Search Results

Search found 9058 results on 363 pages for 'length'.

Page 166/363 | < Previous Page | 162 163 164 165 166 167 168 169 170 171 172 173  | Next Page >

  • Rspec and Rails 3 - Problem Validating Nested Attribute Collection Size

    - by MunkiPhD
    When I create my Rspec tests, I keep getting a validation of false as opposed to true for the following tests. I've tried everything and the following is the measly code that I have now - so if it's waaaaay wrong, that's why. class Master < ActiveRecord::Base attr_accessible :name, :specific_size # Associations ---------------------- has_many :line_items accepts_nested_attributes_for :line_items, :allow_destroy => true, :reject_if => lambda { |a| a[:item_id].blank? } # Validations ----------------------- validates :name, :presence => true, :length => {:minimum => 3, :maximum => 30} validates :specific_size, :presence => true, :length => {:minimum => 4, :maximum => 30} validate :verify_items_count def verify_items_count if self.line_items.size < 2 errors.add(:base, "Not enough items to create a master") end end end And here it the items model: class LineItem < ActiveRecord::Base attr_accessible :specific_size, :other_item_type_id # Validations -------------------- validates :other_item_type_id, :presence => true validates :master_id, :presence => true validates :specific_size, :presence => true # Associations --------------------- belongs_to :other_item_type belongs_to :master end The RSpec Tests: before(:each) do @master_lines = [] @master_lines << LineItem.new(:other_item_type_id => 1, :master_id => 2, :specific_size => 1) @master_lines << LineItem.new(:other_item_type_id => 2, :master_id => 2, :specific_size => 1) @attr = {:name => "Some Master", :specific_size => "1 giga"} end it "should create a new instance given a valid name and specific size" do @master = Master.create(@attr) line_item_one = @master.line_items.build(:other_item_type_id => 1, :specific_size => 1) line_item_two = @master.line_items.build(:other_item_type_id => 2, :specific_size => 2) @master.line_items.size === 2 @master.should be_valid end it "should have at least two items to be valid" do master = Master.new(:name => "test name", :specific_size => "1 mega") master_item_one = LineItem.new(:other_item_type_id => 1, :specific_size => 2) master_item_two = LineItem.new(:other_item_type_id => 2, :specific_size => 1) master.line_items << master_item_one master.should_not be_valid master.line_items << master_item_two master.line_items.size.should === 2 master.should be_valid end I'm very new to Rspec and Rails - and I've been failing at this for the past couple of hours. Thanks for any help in advance.

    Read the article

  • DataColumn expressions

    - by Kumar
    What is the most complex expression you've seen/used ? and what's the limit on the length of the expression that can be used ? I seem to recall something to that effect a while back but can't locate it now !!

    Read the article

  • sed or greo or awk to match very very long lines

    - by yael
    more file param1=" 1,deerfntjefnerjfntrjgntrjnvgrvgrtbvggfrjbntr*rfr4fv*frfftrjgtrignmtignmtyightygjn 2,3,4,5,6,7,8, rfcmckmfdkckemdio8u548384omxc,mor0ckofcmineucfhcbdjcnedjcnywedpeodl40fcrcmkedmrikmckffmcrffmrfrifmtrifmrifvysdfn drfr4fdr4fmedmifmitfmifrtfrfrfrfnurfnurnfrunfrufnrufnrufnrufnruf"** # need to match the content of param1 as sed -n "/$param1/p" file but because the line length (very long line) I cant match the line what’s the best way to match very long lines?

    Read the article

  • Problem getting size of Website Xcode

    - by Michael Amici
    When i try and compile I come up with a warning that reads initialization makes pointer from integer without a cast. No clue why. I am just trying to get the size of a website. #import "Lockerz_RedemptionViewController.h" @implementation Lockerz_RedemptionViewController -(IBAction)startLoop:(id) sender { NSData *dataNew = [NSData dataWithData:[NSData dataWithContentsOfURL:[NSURL URLWithString:@"http://www.google.com/"]]]; NSUInteger *len = [dataNew length]; //error is here NSLog(@"%@", len); }

