Search Results

Search found 13112 results on 525 pages for 'exception duck'.

Page 162/525 | < Previous Page | 158 159 160 161 162 163 164 165 166 167 168 169  | Next Page >

  • Update MySQL table from jsp

    - by vishnu
    I have these in a jsp file. But these values are not updated in the mysql table. May be it is not commiting. How can i solve this ? String passc1 = request.getParameter("passc1"); String accid = request.getParameter("accid"); int i = 0; String sql = " update customertb " + " set passwd = ?" + " where acc_no = ?;"; try { PreparedStatement ps = con.prepareStatement(sql); ps.setString(1, passc1); ps.setString(2, accid); i = ps.executeUpdate(); } catch (Exception e) { // do something with Exception here. Maybe just throw it up again } finally { con.close(); }

    Read the article

  • Cross-thread operation not valid: Control accessed from a thread other than the thread it was create

    - by SilverHorse
    I have a scenario. (Windows Forms, C#, .NET) There is a main form which hosts some user control. The user control does some heavy data operation, such that if I directly call the Usercontrol_Load method the UI become nonresponsive for the duration for load method execution. To overcome this I load data on different thread (trying to change existing code as little as I can) I used a background worker thread which will be loading the data and when done will notify the application that it has done its work. Now came a real problem. All the UI (main form and its child usercontrols) was created on the primary main thread. In the LOAD method of the usercontrol I'm fetching data based on the values of some control (like textbox) on userControl. The pseudocode would look like this: //CODE 1 UserContrl1_LOadDataMethod() { if(textbox1.text=="MyName") <<======this gives exception { //Load data corresponding to "MyName". //Populate a globale variable List<string> which will be binded to grid at some later stage. } } The Exception it gave was Cross-thread operation not valid: Control accessed from a thread other than the thread it was created on. To know more about this I did some googling and a suggestion came up like using the following code //CODE 2 UserContrl1_LOadDataMethod() { if(InvokeRequired) // Line #1 { this.Invoke(new MethodInvoker(UserContrl1_LOadDataMethod)); return; } if(textbox1.text=="MyName") //<<======Now it wont give exception** { //Load data correspondin to "MyName" //Populate a globale variable List<string> which will be binded to grid at some later stage } } BUT BUT BUT... it seems I'm back to square one. The Application again become nonresponsive. It seems to be due to the execution of line #1 if condition. The loading task is again done by the parent thread and not the third that I spawned. I don't know whether I perceived this right or wrong. I'm new to threading. How do I resolve this and also what is the effect of execution of Line#1 if block? The situation is this: I want to load data into a global variable based on the value of a control. I don't want to change the value of a control from the child thread. I'm not going to do it ever from a child thread. So only accessing the value so that the corresponding data can be fetched from the database.

    Read the article

  • Hibernate constraint ConstraintViolationException. Is there an easy way to ignore duplicate entries?

    - by vincent
    Basically I've got the below schema and I'm inserting records if they don't exists. However when it comes to inserting a duplicate it throws and error as I would expect. My question is whether there is an easy way to make Hibernate to just ignore inserts which would in effect insert duplicates? CREATE TABLE IF NOT EXISTS `method` ( `id` bigint(20) NOT NULL AUTO_INCREMENT, `name` varchar(10) DEFAULT NULL, PRIMARY KEY (`id`), UNIQUE KEY `name` (`name`) ) ENGINE=MyISAM DEFAULT CHARSET=latin1 AUTO_INCREMENT=2 ; SEVERE: Duplicate entry 'GET' for key 'name' Exception in thread "pool-11-thread-4" org.hibernate.exception.ConstraintViolationException: could not insert:

    Read the article

  • java.io.IOException: Invalid argument

    - by Luixv
    Hi I have a web application running in cluster mode with a load balancer. It consists in two tomcats (T1, and T2) addressing only one DB. T2 is nfs mounted to T1. This is the only dofference between both nodes. I have a java method generating some files. If the request runs on T1 there is no problem but if the request is running on node 2 I get an exception as follows: java.io.IOException: Invalid argument at java.io.FileOutputStream.close0(Native Method) at java.io.FileOutputStream.close(FileOutputStream.java:279) The corresponding code is as follows: for (int i = 0; i < dataFileList.size(); i++) { outputFileName = outputFolder + fileNameList.get(i); FileOutputStream fileOut = new FileOutputStream(outputFileName); fileOut.write(dataFileList.get(i), 0, dataFileList.get(i).length); fileOut.flush(); fileOut.close(); } The exception appears at the fileOut.close() Any hint? Luis

