Search Results

Search found 7127 results on 286 pages for 'calculated columns'.

Page 168/286 | < Previous Page | 164 165 166 167 168 169 170 171 172 173 174 175  | Next Page >

  • Convert text to table

    - by Quattro
    I would like convert text into a table. Here is a link to the text http://www.tcdb.org/public/tcdb Short example: >gnl|TC-DB|A0CIB0|1.A.17.3.1 Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1 MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI >gnl|TC-DB|A0CS82|9.B.82.1.5 Chromosome undetermined scaffold_26, whole genome shotgun sequence - Paramecium tetraurelia. MIIEEQIEEKMIYKAIHRVKVNYQKKIDRYILYKKSRWFFNLLLMLLYAYRIQNIGGFYI VTYIYCVYQLQLLIDYFTPLGLPPVNLEDEEEDDDQFQNDFSELPTTLSNKNELNDKEFR PLLRTTSEFKVWQKSVFSVIFAYFCTYIPIWDIPVYWPFLFCYFFVIVGMSIRKYIKHMK KYGYTILDFTKKK I wanted to have columns for example delimited with pipe | or ; |>gnl|TC-DB|A0CIB0|1.A.17.3.1| Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1| MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI I am working with Windows and I don't know how to do it I just know every row starts with > I want to substitute the first whitespace in a row with a delimiter like | or ; after the first regular expression new line in a row, I want also a delimiter everything between the regular expression first new line and > should go into a new column (it's a sequence of a protein)

    Read the article

  • Using pivot tables to group transactions

    - by andreas
    I have my bank account statement and what I would like to do is group the descriptions of the transactions together with their debit or credit and sum their total. I could then see that, e.g., for ebay.com my total debit was $2000, etc. Description Debit Credit A 1 B 1 A 1 B 1 C 1 D 1 A 1 What I want to do is use a pivot table Description Debit Credit A 3 B 2 C 1 D 1 I am no able to do that, as I can't group the description and have additional debit and credit columns -- I get them all in rows with blanks.

    Read the article

  • How can i lock images to a cell in excel 2010

    - by Jamie
    Ok, so i am using microsoft excel 2010 and have a set up currently where i have 2 views expanded and deflated using the Group or +/- function. My problem is that ui have images on the workbook too. The images are over the cells which are to be "hidden" when the - button is pressed and i would like the images to disappear with them. This is not curently happening instead they are moving to the next visible cell. I have included an example below incase i wasn't clear. I wish to hide Columns M:AU and the images are in various cells suchas N5 and O5. When i colapse (hide) the column range all of the images move to "AV5" the next row along that isn't hidden. This means the workbooks is looking messy when colapsed which is the oposite of what i was trying to do. Can anyone advise on a way around this?

    Read the article

  • Set an Excel cell's color based on multiple other cells' colors

    - by Lord Torgamus
    I have an Excel 2007 spreadsheet for a list of products and a bunch of factors to rate each one on, and I'm using Conditional Formatting to set the color of the cells in the individual attribute columns. It looks something like this: I want to fill in the rating column for each item with a color, based on the color ratings of its individual attributes. Examples of ways to determine this: the color of the category in which the item scored worst the statistical mode of the category colors the average of the category ratings, where each color is assigned a numerical value How can I implement any or all of the above rules? (I'm really just asking for a quick overview of the relevant Excel feature; I don't need step-by-step instructions for each rule.)

    Read the article

  • Regular expression in mySQL [migrated]

    - by Rayne
    I have a mysql table that has 2 columns - Column 1 contains a string value, and Column 2 contains the number of times that string value occurred. I'm trying to find the string abc.X.def, where the beginning of the string is "abc.", followed by one or more characters, then the string ".def". There could be more characters following ".def". How can I find such strings, then add the occurrence of such strings and display the results? For example, if I have abc.111.def23 1 abc.111.def 2 abc.22.def444 1 abc.111.def 1 Then I will get abc.111.def23 1 abc.111.def 3 abc.22.def444 1 Thank you.