    Read the article

  • OutOfMemoryError loading Bitmap via DefaultHttpClient

    - by Goddchen
    i have a simple problem: Although i'm using sampleSize properly, my code doesn't even reach the BitmapFactorycode, since DefaultHttpClient is already throwing the exception. Here is my code: DefaultHttpClient client = new DefaultHttpClient(); HttpGet request = new HttpGet(mSongInfo.imageLarge); HttpResponse response = client.execute(request); int sampleSize = 1; while (response.getEntity().getContentLength() / sampleSize / sampleSize > 100 * 1024) { sampleSize *= 2; } BitmapFactory.Options options = new BitmapFactory.Options(); options.inSampleSize = sampleSize; final Bitmap bitmap = BitmapFactory.decodeStream(response .getEntity().getContent(), null, options); And here is the exception: 0 java.lang.OutOfMemoryError: (Heap Size=11463KB, Allocated=7623KB, Bitmap Size=9382KB) 1 at org.apache.http.util.ByteArrayBuffer.<init>(ByteArrayBuffer.java:53) 2 at org.apache.http.impl.io.AbstractSessionInputBuffer.init(AbstractSessionInputBuffer.java:82) 3 at org.apache.http.impl.io.SocketInputBuffer.<init>(SocketInputBuffer.java:98) 4 at org.apache.http.impl.SocketHttpClientConnection.createSessionInputBuffer(SocketHttpClientConnection.java:83) 5 at org.apache.http.impl.conn.DefaultClientConnection.createSessionInputBuffer(DefaultClientConnection.java:170) 6 at org.apache.http.impl.SocketHttpClientConnection.bind(SocketHttpClientConnection.java:106) 7 at org.apache.http.impl.conn.DefaultClientConnection.openCompleted(DefaultClientConnection.java:129) 8 at org.apache.http.impl.conn.DefaultClientConnectionOperator.openConnection(DefaultClientConnectionOperator.java:173) 9 at org.apache.http.impl.conn.AbstractPoolEntry.open(AbstractPoolEntry.java:164) 10 at org.apache.http.impl.conn.AbstractPooledConnAdapter.open(AbstractPooledConnAdapter.java:119) 11 at org.apache.http.impl.client.DefaultRequestDirector.execute(DefaultRequestDirector.java:359) 12 at org.apache.http.impl.client.AbstractHttpClient.execute(AbstractHttpClient.java:555) 13 at org.apache.http.impl.client.AbstractHttpClient.execute(AbstractHttpClient.java:487) 14 at org.apache.http.impl.client.AbstractHttpClient.execute(AbstractHttpClient.java:465) 15 at de.goddchen.android.easysongfinder.fragments.SongFragment$1.run(SongFragment.java:79) 16 at java.lang.Thread.run(Thread.java:1027) As you can see, the code doesn't even reach the part where i check the size (Content-Length) of the image and calculate a proper sample size. I wasn't aware that simply calling DefaultHttpClient.execute(...) will already load the complete content into the memory. Am i doing something wrong? What is the right way to first retrieve the content length and then start reading the content from an InputStream? EDIT To avoid common answers that show how to load images from a URL: i already know how to do that, i have also posted the code above, so why do you keep referencing tutorials on that? I explicitly was very clear about the problem: Why is HttpClient.execute(...)already fetching the whole content and storing it in memory instead of providing a proper ÌnputStreamto me? Please don't post any beginner tutorials on how to load aBitmap`from a URL...

    Read the article

  • How to find same-value rectangular areas of a given size in a matrix most efficiently?

    - by neo
    My problem is very simple but I haven't found an efficient implementation yet. Suppose there is a matrix A like this: 0 0 0 0 0 0 0 4 4 2 2 2 0 0 4 4 2 2 2 0 0 0 0 2 2 2 1 1 0 0 0 0 0 1 1 Now I want to find all starting positions of rectangular areas in this matrix which have a given size. An area is a subset of A where all numbers are the same. Let's say width=2 and height=3. There are 3 areas which have this size: 2 2 2 2 0 0 2 2 2 2 0 0 2 2 2 2 0 0 The result of the function call would be a list of starting positions (x,y starting with 0) of those areas. List((2,1),(3,1),(5,0)) The following is my current implementation. "Areas" are called "surfaces" here. case class Dimension2D(width: Int, height: Int) case class Position2D(x: Int, y: Int) def findFlatSurfaces(matrix: Array[Array[Int]], surfaceSize: Dimension2D): List[Position2D] = { val matrixWidth = matrix.length val matrixHeight = matrix(0).length var resultPositions: List[Position2D] = Nil for (y <- 0 to matrixHeight - surfaceSize.height) { var x = 0 while (x <= matrixWidth - surfaceSize.width) { val topLeft = matrix(x)(y) val topRight = matrix(x + surfaceSize.width - 1)(y) val bottomLeft = matrix(x)(y + surfaceSize.height - 1) val bottomRight = matrix(x + surfaceSize.width - 1)(y + surfaceSize.height - 1) // investigate further if corners are equal if (topLeft == bottomLeft && topLeft == topRight && topLeft == bottomRight) { breakable { for (sx <- x until x + surfaceSize.width; sy <- y until y + surfaceSize.height) { if (matrix(sx)(sy) != topLeft) { x = if (x == sx) sx + 1 else sx break } } // found one! resultPositions ::= Position2D(x, y) x += 1 } } else if (topRight != bottomRight) { // can skip x a bit as there won't be a valid match in current row in this area x += surfaceSize.width } else { x += 1 } } } return resultPositions } I already tried to include some optimizations in it but I am sure that there are far better solutions. Is there a matlab function existing for it which I could port? I'm also wondering whether this problem has its own name as I didn't exactly know what to google for. Thanks for thinking about it! I'm excited to see your proposals or solutions :)