    Read the article

  • Class declaration bug

    - by aladine
    Please advise me what's wrong with this class declaration: ExchEngine.java package engine; public class ExchEngine { public ExchEngine() { } public static void main(String[] args) { ExchEngine engine=new ExchEngine() ; } } When I compile this file, I always get exception: java.lang.NoClassDefFoundError: test_engine/ExchEngine Caused by: java.lang.ClassNotFoundException: test_engine.ExchEngine at java.net.URLClassLoader$1.run(URLClassLoader.java:202) at java.security.AccessController.doPrivileged(Native Method) at java.net.URLClassLoader.findClass(URLClassLoader.java:190) at java.lang.ClassLoader.loadClass(ClassLoader.java:307) at sun.misc.Launcher$AppClassLoader.loadClass(Launcher.java:301) at java.lang.ClassLoader.loadClass(ClassLoader.java:248) Exception in thread "main" This seems very weird that ExchEngine.java is inside a package and it cannot run itself. Thanks for any help.

    Read the article

  • Does Google App Engine allow creation of files and folders on the server ?

    - by Frank
    I know Google App Engine offers free space, but I wonder if it's for storing data in it's database only or does it also allow me to create files and directories on the server side to store my data ? For instance can I use the following method to save file ? public static void saveFile(String File_Path,StringBuffer Str_Buf,boolean Append) { FileOutputStream fos=null; BufferedOutputStream bos=null; try { fos=new FileOutputStream(File_Path,Append); bos=new BufferedOutputStream(fos); for (int j=0;j<Str_Buf.length();j++) bos.write(Str_Buf.charAt(j)); } catch (Exception e) { e.printStackTrace(); } finally { try { if (bos!=null) { bos.close(); bos=null; } if (fos!=null) { fos.close(); fos=null; } } catch (Exception ex) { ex.printStackTrace(); } } } Frank

    Read the article

  • enterprise library configuration 4.0

    - by prince23
    hi, i am using enterprise libaray confiuration 4.0. and here i have set the file size as rollSizeKB="20" but once my file size reaches 9kb. a new file is created. what is te issue. why is it creating new file once it reaches 9KB. <add fileName="c:\Exception.log" footer="----------------------------------------" formatter="Text Formatter" header="----------------------------------------" rollFileExistsBehavior="Increment" rollInterval="None" rollSizeKB="20" timeStampPattern="yyyy-MM-dd" listenerDataType="Microsoft.Practices.EnterpriseLibrary.Logging.Configuration.RollingFlatFileTraceListenerData, Microsoft.Practices.EnterpriseLibrary.Logging, Version=4.0.0.0, Culture=neutral, PublicKeyToken=31bf3856ad364e35" traceOutputOptions="Timestamp" filter="All" type="Microsoft.Practices.EnterpriseLibrary.Logging.TraceListeners.RollingFlatFileTraceListener, Microsoft.Practices.EnterpriseLibrary.Logging, Version=4.0.0.0, Culture=neutral, PublicKeyToken=31bf3856ad364e35" name="Exception Policy" /> any help would be great thank you

