Search Results

Search found 12798 results on 512 pages for 'inline images'.

Page 160/512 | < Previous Page | 156 157 158 159 160 161 162 163 164 165 166 167  | Next Page >

  • Removing the transperancy from image while keeping the actual image

    - by KPL
    Hello people, I have three images,and , they are not square or rectangular in shape. They are just like face of anyone. So,basically, my images are in the size 196x196 or anything like that, but complete square or rectangle with the face in the middle and transperant background in the rest of the portion. Now, I want to remove the transperant background too and just keep the faces. Don't know if this is possible and mind you, this isn't a programming question.

    Read the article

  • HTML list wrapping problem

    - by Daniel
    I have a HTML list with this style: font-weight: bold; padding: 0px; margin: 0px; list-style-type: none; display: block; width:700px; font-size: 14px; white-space: pre-wrap; and the cells have this style: display: inline; and I have spacer cells between each cell with this style: padding-right: 20px; display: inline; My problem is that when the list is too long for its 700 pixels, it wraps. I want this, but I dont want the objects to be on two separate lines. I have tried the CSS white-space property, but nothing seems to work. Any ideas?

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • Background-image won't change using jquery in IE6

    - by slav
    There is a panel on my page with no default background-image css. On load it is set with jquery to an initial image, waits for 10 seconds then loads a random image out of some predetermined images. There are previous and next buttons which allow you to cycle through the images. In ie6 the initial image loads and then a random image also loads after 10 seconds, however pressing prev/next causes the background to become white and the images aren't loaded. With alerts I was able to find that it's still keeping track of the position and url of the image it's supposed to load, but just won't load it. Here is the code below. <script type="text/javascript"> var facts = new Array(); var position; $(document).ready(function() { <xsl:for-each select="$currentPage/ancestor-or-self::node[@level=1]/../node[@nodeName='Fun Fact Folder']/node"> facts[<xsl:value-of select="position()" />] = '<xsl:value-of select="." />'; </xsl:for-each> if(window.location.pathname == "/homepage.aspx" || window.location.pathname == "/") { $(".fun_facts_bg").css("background-image", "url(images/fun_fact_homepage.JPG)"); setTimeout("randomFact()",10000); } else { randomFact(); } }); function randomFact() { $("a.previous_button").css("display", "block"); $("a.next_button").css("display", "block"); position = Math.ceil(Math.random() * (facts.length - 1)); changeFact(0); } function changeFact(increment) { position = checkPosition(position, increment); $(".fun_facts_bg").css("background-image", "url(" + facts[position] + ")"); } <xsl:text disable-output-escaping="yes">&lt;!--//--&gt;&lt;![CDATA[//&gt;&lt;!-- function checkPosition(currentPos, increment) { currentPos = currentPos + increment; if (currentPos &gt; facts.length - 1) { currentPos = 1; } else if (currentPos &lt; 1) { currentPos = facts.length - 1; } return currentPos; } //--&gt;&lt;!]]&gt;</xsl:text> </script> <a class="previous_button" href="javascript:void(0);" onclick="changeFact(-1);"> <a class="next_button" href="javascript:void(0);" onclick="changeFact(1);">

    Read the article

  • to change the style of div

    - by ramyatk06
    hi guys, I have 2 buttons and 2 divs div1 and div2.On click button1 div1 is made visible and div2 invisible,On clicking button2 div2 is made visible and div1 is invisible. For that i used javascript. function showdiv2() { document.getElementById("div2").style.visibility="visible"; document.getElementById("div2").style.display="inline"; document.getElementById("div1").style.visibility="hidden"; document.getElementById("div1").style.display = "none"; document.getElementById("lbl_msg").innerHTML = "" } function showdiv1() { document.getElementById("div1").style.visibility="visible"; document.getElementById("div1").style.display="inline"; document.getElementById("div2").style.visibility="hidden"; document.getElementById("div2").style.display = "none"; document.getElementById("lbl_msg").innerHTML = "" } In div2 i have a gridview in which i have a linkbutton named lnkDelete.In its click control is going to div1.In click of lnkDelete,i want to make div1 invisible,but on clicking button1 div1 should be visible.Can anybody help to make div1 invisible in clickevent of lnkDelete in codebehind?

