Search Results

Search found 11687 results on 468 pages for 'solutions focus'.

Page 158/468 | < Previous Page | 154 155 156 157 158 159 160 161 162 163 164 165  | Next Page >

  • Load balancers, multiple data centers and url based routing

    - by kunkunur
    There is one data center - dc1. There is a business need to setup another data center - dc2 in another geography and there might be more in the future say dc3. Within the data center dc1: There are two web servers say WS1 and WS2. These two webservers do not share anything currently. There isnt any necessity foreseen to have more webservers within each dc. dc1 also has a local load balancer which has been setup with session stickiness. So if a user say u1 lands on dc1 and if the load balancer decides to route his first request to WS1 then from there on all u1's requests will get routed to WS1. Local load balancer and webservers are invisible to the user. Local load balancer listens to the traffic on a virtual ip which is assigned to the virtual cluster of webservers ws1 and ws2. Virtual ip is the ip to which the host name is resolved to in the DNS. There are no client specific subdomains as of now instead there is a client specific url(context). ex: www.example.com/client1 and www.example.com/client2. Given above when dc2 is onboarded I want to route the traffic between dc1 and dc2 based on the client. The options that I have found so far are. Have client specific subdomains e.g. client1.example.com and client2.example.com and assign each of them with the virtual ip of the data center to which I want to route them. or Assign www.example.com and www1.example.com to first dc i.e. dc1 and assign www2.example.com to dc2. All requests will first get routed to dc1 where WS1 and WS2 will redirect the user to www1.example.com or www2.example.com based on whether the url ends with /client1 or /client2. I need help in the following If I setup a global load balancer between dc1 and dc2 do I have any alternative solutions. That is, can a global load balancer route the traffic based on the url ? Are there drawbacks to subdomain based solutions compared to www1 solution? With www1 solution I am worried that it creates a dependency on dc1 atleast for the first request and the user will see that he is getting redirected to a different url.

    Read the article

  • How to fix SCRIPT_NAME with PHP-FPM and Apache's mod_fastcgi?

    - by Kyle MacFarlane
    I have the following in my Apache conf to get PHP-FPM working: FastCgiExternalServer /srv/www/fast-cgi-fake-handler -host 127.0.0.1:9000 AddHandler php-fastcgi .php AddType text/html .php Action php-fastcgi /var/www/cgi-bin Alias /var/www/cgi-bin /srv/www/fast-cgi-fake-handler DirectoryIndex index.php This works fine except that SCRIPT_NAME is always /var/www/cgi-bin and some scripts use SCRIPT_NAME to work out the location of the current script (vBulletin). Google has plenty of solutions for Nginx but not a word for Apache.

    Read the article

  • Automatically restore windows network drive (red "X") via batch file

    - by user33958
    i need check if a network drive is mapped and accessible. From time to time windows displays a red X on the drive, and i would need to manually click the drive in explorer to reconnect. I already found solutions which involve editing the registry which unfortunately isn´t possible. So i would need a batch file checking for connection, and (re-)mounting the drive. What i´m using at the moment: IF NOT EXIST z: net use z: \\10.211.55.5\test

    Read the article

  • Any consumer routers with Outgoing VPN support?

    - by Brian Lacy
    When I'm working at home, I need to be able to connect to three different outgoing VPNs, two of which happen to use the same internal IP addressing schemes (192.168.0.*). I also need a static address for my VirtualBox VM so I can connect to my testing web server. Are there any routers which will allow me to connect to multiple outgoing VPNs and assign different internal IP addresses through NAT? Is such a thing even possible, or are there alternate solutions available? Thanks!

    Read the article

  • Recommendations for remote server management software, similar to Puppet or Canonical Landscape?

    - by rmh
    We currently have five Ubuntu 10.04 LTS servers, and keeping them all up-to-date is starting to be a pain. I've been looking into solutions like Puppet and Canonical Landscape. Out of the two I prefer Puppet -- it would be useful to be able to ensure the permissions of various directories on the machines, and define groups and users on the server which are then propagated to clients. Is there any other software in this vein that I should be taking a look at?

    Read the article

  • Logitech mk520 (k520) keyboard Ctrl + Shift + ArrowKeys not working correctly. - Windows 8

    - by Phxvyper
    Ever since i installed windows 8, I'm unable to use Ctrl + Shift + Arrow Keys (to select words and phrases quickly in text editors) with any program. Ive found the same issue with other models of Logitech keyboards (not with any other brand, though) however, the solutions provided to those other models aren't working for me (or are impossible to complete, because of the difference in the model) If you have a possible solution, please reply! Thank you.