    Read the article

  • webservice - unknown web method parameter name methodname

    - by ch3r1f
    I called a webservice for fetching items in fullcalendar. The method is never called and firebug gives this error: *"POST [http]://localhost:50536/FullCalendar/ServicioFullCalendar.asmx/GetEventosCalendario POST [http]://localhost:50536/FullCalendar/ServicioFullCalendar.asmx/GetEventosCalendario 500 Internal Server Error 1.01s" "unknown web method parameter name methodname"* Here is the asmx.vb code: <System.Web.Script.Services.ScriptService()> _ <System.Web.Services.WebService(Namespace:="http://localhost/uva/")> _ <System.Web.Services.WebServiceBinding(ConformsTo:=WsiProfiles.BasicProfile1_1)> _ <ToolboxItem(False)> _ Public Class ServicioFullCalendar Inherits System.Web.Services.WebService <ScriptMethod(ResponseFormat:=ResponseFormat.Json)> _ <WebMethod(MessageName:="ObtieneEventos")> _ Public Shared Function GetEventosCalendario(ByVal startDate As String, ByVal endDate As String) As String Try Return CalendarioMensualDAO.Instance.getEventos(startDate, endDate) Catch ex As Exception Throw New Exception("FullCalendar:GetEventos: " & ex.Message) Finally End Try End Function The webservice is "loaded" from the fullcalendar as follows: events: "ServicioFullCalendar.asmx/GetEventosCalendario",

    Read the article

  • JPA getSingleResult() or null

    - by Eugene Ramirez
    Hi. I have an insertOrUpdate method which inserts an Entity when it doesn't exist or update it if it does. To enable this, I have to findByIdAndForeignKey, if it returned null insert if not then update. The problem is how do I check if it exists? So I tried getSingleResult. But it throws an exception if the public Profile findByUserNameAndPropertyName(String userName, String propertyName) { String namedQuery = Profile.class.getSimpleName() + ".findByUserNameAndPropertyName"; Query query = entityManager.createNamedQuery(namedQuery); query.setParameter("name", userName); query.setParameter("propName", propertyName); Object result = query.getSingleResult(); if(result==null)return null; return (Profile)result; } but "getSingleResult" throws an exception. Thanks

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • Handle mysql restart in SQLAlchemy

    - by wRAR
    My Pylons app uses local MySQL server via SQLAlchemy and python-MySQLdb. When the server is restarted, open pooled connections are apparently closed, but the application doesn't know about this and apparently when it tries to use such connection it receives "MySQL server has gone away": File '/usr/lib/pymodules/python2.6/sqlalchemy/engine/default.py', line 277 in do_execute cursor.execute(statement, parameters) File '/usr/lib/pymodules/python2.6/MySQLdb/cursors.py', line 166 in execute self.errorhandler(self, exc, value) File '/usr/lib/pymodules/python2.6/MySQLdb/connections.py', line 35 in defaulterrorhandler raise errorclass, errorvalue OperationalError: (OperationalError) (2006, 'MySQL server has gone away') This exception is not caught anywhere so it bubbles up to the user. If I should handle this exception somewhere in my code, please show the place for such code in a Pylons WSGI app. Or maybe there is a solution in SA itself?

    Read the article

  • Building libopenmetaverse on CentOS 5

    - by Gary
    I'm trying to build libopenmetaverse on CentOS however I get the following error. I'm not this kind of developer and am installing this for someone else to use. This is just the part of the build that fails. Any ideas? [nant] /opt/libomv/Programs/WinGridProxy/WinGridProxy.exe.build build Buildfile: file:///opt/libomv/Programs/WinGridProxy/WinGridProxy.exe.build Target framework: Mono 2.0 Profile Target(s) specified: build build: [echo] Build Directory is /opt/libomv/bin [csc] Compiling 15 files to '/opt/libomv/bin/WinGridProxy.exe'. [resgen] Error: Invalid ResX input. [resgen] Position: Line 2700, Column 5. [resgen] Inner exception: An exception was thrown by the type initializer for System.Drawing.GDIPlus BUILD FAILED External Program Failed: /tmp/tmp5a71a509.tmp/resgen.exe (return code was 1) Total time: 0.4 seconds. BUILD FAILED Nested build failed. Refer to build log for exact reason. Total time: 47 seconds. Build Exit Code: 1

    Read the article

  • Operation can only be performed on cells that belong to a DataGridView control

    - by The Demigeek
    The following code throws an InvalidOperationException with the above message and I don't understand why. My code calls the following method when the user may have made changes to the datagridview's underlying data source. The goal is to update the display with any changed data, and preserve the sort column and order. private void ReloadDataGridBindingListFromDatabase() { DataGridView dgv = myDataGridViewControl; DataGridViewColumn sortedColumn = dgv.SortedColumn; SortOrder sortOrder = dgv.SortOrder; //do stuff here to refresh dgv.DataSource if (sortedColumn != null) { //this line throws an exception sortedColumn.HeaderCell.SortGlyphDirection = sortOrder; } //etc. } Clearly, sortedColumn.HeaderCell is a cell that belongs to a DataGridView control. So why am I getting this exception? Many thanks for your input.