    Read the article

  • Extract dates from filename(C#3.0)

    - by Newbie
    I have a situation where I need to extract dates from the file names whose general pattern is [filename_]YYYYMMDD[.fileExtension] e.g. "xxx_20100326.xls" or x2v_20100326.csv The below program does the work //Number of charecter in the substring is set to 8 //since the length of YYYYMMDD is 8 public static string ExtractDatesFromFileNames(string fileName) { return fileName.Substring(fileName.IndexOf("_") + 1, 8); } Is there any better option of achieving the same? I am basically looking for standard practice. I am using C#3.0 and dotnet framework 3.5 Thanks

    Read the article

  • Weird constants

    - by Quassnoi
    I've seen these in real code: #define SCREEN_DIMENSIONS 2 #define THREE_THOUSAND_FIVE_HUNDRED_TWENTY_TWO 3522 What is the weirdest constant you've ever seen? P. S. And of course my favorite in JScript: bool b; switch (b.ToString().length) { case 4: // true ... break; case 5: // false ... break; )

    Read the article

  • textbox issue regarding shrinking first time input text

    - by picnic4u
    i have a problem regarding the textbox. i have done the textbox auto expandable but when i insert the text first time then the textbox shrink in size from their original size.but my requirement is that when my text is exceeding the text box length then it auto expand. my code is <script type="text/javascript"> $(document).ready(function() { $('.txtStyle').autogrow(); }); </script> pls somebody suggest how ot is possible

    Read the article

  • Why the generated key size is not constant?

    - by Tom Brito
    The following code prints randomly 634, 635, 636, each time I run it. Why its not constant? public static void main(String[] args) throws Exception { KeyPairGenerator keyPairGen = KeyPairGenerator.getInstance("RSA", "BC"); keyPairGen.initialize(1024); RsaKeyPair keyPair = new RsaKeyPair(keyPairGen.generateKeyPair()); System.out.println(keyPair.getPrivate().getEncoded().length); }

    Read the article

  • Can't get jQuery to get focus on cloned input fields

    - by Rebel1Moon
    I have a page that needs to create dynamic form fields as often as the user needs, and I am trying to use Ajax to tie it in to my database for faster form entry and to prevent user typos. So, I have put my Ajax returned data into popup div, the user selects, then the form field is filled in. The problem comes on the cloned fields. They don't seem to want to bring up the popup div when focused. I am thinking it is something to do with when they get created/added to the DOM. Here is my JS that creates the clones: $(document).ready(function() { var regex = /^(.*)(\d)+$/i; var cloneIndex = $(".clonedInput").length; $("button.clone").live("click", function(){ $(this).parents(".clonedInput").clone() .appendTo("#course_container") .attr("id", "clonedInput" + cloneIndex) .find("*").each(function() { var id = this.id || ""; var match = id.match(regex) || []; if (match.length == 3) { this.id = match[1] + (cloneIndex); } }); cloneIndex++; numClones=cloneIndex-1; //alert("numClones "+numClones); }); Here is where I expect to be able to get focus on the correct cloned field and call the popup. The baker_equiv0 id is original code, whereas baker_equiv1 is the first clone. $('#baker_equiv0').focus(function() { \\ THIS CODE WORKS $('.popup').fadeIn(500); $('#results').empty(); // document.enter_data.baker_equiv1.value="test"; THIS LINE WORKS //alert("numClones "+numClones); }); $('#baker_equiv1').focus(function() { // THIS DOESN'T EVER FIRE alert("numClones "+numClones); $('.popup').fadeIn(500); $('#results').empty(); }); Here is the HTML with the form: <label for="baker_equiv" class="">Baker Equivalent: <span class="requiredField">*</span></label> <input type="text" class="cinputsa" name="baker_equiv[]" id="baker_equiv0" size="8" ONKEYUP="get_equiv(this.value);"> If I put this in the HTML code above, it works fine: onfocus="alert(this.id)" I'd also be interested in how to adjust the JS code to work based on the id array created rather than having to copy code for each potential set of fields clones, i.e., baker_equiv[] rather than baker_equiv0, baker_equiv1, etc. Thanks all!