    Read the article

  • Detect if objects are loaded [Javascript]

    - by Samuel
    I was wondering, is there a way to detect if a certain image / div is loaded? For example when i am loading two heavy images and showing a loading sign at the two places the images will later occupy, is there a way to already display the first image when it's loaded while still loading the second one?

    Read the article

  • Bullets WILL NOT dissapear in firefox

    - by DunlopBurns
    Hoping you can help me with a problem. I cannot get rid of Bullets in Firefox, i don't want any anywhere, hence my list-style-type: none!important being everywhere. It only appears in Firefox as far as i can tell. the HTML.... <!DOCTYPE html PUBLIC "-//W3C//DTD XHTML 1.0 Transitional//EN" "http://www.w3.org/TR/xhtml1/DTD/xhtml1-transitional.dtd"> <html xmlns="http://www.w3.org/1999/xhtml" lang="en" xml:lang="en"> <head> <title>littleprints.nl</title> <meta name="description" content="----" /> <meta name="keywords" content="----" /> <meta http-equiv="Content-Type" content="text/html; charset=iso-8859-1" /> <script type="text/javascript" src="http://ajax.googleapis.com/ajax/libs/jquery/1.4/jquery.min.js"></script> <script type="text/javascript" src="js/slimbox2.js"></script> <link rel="stylesheet" href="css/slimbox2.css" type="text/css" media="screen" /> <link rel="stylesheet" href="layout.css"/> <link rel="stylesheet" href="style.css"/> </head> <body> <div id="container"> <div id="inline1"> <div id="mainpic"> <img src="myimages/circle.jpg" width="100%" alt="Circle bracelet"/> </div> <div id="intro"> <p>Hi and welcome to little prints NL. we make this and that all by hand with 100% silver. my name is Donna Burns and i work by commision, ive been studying for 4 years and am currently learning to become a goldsmith.</p> </div> </div> <div id="inline2"> <p>Click for more...</p> <div id="images"> <a href="myimages/photos/dogtag.jpg" rel="lightbox-gal" title="Beautiful, isn't it?" ><img src="myimages/work/chunky.gif" alt="chunky"/></a> <a href="myimages/photos/hearts.jpg" rel="lightbox-gal" title="Beautiful, isn't it?" ><img src="myimages/work/hearts.gif" alt="hearts"/></a> <a href="myimages/photos/close.jpg" rel="lightbox-gal" title="Beautiful, isn't it?" ><img src="myimages/work/close.gif" alt="close"/></a> <a href="myimages/photos/pearl.jpg" rel="lightbox-gal" title="Beautiful, isn't it?" >&nbsp;</a> <a href="myimages/photos/flower.jpg" rel="lightbox-gal" title="Beautiful, isn't it?" >&nbsp;</a> <a href="myimages/photos/frontcircle.jpg" rel="lightbox-gal" title="Beautiful, isn't it?" >&nbsp;</a> <a href="myimages/photos/dogtag.jpg" rel="lightbox-gal" title="Beautiful, isn't it?" >&nbsp;</a> </div> </div> </div><!--end container--> <div id="footer"> <div id="footalign"> <div id="social"> <ul> <li> <a href="http://www.facebook.com/littleprints" title="Little Prints"> <img src="myimages/facebook.png" width="50px" height="50px" alt="FB"/> </a> </li> <li> <a href="contact.html" title="contact"> <img src="myimages/at.gif" alt="@"/> </a> </li> </ul> </div> <div id="contact"> <p><br/>To enquire about a charm either phone:<br/> 0787463289<br/> or use one of the methods to the side.</p> </div> </div> </div> </body> </html> the CSS... * {margin: 0; padding: 0; border: 0;} html, body { background-color: #000000;image; text-align: center; font: 16px/1.8 Verdana, Arial, Helvetica, sans-serif; list-style-type: none!important; text-decoration: none;} #container { position: relative; width: 900px; top: 0; min-height: 100%; margin-left: auto; margin-right: auto; padding-top: 20px; background-image: URL(myimages/back2.gif); margin-bottom: 180px; } #footer { background-color: #555555; position: relative; clear: both; bottom: 0; width: 900px; height: auto; margin-left: auto; margin-right: auto; margin-bottom: 20px; padding-bottom: 22px; margin-top: -180px; } #inline1{ display: inline-block; margin-top: 250px; margin-bottom: 20px; } #inline2 { display: inline-block; margin-top: 30px; margin-bottom: 50px; } #mainpic { float: left; width: 68%; margin-left: 20px; } #intro { float: right; width: 20%; margin-left: auto; margin-right: 50px; margin-top: 20px; } #images { margin-bottom: 20px; margin-left: auto; margin-right: auto; } #footalign { display: inline; width:900px; list-style-type: none; } #contact { text-align: center; background-color:#555555; float: middle; list-style-type: none; } #social{ background-color:#555555; float: right; list-style: none; padding:0; padding-right: 5px; text-align:center; list-style-type: none!important; } #social img{ border: none; list-style-type: none!important; margin: 3px; } #social ul{ border: none; list-style-type: none!important; } #social a{ display:inline-block; -webkit-transition:all .5s ease-out; -moz-transition:all .5s ease-out; -ms-transition:all .5s ease-out; -o-transition:all .5s ease-out; transition:all .5s ease-out; list-style-type: none!important; } #social a:hover{ display:inline-block; -webkit-transform:translate(-10px,0px); -moz-transform:translate(0px,-10px); -ms-transform:translate(-10px,0px); -o-transform:translate(-10px,0px); transform:translate(-10px,0px); list-style-type: none!important; } #form { margin-top: 250px; margin-bottom: 50px; } .nav1 {font-family: sans-serif;font-size: 22px;text-shadow: 2px 2px 5px #000000;} a:link {text-decoration:none; color:#000000; padding:3px;} a:visited {text-decoration:none; color:#000000;} a:active {text-decoration:none; color:#555555;} a:hover {text-decoration:none; color:#555555;} .nav2 {font-family: sans-serif;font-size: 22px;text-shadow: 2px 2px 5px #ffffff;} a:link {text-decoration:none; color:#ffffff; padding:3px;} a:visited {text-decoration:none; color:#ffffff;} a:active {text-decoration:none; color:#555555;} a:hover {text-decoration:none; color:#555555;} .p1 { color: #ffffff; } div#images img { max-width: 500px; height: auto; }