    Read the article

  • Use DLL and have it be as trusted as my own application is

    - by Binary255
    Hi, I am using a port of GNU GetOpts, to be specific I am using the one at: http://getopt.codeplex.com I have added the DLL as a reference. But when I run my application I receive an exception: System.IO.FileLoadException was unhandled Message="Could not load file or assembly 'Gnu.Getopt, Version=0.9.1.24287, Culture=neutral, PublicKeyToken=d014b4ccdc53511a' or one of its dependencies. Failed to grant permission to execute. (Exception from HRESULT: 0x80131418)" If it is possible I would like my application to say, "trust this DLL as much as you trust me". Is there a way to do that so I won't have to fiddle with security settings? And if there is not. What is the cleanest way to get the DLL working?

    Read the article

  • How to acces File over the Network

    - by Polo
    Hi! I am having a hard time on this one, I have à folder over the network wit public accès (no credential restriction). I am trying to do à File.Exist or Directory.Exist and I keep on having a exception. Can somewone tell me the good way to do IO over the network. EDIT 1 FOR DETAILS: if i do execture = \agoodip\Public\test.txt I get the file etc etc In my code it look like a basic Directory.Exist(@"\agoodip\Public") or File.exist(@"\agoodip\Public\test.txt") The exception I get is Path not found. Thanks!

    Read the article

  • I am deploying a Silverlight APPlication that calls a WCF Service

    - by Rico
    It Runs It Loads but when it calls the service I get An exception occurred during the operation, making the result invalid. Check InnerException for exception details. at System.ComponentModel.AsyncCompletedEventArgs.RaiseExceptionIfNecessary() at SalesSimplicityPO_SL.POSvc.GetPurchaseOrdersCompletedEventArgs.get_Result() at SalesSimplicityPO_SL.About.mySvc_GetPurchaseOrdersCompleted(Object sender, GetPurchaseOrdersCompletedEventArgs e) at SalesSimplicityPO_SL.POSvc.POSvcClient.OnGetPurchaseOrdersCompleted(Object state) What is the problem does anyone know? I load and call my web service like.. BasicHttpBinding binding = new BasicHttpBinding(); EndpointAddress address = new EndpointAddress(new Uri("http://localhost/POSystem/POSvc.svc")); POSvc.POSvcClient mySvc = new POSvc.POSvcClient(binding, address); mySvc.InsertPOCompleted += new EventHandler<SalesSimplicityPO_SL.POSvc.InsertPOCompletedEventArgs>(mySvc_InsertPOCompleted); mySvc.InsertPOAsync(InitialsTextBox.Text.ToString(), DescTextBox.Text.ToString(), ClientTextBox.Text.ToString()); Works great in debug.... What am i Doing to get this error?

    Read the article

  • Fleunt NHibernate not working outside of nunit test fixtures

    - by thorkia
    Okay, here is my problem... I created a Data Layer using the RTM Fluent Nhibernate. My create session code looks like this: _session = Fluently.Configure(). Database(SQLiteConfiguration.Standard.UsingFile("Data.s3db")) .Mappings( m => { m.FluentMappings.AddFromAssemblyOf<ProductMap>(); m.FluentMappings.AddFromAssemblyOf<ProductLogMap>(); }) .ExposeConfiguration(BuildSchema) .BuildSessionFactory(); When I reference the module in a test project, then create a test fixture that looks something like this: [Test] public void CanAddProduct() { var product = new Product {Code = "9", Name = "Test 9"}; IProductRepository repository = new ProductRepository(); repository.AddProduct(product); using (ISession session = OrmHelper.OpenSession()) { var fromDb = session.Get<Product>(product.Id); Assert.IsNotNull(fromDb); Assert.AreNotSame(fromDb, product); Assert.AreEqual(fromDb.Id, product.Id); } My tests pass. When I open up the created SQLite DB, the new Product with Code 9 is in it. the tables for Product and ProductLog are there. Now, when I create a new console application, and reference the same library, do something like this: Product product = new Product() {Code = "10", Name = "Hello"}; IProductRepository repository = new ProductRepository(); repository.AddProduct(product); Console.WriteLine(product.Id); Console.ReadLine(); It doesn't work. I actually get pretty nasty exception chain. To save you lots of head aches, here is the summary: Top Level exception: An invalid or incomplete configuration was used while creating a SessionFactory. Check PotentialReasons collection, and InnerException for more detail.\r\n\r\n The PotentialReasons collection is empty The Inner exception: The IDbCommand and IDbConnection implementation in the assembly System.Data.SQLite could not be found. Ensure that the assembly System.Data.SQLite is located in the application directory or in the Global Assembly Cache. If the assembly is in the GAC, use element in the application configuration file to specify the full name of the assembly. Both the unit test library and the console application reference the exact same version of System.Data.SQLite. Both projects have the exact same DLLs in the debug folder. I even tried copying SQLite DB the unit test library created into the debug directory of the console app, and removed the build schema lines and it still fails If anyone can help me figure out why this won't work outside of my unit tests it would be greatly appreciated. This crazy bug has me at a stand still.