    Read the article

  • Source File not updating Destination Files in Excel

    - by user127105
    I have one source file that holds all my input costs. I then have 30 to 40 destination files (costing sheets) that use links to data in this source file for their various formulae. I was sure when I started this system that any changes I made to the source file, including the insertion of new rows and columns was updated automatically by the destination files, such that the formula always pulled the correct input costs. Now all of a sudden if my destination files are closed and I change the structure of the source file by adding rows - the destination files go haywire? They pick up changes to their linked cells, but don't pick up changes to the source sheet that have shifted their relative positions in the sheet. Do I really need to open all 40 destination files at the same time I alter the source file structure? Further info: all the destination files are protected, and I am working on DropBox.

    Read the article

  • Many to many self join through junction table

    - by Peter
    I have an EF model that can self-reference through an intermediary class to define a parent/child relationship. I know how to do a pure many-to-many relationship using the Map command, but for some reason going through this intermediary class is causing problems with my mappings. The intermediary class provides additional properties for the relationship. See the classes, modelBinder logic and error below: public class Equipment { [Key] public int EquipmentId { get; set; } public virtual List<ChildRecord> Parents { get; set; } public virtual List<ChildRecord> Children { get; set; } } public class ChildRecord { [Key] public int ChildId { get; set; } [Required] public int Quantity { get; set; } [Required] public Equipment Parent { get; set; } [Required] public Equipment Child { get; set; } } I've tried building the mappings in both directions, though I only keep one set in at a time: modelBuilder.Entity<ChildRecord>() .HasRequired(x => x.Parent) .WithMany(x => x.Children ) .WillCascadeOnDelete(false); modelBuilder.Entity<ChildRecord>() .HasRequired(x => x.Child) .WithMany(x => x.Parents) .WillCascadeOnDelete(false); OR modelBuilder.Entity<Equipment>() .HasMany(x => x.Parents) .WithRequired(x => x.Child) .WillCascadeOnDelete(false); modelBuilder.Entity<Equipment>() .HasMany(x => x.Children) .WithRequired(x => x.Parent) .WillCascadeOnDelete(false); Regardless of which set I use, I get the error: The foreign key component 'Child' is not a declared property on type 'ChildRecord'. Verify that it has not been explicitly excluded from the model and that it is a valid primitive property. when I try do deploy my ef model to the database. If I build it without the modelBinder logic in place then I get two ID columns for Child and two ID columns for Parent in my ChildRecord table. This makes sense since it tries to auto create the navigation properties from Equipment and doesn't know that there are already properties in ChildRecord to fulfill this need. I tried using Data Annotations on the class, and no modelBuilder code, this failed with the same error as above: [Required] [ForeignKey("EquipmentId")] public Equipment Parent { get; set; } [Required] [ForeignKey("EquipmentId")] public Equipment Child { get; set; } AND [InverseProperty("Child")] public virtual List<ChildRecord> Parents { get; set; } [InverseProperty("Parent")] public virtual List<ChildRecord> Children { get; set; } I've looked at various other answers around the internet/SO, and the common difference seems to be that I am self joining where as all the answers I can find are for two different types. Entity Framework Code First Many to Many Setup For Existing Tables Many to many relationship with junction table in Entity Framework? Creating many to many junction table in Entity Framework

    Read the article

  • How can I import tasks into Project that have already been started?

    - by unknown
    I am writing a feature to import tasks from an online bug tracking / project management tool into Microsoft Project, primarily for resource leveling. Currently I am importing all tasks in as Fixed work, and giving them an assignment to a single resource for 100% of the work. The duration is then dynamically calculated, which at import time is equal to the amount of work. However, I am not a project manager by any means, and am having difficulty on how to get the start dates to calculate correctly. I've never used Project either. I am using Schedule From Start and setting the Project Start Date to the date the contract was signed / work was approved. However, this can be in the past, and I do not want current tasks scheduled from that date. Should it be today then? Another problem I have is with tasks that were already started. I have remaining work set, and I was placing a constraint on them to be started on the day the work was first applied. However, the remaining work for the task would be scheduled from that date, which was sometimes in the past. Using task constraints, a project start date, and whatever other settings available to me that I don't know about, what is the correct way to have the tasks scheduled?