    Read the article

  • Take a screenshot of an entire webpage in Opera

    - by robertc
    Is there some tool within Opera, or possibly an add-on, which will let me take a screenshot of an entire web page? I usually use Screengrab to do this with Firefox, but in this situation I want a screenshot of the page as Opera renders it (because I want to show the page as rendered with HTML5 form controls like date and time). I am currently using Opera 10.60 x86_64 on Fedora 12, so solutions that work in browser would be preferable rather than external programs.

    Read the article

  • Monitor File Changes On Windows System

    - by user10487
    I am looking for a utility that can take a snapshot of the files in directories that I am interested in and then compare that snapshot to the current state of the system and show me any files that have been added, changed, or deleted. Does anyone know of solutions that provide this functionality? Thanks, Nate

    Read the article

  • WebDav uploads fail on files with certain characters on Apache

    - by bnferguson
    Have webdav uploads working great on one our boxes but anytime there is a ; # or * (and maybe a few others) the upload fails. That is expected since they're restricted characters but I'm curious if there's a way to rewrite/rename those files on their way through. We don't care what the name is really it just has to make it up to the server. Started looking at mod_rewrite solutions but my rewrite fu is rather weak.

    Read the article

  • How can virtualization be efficient?

    - by pestaa
    As I understand, the virtual machine and the guest OS doubles the amount of abstraction layers (that are computationally relevant) between the user interface and the pure power of the hardware. Some of the said abstraction layers are (emulated) hardware, drivers, IO interfaces, etc. Top-notch virtualization solutions like Xen probably eliminate a few of these complexities, but I still wonder how efficiency is achieved in these environments; and whether manageable cloud servers are really worth the performance price.

    Read the article

  • Show floor-plans online like a map

    - by Quora Feans
    Given a floor-plan, which is too big for any screen, even if it is a 17" one, how can I show it online like a map? It would need further functionality that a browser alone does not have (just zoom in/out the entire image won't do the trick). The image will be breaked down into smaller jpgs, so the user will not have to download the whole floorplan at once.It will need some zoom in/zoom out button, and some way or bookmarking position (x,y). open-source solutions prefered.

    Read the article

  • How do you protect your <appid>.appspot.com domain from DDOS attack?

    - by jacob
    If I want to use CloudFlare to help protect my GAE app via it's custom domain, I still am vulnerable to attacks directly on the .appspot.com domain. How do I mitigate that? I could force redirect appspot.com host requests, such as discussed here: http://stackoverflow.com/questions/1364733/block-requests-from-appspot-com-and-force-custom-domain-in-google-app-engine/ But I would still suffer the load of processing the redirect in my app. Are there any other solutions?

    Read the article

  • Virtual session on windows xp

    - by dotnet-practitioner
    What is the easiest way to install , setup, and run virtual session on my fresh install on my windows xp computer? I want to be able to browse , install a new software in a new virtual session instead of machine itself. What is available out there? What kind of software it would take and are there any free solutions out there? Easiest solution would be very helpful for me.

    Read the article

  • Hardware for multipurpose home server

    - by Michael Dmitry Azarkevich
    Hi guys, I'm looking to set up a multipurpose home server and hoped you could help me with the hardware selection. First of all, the services it will provide: Hosting a MySQL database (for training and testing purposes) FTP server Personal Mail Server Home media server So with this in mind I've done some research, and found some viable solutions: A standard PC with the appropriate software (Either second hand or new) A non-solid state mini-ITX system A solid state, fanless mini-ITX system I've also noted the pros and cons of each system: A standard second hand PC with old hardware would be the cheapest option. It could also have lacking processing power, not enough RAM and generally faulty hardware. Also, huge power consumption heat generation and noise levels. A standard new PC would have top-notch hardware and will stay that way for quite some time, so it's a good investment. But again, the main problem is power consumption, heat generation and noise levels. A non-solid state mini-ITX system would have the advantages of lower power consumption, lower cost (as far as I can see) and long lasting hardware. But it will generate noise and heat which will be even worse because of the size. A solid state, fanless mini-ITX system would have all the advantages of a non-solid state mini-ITX but with minimal noise and heat. The main disadvantage is the read\write problems of flash memory. All in all I'm leaning towards a non-solid state mini-ITX because of the read\write issues of flash memory. So, after this overview of what I do know, my questions are: Are all these services even providable from a single server? To my best understanding they are, but then again, I might be wrong. Is any of these solutions viable? If yes, which one is the best for my purposes? If not, what would you suggest? Also, on a more software oriented note: OS wise, I'm planning to run Linux. I'm currently thinking of four options I've been recommended: CentOS, Gentoo, DSL (Damn Small Linux) and LFS (Linux From Scratch). Any thoughts on this? Any other distro you would recomend? Regarding FTP services, I've herd good things about FileZila. Anyone has any experience with that? Do you recommend it? Do you recommend something else? Regarding the Mail service, I know nothing about this except that it exists. Any software you recommend for this task? Home media, same as mail service. Any recommended software? Thank you very much.