    Read the article

  • WCF: what timeout property to use?

    - by Tom234
    I have a piece of code like so NetTcpBinding binding = new NetTcpBinding(SecurityMode.Transport); binding.Security.Message.ClientCredentialType = MessageCredentialType.Windows; binding.CloseTimeout = new TimeSpan(0, 0, 1); binding.OpenTimeout = new TimeSpan(0, 0, 1); binding.SendTimeout = new TimeSpan(0, 0, 1); binding.ReceiveTimeout = new TimeSpan(0, 0, 1); EndpointAddress endPoint = new EndpointAddress(new Uri(clientPath)); DuplexChannelFactory<Iservice> channel = new DuplexChannelFactory<Iservice>(new ClientCallBack(clientName), binding, endPoint); channel.Ping() When the endpoint doesn't exist it still waits 20seconds before throwing an EndpointNotFoundException. The weird thing is that when i changed the SendTimeout the exception message changed from The connection attempt lasted for a time span of 00:00:20 to ....01 but still took 20seconds to throw the exception! How can i change this timeout?

    Read the article

  • Unhandled exceptions in BackgroundWorker

    - by edg
    My WinForms app uses a number of BackgroundWorker objects to retrieve information from a database. I'm using BackgroundWorker because it allows the UI to remain unblocked during long-running database queries and it simplifies the threading model for me. I'm getting occasional DatabaseExceptions in some of these background threads, and I have witnessed at least one of these exceptions in a worker thread while debugging. I'm fairly confident these exceptions are timeouts which I suppose its reasonable to expect from time to time. My question is about what happens when an unhandled exception occurs in one of these background worker threads. I don't think I can catch an exception in another thread, but can I expect my WorkerCompleted method to be executed? Is there any property or method of the BackgroundWorker I can interrogate for exceptions?

    Read the article

  • java.io.FileNotFoundException for valid URL

    - by Alexei
    Hello. I use library rome.dev.java.net to fetch RSS. Code is URL feedUrl = new URL("http://planet.rubyonrails.ru/xml/rss"); SyndFeedInput input = new SyndFeedInput(); SyndFeed feed = input.build(new XmlReader(feedUrl)); You can check that http://planet.rubyonrails.ru/xml/rss is valid URL and the page is shown in browser. But I get exception from my application java.io.FileNotFoundException: http://planet.rubyonrails.ru/xml/rss at sun.net.www.protocol.http.HttpURLConnection.getInputStream(HttpURLConnection.java:1311) at com.sun.syndication.io.XmlReader.<init>(XmlReader.java:237) at com.sun.syndication.io.XmlReader.<init>(XmlReader.java:213) at rssdaemonapp.ValidatorThread.run(ValidatorThread.java:32) at java.util.concurrent.ThreadPoolExecutor$Worker.runTask(ThreadPoolExecutor.java:886) at java.util.concurrent.ThreadPoolExecutor$Worker.run(ThreadPoolExecutor.java:908) at java.lang.Thread.run(Thread.java:619) I don't use any proxy. I get this exception on my PC and on the production server and only for this URL, other URLs are working.