    Read the article

  • Windows 7 Enterprise, Service Pack 1. Software MS Office Excel 2010

    - by user327560
    In Excel I understand there is no mechanism to customise & re-label the Rows & Columns (i.e. Renaming Col. A to some text like "Item Number" and so on. My question is regarding if it's possible to start Row Numbering at zero, or to determine a pre-allocated number of rows which contain my Headers, and then the first Row with the detail is infact seen as Row 1? Reason for question is I work multiple INternational Projects and we use Excel to trsack alot of activities & issues. Oddly, many people will refer to, for example "Point 7"... Some people mean the ID 7 (which I have the first Column dedicated to ID Number), some mean Excel Row 7, which infact could be really ID 3, or 4 from Col. A.... Any easy way or workaround to just use the Excel Row Numbers but select from when Row 1 is counted?

    Read the article

  • Do I need to manually create indexes for a DBIx::Class belongs_to relationship

    - by Dancrumb
    I'm using the DBIx::Class modules for an ORM approach to an application I have. I'm having some problems with my relationships. I have the following package MySchema::Result::ClusterIP; use strict; use warnings; use base qw/DBIx::Class::Core/; our $VERSION = '1.0'; __PACKAGE__->load_components(qw/InflateColumn::Object::Enum Core/); __PACKAGE__->table('cluster_ip'); __PACKAGE__->add_columns( # Columns here ); __PACKAGE__->set_primary_key('objkey'); __PACKAGE__->belongs_to( 'configuration' => 'MySchema::Result::Configuration', 'config_key'); __PACKAGE__->belongs_to( 'cluster' => 'MySchema::Result::Cluster', { 'foreign.config_key' => 'self.config_key', 'foreign.id' => 'self.cluster_id' } ); As well as package MySchema::Result::Cluster; use strict; use warnings; use base qw/DBIx::Class::Core/; our $VERSION = '1.0'; __PACKAGE__->load_components(qw/InflateColumn::Object::Enum Core/); __PACKAGE__->table('cluster'); __PACKAGE__->add_columns( # Columns here ); __PACKAGE__->set_primary_key('objkey'); __PACKAGE__->belongs_to( 'configuration' => 'MySchema::Result::Configuration', 'config_key'); __PACKAGE__->has_many('cluster_ip' => 'MySchema::Result::ClusterIP', { 'foreign.config_key' => 'self.config_key', 'foreign.cluster_id' => 'self.id' }); There are a couple of other modules, but I don't believe that they are relevant. When I attempt to deploy this schema, I get the following error: DBIx::Class::Schema::deploy(): DBI Exception: DBD::mysql::db do failed: Can't create table 'test.cluster_ip' (errno: 150) [ for Statement "CREATE TABLE `cluster_ip` ( `objkey` smallint(5) unsigned NOT NULL auto_increment, `config_key` smallint(5) unsigned NOT NULL, `cluster_id` char(16) NOT NULL, INDEX `cluster_ip_idx_config_key_cluster_id` (`config_key`, `cluster_id`), INDEX `cluster_ip_idx_config_key` (`config_key`), PRIMARY KEY (`objkey`), CONSTRAINT `cluster_ip_fk_config_key_cluster_id` FOREIGN KEY (`config_key`, `cluster_id`) REFERENCES `cluster` (`config_key`, `id`) ON DELETE CASCADE ON UPDATE CASCADE, CONSTRAINT `cluster_ip_fk_config_key` FOREIGN KEY (`config_key`) REFERENCES `configuration` (`config_key`) ON DELETE CASCADE ON UPDATE CASCADE ) ENGINE=InnoDB"] at test_deploy.pl line 18 (running "CREATE TABLE `cluster_ip` ( `objkey` smallint(5) unsigned NOT NULL auto_increment, `config_key` smallint(5) unsigned NOT NULL, `cluster_id` char(16) NOT NULL, INDEX `cluster_ip_idx_config_key_cluster_id` (`config_key`, `cluster_id`), INDEX `cluster_ip_idx_config_key` (`config_key`), PRIMARY KEY (`objkey`), CONSTRAINT `cluster_ip_fk_config_key_cluster_id` FOREIGN KEY (`config_key`, `cluster_id`) REFERENC ES `cluster` (`config_key`, `id`) ON DELETE CASCADE ON UPDATE CASCADE, CONSTRAINT `cluster_ip_fk_config_key` FOREIGN KEY (`config_key`) REFERENCES `configuration` (`conf ig_key`) ON DELETE CASCADE ON UPDATE CASCADE ) ENGINE=InnoDB") at test_deploy.pl line 18 From what I can tell, MySQL is complaining about the FOREIGN KEY constraint, in particular, the REFERENCE to (config_key, id) in the cluster table. From my reading of the MySQL documentation, this seems like a reasonable complaint, especially in regards to the third bullet point on this doc page. Here's my question. Am I missing something in the DBIx::Class module? I realize that I could explicitly create the necessary index to match up with this foreign key constraint, but that seems to be repetitive work. Is there something I should be doing to make this occur implicitly?