    Read the article

  • Lack of ImageList in MenuStrip and performance issues

    - by Ivan
    MenuStrip doesn't support using ImageList images. What are performance issues of this? Are there chances of using too much GDI resources and slow-downs? How many items should be considered acceptable, after which one should implement custom control that draws images from ImageList?

    Read the article

  • how to disable the lightbox to close after submit button?

    - by Mahmoud
    Hey all Here is an example upload on my server just in-case you want to understand what i am talking about link: secure.sabayafrah.com username: mahmud password: mahmud as you can see when you click on the image it inlarge the thumb image, so when you click on the image below it which is add it then closes the images and refreshes the page, how to disable that codes used: for images i used lightbox :http://www.huddletogether.com/projects/lightbox2/ and for the adding cart i used jcart: http://conceptlogic.com/jcart/

    Read the article

  • Best approach to make Page Flip animation on iPhone (like magazine)

    - by 2Fast4YouBR
    Hi all, What would be the besta approach to make one oage flip like a real magazine, like I put the finger in the corner of the screen then flip the page... Like this video: http://www.youtube.com/watch?v=dy4Y9j7COgg&feature=related Is it a sequence of images ? all images are in one view or Imageview ? Or there is another way to do it using the some stuff of the SDK? is this effect exisits or we have to develop ? cheers

    Read the article

  • Background Image comes up as white when displayed using Javascript

    - by AndroidNewbie
    I am trying to change the background image whenever the document is loaded, and when it hits this point: document.body.style.backgroundImage="url('../images/mobile-bckground.png')"; The page simply makes the background plain white. It is displayed like this in my javascript: $(function() { document.body.style.backgroundImage="url('../images/mobile-bckground.png')"; }); I have verified the image is in the right location, why is it doing this?

