4 derived class HDF5 HDF5 using parallel IO NetCDF etc... The code should read data in any of these formats, then write out to any of these formats. In the past, I would add an AbstractIO member to myModel and create/destroy this object depending on which I/O scheme I want. In this way, I could do something like: myModelObj.ioObj->read('input.hdf') myModelObj.ioObj->write('output.hdf') I have a bit of OOP experience but very little on the Design Patterns front, so I recently acquired the Gang of Four book "Design Patterns: Elements of Reusable Object-Oriented Software". OOP designers: Which pattern(s) would you recommend I use to integrate I/O with the myModel object? I am interested in answering this for two reasons: To learn more about design patterns in general Apply what I learn to help refactor an large old crufty/legacy physics code to be more human-readable & extensible. I am leaning towards applying the Decerator pattern to myModel, so I can attach the I/O responsibilities dynamically to myModel (i.e. whether to use HDF4, HDF5, etc.). However, I don't feel very confident that this is the best pattern to apply. Reading the Gang of Four book cover-to-cover before I start coding feels like a good way to develop an unhealthy caffeine addiction. What patterns do you recommend?

    Read the article

  • Using C# Type as generic

    - by I Clark
    I'm trying to create a generic list from a specific Type that is retrieved from elsewhere: Type listType; // Passed in to function, could be anything var list = _service.GetAll<listType>(); However I get a build error of: The type or namespace name 'listType' could not be found (are you missing a using directive or an assembly reference?) Is this even possible or am I setting foot onto C# 4 Dynamic territory? As a background: I want to automatically load all lists with data from the repository. The code below get's passed a Form Model whose properties are iterated for any IEnum (where T inherits from DomainEntity). I want to fill the list with objects of the Type the list made of from the repository. public void LoadLists(object model) { foreach (var property in model.GetType() .GetProperties(BindingFlags.Public | BindingFlags.Instance | BindingFlags.SetProperty)) { if (IsEnumerableOfNssEntities(property.PropertyType)) { var listType = property.PropertyType.GetGenericArguments()[0]; var list = _repository.Query<listType>().ToList(); property.SetValue(model, list, null); } } }

    Read the article

< Previous Page | 151 152 153 154 155 156 157 158 159 160 161 162  | Next Page >