    Read the article

  • python truncate a long string

    - by Hulk
    How to truncate sthe string to 75 characters only in python This is how it was done in javascript var data="saddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddsaddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddsadddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddd" var info = (data.length > 75) ? data.substring[0,75] + '..' : data;

    Read the article

  • Foreign keys and NULL in mySQL

    - by Industrial
    Hi everyone, Can I have a column in my values table (value) referenced as a foreign key to knownValues table, and let it be NULL whenever needed, like in the example: Table: values product type value freevalue 0 1 NULL 100 1 2 NULL 25 3 3 1 NULL Table: types id name prefix 0 length cm 1 weight kg 2 fruit NULL Table: knownValues id Type name 0 2 banana Note: The types in the table values & knownValues are of course referenced into the types table. Thanks!

    Read the article

  • IIS headers of aspx page appear on page sometimes, any idea why?

    - by Chris
    At random this output it occurring at the top of the page. Site is installed on a lot of servers issue only happens on one server. HTTP/1.1 200 OK Date: Mon, 24 May 2010 04:18:30 GMT Server: Microsoft-IIS/6.0 X-Powered-By: ASP.NET X-AspNet-Version: 2.0.50727 Cache-Control: private Content-Type: text/html; charset=utf-8 Content-Length: 39611

    Read the article

  • JavaFx MediaPlayer via HTTPS

    - by LMA
    I'm trying to make applet-videoplayer, that takes video files from PHP script via https. If source of data is httpS ://domain.com/1.flv - it works httpS ://domain.com/view.php - it doesn't work HTTP ://domain.com/view.php - it works again. In php I make HTTP header, that contains Content-type: video/x-flv Last-Modified: Wed, 14 Apr 2010 14:04:34 GMT Accept-Ranges: bytes Content-Length: 24693477 What else should I add in header to make it work? If I use not mediaPlayer, but MediaBox from samples, it writes "Loading", and keeps "rolling" locading image

    Read the article

  • Can I write this javascript more efficiently with jquery?

    - by Haluk
    Hi, Do you think jquery could help me get the following script work faster? Thanks! window.onload=function colorizeCheckedRadios(){ var inputs = document.getElementsByTagName("input"); if (inputs) { for (var i = 0; i < inputs.length; ++i) { if(inputs[i].checked&&inputs[i].type=="radio"){ inputs[i].parentNode.parentNode.style.backgroundColor='#FCE6F4'; } } } }

    Read the article

  • How to use substring in vbscript within a xsl page.

    - by dipesh
    I am trying to replace the double quotes in a string with a single quote, got the following code but get error message saying "Object Required strLocation" Sub UpdateAdvancedDecisions(strLocation) Dim d Dim strLLength strLLength = Len(strLocation) - 1 For d = 0 To strLLength alert strLocation strValue = strLocation.Substring(2,3) If strLocation.substring(d,d+1)=" " " Then strLLength = strLLength.substring(0, d) + "'" + strLLength.substring(d + 1,strLLength.length) Next End Sub

    Read the article

  • Why is my (Type).GetFields(BindingFlags.Instance | BindingFlags.Public) not working?