    Read the article

  • Why would the assignment operator ever do something different than its matching constructor?

    - by Neil G
    I was reading some boost code, and came across this: inline sparse_vector &assign_temporary(sparse_vector &v) { swap(v); return *this; } template<class AE> inline sparse_vector &operator=(const sparse_vector<AE> &ae) { self_type temporary(ae); return assign_temporary(temporary); } It seems to be mapping all of the constructors to assignment operators. Great. But why did C++ ever opt to make them do different things? All I can think of is scoped_ptr?

    Read the article

  • How to achieve table like rows within container using CSS

    - by Barry
    I'm helping an artist maintain her website and have inherited some pretty outdated code. Have moved lots of redundant common code to include files and am now working on moving from inline styles to more CSS-driven styles. For the gallery pages, e.g. http://artistsatlaketahoe.com/abstract.html, a lot of inline styling is used to force the current layout. My preference would be to replace this entirely with CSS that presents the following table-like layout within the "content" div: [image] [image descriptives and purchase button] [image] [image descriptives and purchase button] [image] [image descriptives and purchase button] I'd like to middle-align the image descriptives & purchase button relative to the image if possible. And then apply some padding above and below each row to stop using tags for vertical spacing. Any ideas how to create a div that I can use to get this kind of layout? Thanks!

    Read the article

  • How to successfully implement og:image for the LinkedIn

    - by Sabo
    THE PROBLEM: I am trying, without much success, to implement open graph image on site: http://www.guarenty-group.com/cz/ The homepage is completeply bypassing the og:image tag, where internal pages are reading all images from the site and place og:image as the last option. Other social networks are working fine on both internal pages and homepage. THE CONFIGURATION: I have no share buttons or alike, all I want is to be able to share the link via my profile. The image is well over 300x300px: http://guarenty-group.com/img/gg_seal.png Here is how my head tag looks like: <!DOCTYPE html PUBLIC "-//W3C//DTD XHTML 1.0 Transitional//EN" "http://www.w3.org/TR/xhtml1/DTD/xhtml1-transitional.dtd"> <html xmlns="http://www.w3.org/1999/xhtml"> <head> <meta http-equiv="Content-Type" content="text/html; charset=utf-8" /> <title>Guarenty Group : Pojištení pro nájemce a pronajímatelé</title> <meta name="keywords" content="" /> <meta name="description" content="Guarenty Group pojištuje príjem z nájmu pronajímatelum, kauci nájemcum - aby nemuseli platit velkou cástku v hotovostí predem - a dále nájemcum pojištuje príjmy, aby meli na nájem pri nemoci, úrazu ci nezamestnání." /> <meta name="image_src" content="http://guarenty-group.com/img/gg_seal.png" /> <meta name="image_url" content="http://guarenty-group.com/img/gg_seal.png" /> <meta property="og:title" content="Pojištení pro nájemce a pronajímatelé" /> <meta property="og:url" content="http://guarenty-group.com/cz/" /> <meta property="og:image" content="http://guarenty-group.com/img/gg_seal.png" /> <meta property="og:description" content="Guarenty Group pojištuje príjem z nájmu pronajímatelum, kauci nájemcum - aby nemuseli platit velkou cástku v hotovostí predem - a dále nájemcum pojištuje príjmy, aby meli na nájem pri nemoci, úrazu ci nezamestnání [...]" /> ... </head> THE TESTING RESULTS: In order to trick the cache i have tested the site with http://www.guarenty-group.com/cz/?try=N, where I have changed the N every time. The strange thing is that images found for different value of N is different. Sometimes there is no image, sometimes there is 1, 2 or 3 images, but each time there is a different set of images. But, in any case I could not find the image specified in the og:graph! MY QUESTIONS: https://developer.linkedin.com/documents/setting-display-tags-shares is saying one thing, and the personnel on the support forum is saying "over 300" Does anyone know What is the official minimum dimension of the image (both w and h)? Can an image be too large? Should I use the xmlns, should I not use xmlns or it doesn't matter? What are the maximum (and minimum) lengths for og:title and og:description tags? Any other suggestion is of course welcomed :) Thanks in advance, cheers~