    Read the article

  • How to prevent dual booted OSes from damaging each other?

    - by user1252434
    For better compatibility and performance in games I'm thinking about installing Windows additionally to Linux. I have security concerns about this, though. Note: "Windows" in the remaining text includes not only the OS but also any software running on it. Regardless of whether it comes included or is additionally installed, whether it is started intentionally or unintentionally (virus, malware). Is there an easy way to achieve the following requirements: Windows MUST NOT be able to kill my linux partition or my data disk neither single files (virus infection) nor overwriting the whole disk Windows MUST NOT be able to read data disk (- extra protection against spyware) Linux may or may not have access to the windows partition both Linux and Windows should have full access to the graphics card this rules out desktop VM solutions for gaming I want the manufacturer's windows graphics card driver Regarding Windows to be unable to destroy my linux install: this is not just the usual paranoia, that has happened to me in the past. So I don't accept "no ext4 driver" as an argument. Once bitten, twice shy. And even if destruction targeted at specific (linux) files is nearly impossible, there should be no way to shred the whole partition. I may accept the risk of malware breaking out of a barrier (e.g. VM) around the whole windows box, though. Currently I have a system disk (SSD) and a data disk (HDD), both SATA. I expect I have to add another disk. If i don't: even better. My CPU is a Intel Core i5, with VT-x and VT-d available, though untested. Ideas I've had so far: deactivate or hide other HDs until reboot at low level possible? can the boot loader (grub) do this for me? tiny VM layer: load windows in a VM that provides access to almost all hardware, except the HDs any ready made software solution for this? Preferably free. as I said: the main problem seems to be to provide full access to the graphics card hardware switch to cut power to disks commercial products expensive and lots of warnings against cheap home built solutions preferably all three hard disks with one switch (one push) mobile racks - won't wear of daily swapping be a problem?

    Read the article

  • sed or grep or awk to match very very long lines

    - by yael
    more file param1=" 1,deerfntjefnerjfntrjgntrjnvgrvgrtbvggfrjbntr*rfr4fv*frfftrjgtrignmtignmtyightygjn 2,3,4,5,6,7,8, rfcmckmfdkckemdio8u548384omxc,mor0ckofcmineucfhcbdjcnedjcnywedpeodl40fcrcmkedmrikmckffmcrffmrfrifmtrifmrifvysdfn" need to match the content of $param1 in the file but its not work for example sed -n "/$param1/p" file or any grep $param1 file etc... any other solutions? maybe with perl?

    Read the article

  • unable to type in web browser ubuntu 64bit

    - by mononym
    Hi Guys, I upgraded to 64bit ubuntu and every now and again (quite often though) i am unable to to type into the search box for google in chrome and firefox, i havent tried other browsers as these are the 2 i primarily use. Has anyone else experienced this? any solutions? also i'm unable to drag the slider in youtube (in firefox) to scan through videos.

    Read the article

  • Blocking IP addresses Load Balanced Cluster

    - by Dom
    Hi We're using HAproxy as a front end load balancer / proxy and are looking for solutions to block random IP addresses from jamming the cluster. Is anyone familiar with a conf for HAProxy that can block requests if they exceed a certain threshold from a single IP within a defined period of time. Or can anyone suggest a software solution which could be placed in front of HAProxy to handle this kind of blocking. Thanks Dom--

    Read the article

  • How do you monitor and react when some scheduled job fails? - general question

    - by Dzida
    Hi, In many projects my team faced problems with 'silent fails' of some important components. There are lot of tasks executed behind the scenes and if somethings fails (either by errors in logic or hardware problems) in most cases responsible person is not notified (or not notified instantly). I know about heavy-weight monitoring tools that could solve some of that problems but there over-complicated and too expensive for our team. I am interested what are your solutions for such problems.

    Read the article

  • Circumvent proxy filter that disables the download of EXE files

    - by elgrego
    Do you know of a way to download exe files although the web proxy has a filter in place not to allow this? I have searched for a feature web site that does automatic file renaming. That should certainly make it possible. The solution would take a URL and then change the extension so that it would look to my proxy as I was downloading a .dat file (or similar). There are perhaps other solutions to this problem.

    Read the article

< Previous Page | 154 155 156 157 158 159 160 161 162 163 164 165  | Next Page >