    - by granadaCoder
    My code can see the NonPublic members, but not the Public ones. (???) Full sample code below. FieldInfo[] publicFieldInfos = t.GetFields(BindingFlags.Instance | BindingFlags.Public); is returning nothing. Note, I'm trying to get at the properties on the abstract class as well as the 1 concrete class. (And read the attributes as well). I'm going bonkers on this one....the msdn example works with the 2 flags (BindingFlags.Instance | BindingFlags.Public).....but my mini inheritance example below is not. THANKS in advance. /////////////START CODE private void RunTest1() { try { textBox1.Text = string.Empty; Type t = typeof(MyInheritedClass); //Look at the BindingFlags *** NonPublic *** int fieldCount = 0; while (null != t) { fieldCount += t.GetFields(BindingFlags.Instance | BindingFlags.NonPublic).Length; FieldInfo[] nonPublicFieldInfos = t.GetFields(BindingFlags.Instance | BindingFlags.NonPublic); foreach (FieldInfo field in nonPublicFieldInfos) { if (null != field) { Console.WriteLine(field.Name); } } t = t.BaseType; } Console.WriteLine("\n\r------------------\n\r"); //Look at the BindingFlags *** Public *** t = typeof(MyInheritedClass); FieldInfo[] publicFieldInfos = t.GetFields(BindingFlags.Instance | BindingFlags.Public); foreach (FieldInfo field in publicFieldInfos) { if (null != field) { Console.WriteLine(field.Name); object[] attributes = field.GetCustomAttributes(t, true); if (attributes != null && attributes.Length > 0) { foreach (Attribute att in attributes) { Console.WriteLine(att.GetType().Name); } } } } } catch (Exception ex) { ReportException(ex); } } private void ReportException(Exception ex) { Exception innerException = ex; while (innerException != null) { Console.WriteLine(innerException.Message + System.Environment.NewLine + innerException.StackTrace + System.Environment.NewLine + System.Environment.NewLine); innerException = innerException.InnerException; } } public abstract class MySuperType { public MySuperType(string st) { this.STString = st; } public string STString { get; set; } public abstract string MyAbstractString {get;set;} } public class MyInheritedClass : MySuperType { public MyInheritedClass(string ic) : base(ic) { this.ICString = ic; } [Description("This is an important property"),Category("HowImportant")] public string ICString { get; set; } private string _oldSchoolPropertyString = string.Empty; public string OldSchoolPropertyString { get { return _oldSchoolPropertyString; } set { _oldSchoolPropertyString = value; } } [Description("This is a not so importarnt property"), Category("HowImportant")] public override string MyAbstractString { get; set; } }

    Read the article

  • Need an algorithm for this problem

    - by Heisenburgor
    There are two integer sequences A[] and B[] of length N,both unsorted. Requirement: through the swapping of elements between A[] and B[], make the difference between {the sum of all elements in A[]} and {the sum of all elements in B[]} to be minimum. Many thanks

    Read the article

  • JS and Jquery problem

    - by Sonny
    hi i got the problem the script.js gives me <div id="gracze"> <div id="10" class="char" style="z-index: 19; top: 592px; left: 608px; "></div> <div id="14" class="char" style="z-index: 25; top: 784px; left: 608px; "></div> </div> instead <div id="gracze"> <div id="4" class="char" ... ></div> <div id="10" class="char" style="z-index: 19; top: 592px; left: 608px; "></div> <div id="14" class="char" style="z-index: 25; top: 784px; left: 608px; "></div> </div> get_players.php 4/62/6 10/19/19 14/19/25 script.js function get_players() { $.ajax({ type: "POST", url: "get_players.php", dataType: "html", success: function(data) { var str = data; var chars = str.split("<br />"); var lol = chars.length; for(var i = lol; i--; ) { chars[i] = chars[i].split('/'); var o = document.getElementById(chars[i][0]); var aimt = i; if (!o) { if (aimt!=chars.length-1 && aimt != 0) { $('#gracze').html('<div id="'+chars[aimt][0]+'" class="char"></div>'+$('#gracze').html()); $('#'+chars[aimt][0]).css("top", chars[aimt][2]*32-16+"px"); $('#'+chars[aimt][0]).css("left", chars[aimt][1]*32+"px"); $('#'+chars[aimt][0]).css("z-index", chars[aimt][1]*32); } } else { $('#'+chars[aimt][0]).animate({ "top": chars[aimt][2]*32-16+"px", "left": chars[aimt][1]*32+"px" }, { duration: 275}); //$('#'+chars[aimt][0]).css("top", chars[aimt][1]*32-16+"px"); //$('#'+chars[aimt][0]).css("left", chars[aimt][2]*32+"px"); $('#'+chars[aimt][0]).css("z-index", chars[aimt][2]); } } }}); setTimeout("get_players();", 1000); } I think it's because of for(var i = lol; i--; ) {

    Read the article

< Previous Page | 162 163 164 165 166 167 168 169 170 171 172 173  | Next Page >