    Read the article

  • What's the regex to solve this problem?

    - by Yeti
    I have an array in PHP with URLs like below: http://example.com/apps/1235554/ http://example.com/apps/apple/ http://example.com/apps/126734 http://example.com/images/a.jpg http://example.com/images/b.jpg http://example.com/apps/2331234/ http://example.com/apps/orange/ How can I separate out these urls and push them to another array using Regex: http://example.com/apps/1235554/ http://example.com/apps/126734 http://example.com/apps/2331234/ Only url with apps/{number}/ and apps/{number} should be selected.

    Read the article

  • JSP How to scale an image?

    - by newbie123
    Is there anyway to scale an image then display in jsp page? When retrieve and display the images, I want to show all photos in same size. is there any API can do it? I have searched from google, those I found was about scaling images byusing tookit but can't works in web application.

    Read the article

  • How to scale JPEG image down so that text is clear as possible?

    - by Juha Syrjälä
    I have some JPEG images that I need scale down to about 80% of original size. Original image dimension are about 700px × 1000px. Images contain some computer generated text and possibly some graphics (similar to what you would find in corporate word documents). How to scale image so that the text is as legible as possible? Currently we are scaling the imaeg down using bicubic interpolation, but that makes the text blurry and foggy.

    Read the article

  • Translate RoR Code to Java

    - by mnml
    Hi, for some reasons I am trying to translate the following RoR view code to a Java Groovy view: <% modulo_artists = @artists.length % 3 base = @artists.length / 3 base = base.ceil case modulo_artists when 0 cols = [base, base, base] when 1 cols = [base, base + 1, base] when 2 cols = [base + 1, base, base + 1] end counter = 0 %> <% id_hash = {"0" => "url('/images/actorsbg.png');", "1" => "url('/images/musiciansbg.png');", "2" => "url('/images/artistsbg.png') no-repeat; color: #FFF;", "3" => "url('/images/fashionbg.png')"} %> <div id="artists_<%=params[:artist_cat]%>" style="background: <%= id_hash[params[:artist_cat]] %>;" > <table border="0" width="660" height="164" cellpadding="0" cellspacing="0"> <tr valign="middle"> <% 3.times do |i| %> <td width="220" align="center" style="padding-right: 15px;"> <% cols[i].times do %> <h1><a href="/artists/show/<%= @artists[counter].urlname %>" ><%= @artists[counter].name %></a></h1> <% counter = counter + 1 %> <% end %> </td> <% end %> </tr> </table> </div> This is what I got so far: #{extends 'main.html' /} %{ modulo_artists = artists.size() % 3 base = artists.size() / 3 base = Math.ceil(base) if(modulo_artists == 0) cols = [base, base, base] else if(modulo_artists == 1) cols = [base, base + 1, base] else if(modulo_artists == 2) cols = [base + 1, base, base + 1] endif counter = 0 }% <div id="artists_${artist_cat}" style="background:${id_hash};" > <table border="0" width="660" height="164" cellpadding="0" cellspacing="0"> <tr valign="middle"> #{list items:1..3, as:'i'} <td width="220" align="center" style="padding-right: 15px;"> #{list items:cols[i]} <h1><a href="@{Artists.show(artists.get(counter).name.replaceAll(" ", "-"))}" >${artists.get(counter).name}</a></h1> %{ counter = counter + 1 }% #{/list} </td> #{/list} </tr> </table> </div> The idea is to keep the items organised in 3 columns like 1|0|1 4|5|4 or 5|4|5 for example

    Read the article

  • Problem in login page in asp.net

    - by Sarathi1904
    Hi all, I have created a login page. In this page i used div tag which is mapped with images for good design purposes. i have enabled the forms authentication in web.config. So finally images i mapped in div is not appearing in the login page. please help me!