    Read the article

  • JSF hiding exceptions?

    - by bshacklett
    I have a managed bean for a JSF page which is doing JPA calls in the constructor to populate fields in the bean. I'm having a bit of trouble with another call to persist an entity (to populate data for testing). I'm expecting it to throw some sort of exception since it's not working, but I'm not getting anything. Just of the heck of it I tried the following: Query newQuery = em.createQuery("Bad Syntax"); List newList = newQuery.getResultList(); I'd expect an IllegalArgumentException here since the query string is completely invalid, but the page still loads and I don't see any exceptions anywhere. Am I right in expecting this exception? If so, why am I not seeing it?

    Read the article

  • JavaScript try/catch: errors or exceptions?

    - by Josh
    OK. I may be splitting hairs here, but my code isn't consistent and I'd like to make it so. But before I do, I want to make sure I'm going the right way. In practice this doesn't matter, but this has been bothering me for a while so I figured I'd ask my peers... Every time I use a try... catch statement, in the catch block I always log a message to my internal console. However my log messages are not consistent. They either look like: catch(err) { DFTools.console.log("someMethod caught an error: ",err.message); ... or: catch(ex) { DFTools.console.log("someMethod caught an exception: ",ex.message); ... Obviously the code functions properly either way but it's starting to bother me that I sometimes refer to "errors" and sometimes to "exceptions". Like I said, maybe I'm splitting hairs but which is the proper terminology? "Exception", or "Error"?

    Read the article

  • C# Assembly Xna.Framework.dll does not load

    - by jbsnorro
    When trying to load Microsoft.Xna.Framework.dll from any project, it throws a FileNotFoundException. The specified module could not be found. (Exception from HRESULT: 0x8007007E), with no innerException. Even the simple code like the following throws that exception: static void Main(string[] args) { Assembly.LoadFile(@"C:\Microsoft.Xna.Framework.dll"); } I run XP x64, but I've set the platform in the configuration manager to x86, because I know it shouldn't(doesn't) work on x64 or Any CPU. I've manually added the dll file to GAC, but that didn't solve the problem. I have also tried the M$ Assembly Binding Log Viewer to see if those logs had any useful information, but they didn't. Everything, the loading etc, was a success according to them. Any suggestions? please?

    Read the article

  • Mysql: ROLLBACK for multiple queries

    - by Raj
    Hi I have more than three MySql queiries in a PHP script triggered by scheduled task. If a query catch an error, script throw an exception and rollback that Mysql query. It works fine. However if first query works fine, but not 2nd query, throw an exception, it rollback 2nd one but not 1st query. I am using begin_trans(), commit and rollback() for individual queries because Sometimes i need to rollback one query, sometimes all queries. Is there any way to rollback one query or all queries? Thanks in advance UPDATE: I got it working, there was no problem with in begin_trans(), commit and rollback(), the database connection config was different for one query from other queries, crazy code without any comments!!!

    Read the article

  • How to get the place name by latitude and longitude using openstreetmap in android

    - by Gaurav kumar
    In my app i am using osm rather than google map.I have latitude and longitude.So from here how i will query to get the city name from osm database..please help me. final String requestString = "http://nominatim.openstreetmap.org/reverse?format=json&lat=" + Double.toString(lat) + "&lon=" + Double.toString(lon) + "&zoom=18&addressdetails=1"; RequestBuilder builder = new RequestBuilder(RequestBuilder.GET, URL.encode(requestString)); try { @SuppressWarnings("unused") Request request = builder.sendRequest(null, new RequestCallback() { @Override public void onResponseReceived(Request request, Response response) { if (response.getStatusCode() == 200) { String city = ""; try { JSONValue json = JSONParser.parseStrict(response); JSONObject address = json.isObject().get("address").isObject(); final String quotes = "^\"|\"$"; if (address.get("city") != null) { city = address.get("city").toString().replaceAll(quotes, ""); } else if (address.get("village") != null) { city = address.get("village").toString().replaceAll(quotes, ""); } } catch (Exception e) { } } } }); } catch (Exception e1) { }

    Read the article

< Previous Page | 158 159 160 161 162 163 164 165 166 167 168 169  | Next Page >