    Read the article

  • IE7 not Caching CSS Image over SSL

    - by Alex
    Hello, I'm using the WebDevHelper toolbar for Internet Explorer to troubleshoot HTTP requests/roundtrips on my SSL site and noticed that IE re-downloads my CSS :hover images every time they are triggered. This causes a huge amount of roundtrips. How can I prevent this from happening? Edit: All static content is served with cache-control: public, so images, javascript etc. are cached in Firefox and Chrome. This problem is IE specific.

    Read the article

  • iPhone Image Resources, ICO vs PNG, app bundle filesize

    - by Jasarien
    My application has a collection of around 1940 icons that are used throughout. They're currently in ICO and new images provided to me come in ICO format too. I have noticed that they contain a 16x16 and 32x32 representation of each icon in one file. Each file is roughly 4KB in filesize (as reported by finder, but ls reports that they vary from being ~1000 bytes to 5000 bytes) A very small number of these icons only contain the 32x32 representation, and as a result are only around 700 bytes in size. Currently I am bundling these icons with my application and they are inflating the size of the app a bit more than I would like. Altogether, the images total just about 25.5MB. Xcode must do some kind of compression because the resulting app bundle is about 12.4MB. Compressing this further into a ZIP (as it would be when submitted to the App Store), results in a final file of 5.8MB. I'm aware that the maximum limit for over the air App Store downloads has been raised to 20MB since the introduction of the iPad (I'm not sure if that extends to iPhone apps as well as iPad apps though, if not the limit would be 10MB). My worry is that new icons are going to be added (sometimes up to 10 icons per week), and will continue to inflate the app bundle over time. What is the best way to distribute these icons with my app? Things I've tried and not had much success with: Converting the icons from ICO to PNG: I tried this in the hopes that the pngcrush utility would help out with the filesize. But it appears that it doesn't make much of a difference between a normal PNG and a crushed png (I believe it just optimises the image for display on the iPhone's GPU rather than compress it's size). Also in going from ICO to PNG actually increased the size of the icon file... Zipping the images, and then uncompressing them on first run. While this did reduce the overall image sizes, I found that the effort needed to unzip them, copy them to the documents folder and ensure that duplication doesn't happen on upgrades was too much hassle to be worth the benefit. Also, on original and 3G iPhones unzipping and copying around 25MB of images takes too long and creates a bad experience... Things I've considered but not yet tried: Instead of distributing the icons within the app bundle, host them online, and download each icon on demand (it depends on the user's data as to which icons will actually be displayed and when). Issues with this is that bandwidth costs money, and image downloads will be bandwidth intensive. However, my app currently has a small userbase of around 5,500 users (of which I estimate around 1500 to be active based on Flurry stats), and I have a huge unused bandwidth allowance with my current hosting package. So I'm open to thoughts on how to solve this tricky issue.

    Read the article

  • want to make better content display

    - by Rahul Mehta
    Hi, We are developing a social networking project, in this project we are adding content , e.g. images , video,audio,link(html). Currently we are using shadowbox.js to show it.But for better and effectiveness we want to use some other better plugin, or want to make own window for showing images and link. Please help , what is the best solution for this project. I want to know this is the white board quesion means programmer.stackexchange question or stackoverflow quesion? Thanks

    Read the article

< Previous Page | 156 157 158 159 160 161 162 163 164 165 166 167  | Next Page >