    Read the article

  • StoreGeneratedPattern T4 EntityFramework concern

    - by LoganWolfer
    Hi everyone, Here's the situation : I use SQL Server 2008 R2, SQL Replication, Visual Studio 2010, EntityFramework 4, C# 4. The course-of-action from our DBA is to use a rowguid column for SQL Replication to work with our setup. These columns need to have a StoreGeneratedPattern property set to Computed on every one of these columns. The problem : Every time the T4 template regenerate our EDMX (ADO.NET Entity Data Model) file (for example, when we update it from our database), I need to go manually in the EDMX XML file to add this property to every one of them. It has to go from this : <Property Name="rowguid" Type="uniqueidentifier" Nullable="false" /> To this : <Property Name="rowguid" Type="uniqueidentifier" Nullable="false" StoreGeneratedPattern="Computed"/> The solution : I'm trying to find a way to customize an ADO.NET EntityObject Generator T4 file to generate a StoreGeneratedPattern="Computed" to every rowguid that I have. I'm fairly new to T4, I only did customization to AddView and AddController T4 templates for ASP.NET MVC 2, like List.tt for example. I've looked through the EF T4 file, and I can't seem to find through this monster where I could do that (and how). My best guess is somewhere in this part of the file, line 544 to 618 of the original ADO.NET EntityObject Generator T4 file : //////// //////// Write PrimitiveType Properties. //////// private void WritePrimitiveTypeProperty(EdmProperty primitiveProperty, CodeGenerationTools code) { MetadataTools ef = new MetadataTools(this); #> /// <summary> /// <#=SummaryComment(primitiveProperty)#> /// </summary><#=LongDescriptionCommentElement(primitiveProperty, 1)#> [EdmScalarPropertyAttribute(EntityKeyProperty=<#=code.CreateLiteral(ef.IsKey(primitiveProperty))#>, IsNullable=<#=code.CreateLiteral(ef.IsNullable(primitiveProperty))#>)] [DataMemberAttribute()] <#=code.SpaceAfter(NewModifier(primitiveProperty))#><#=Accessibility.ForProperty(primitiveProperty)#> <#=code.Escape(primitiveProperty.TypeUsage)#> <#=code.Escape(primitiveProperty)#> { <#=code.SpaceAfter(Accessibility.ForGetter(primitiveProperty))#>get { <#+ if (ef.ClrType(primitiveProperty.TypeUsage) == typeof(byte[])) { #> return StructuralObject.GetValidValue(<#=code.FieldName(primitiveProperty)#>); <#+ } else { #> return <#=code.FieldName(primitiveProperty)#>; <#+ } #> } <#=code.SpaceAfter(Accessibility.ForSetter((primitiveProperty)))#>set { <#+ if (ef.IsKey(primitiveProperty)) { if (ef.ClrType(primitiveProperty.TypeUsage) == typeof(byte[])) { #> if (!StructuralObject.BinaryEquals(<#=code.FieldName(primitiveProperty)#>, value)) <#+ } else { #> if (<#=code.FieldName(primitiveProperty)#> != value) <#+ } #> { <#+ PushIndent(CodeRegion.GetIndent(1)); } #> <#=ChangingMethodName(primitiveProperty)#>(value); ReportPropertyChanging("<#=primitiveProperty.Name#>"); <#=code.FieldName(primitiveProperty)#> = StructuralObject.SetValidValue(value<#=OptionalNullableParameterForSetValidValue(primitiveProperty, code)#>); ReportPropertyChanged("<#=primitiveProperty.Name#>"); <#=ChangedMethodName(primitiveProperty)#>(); <#+ if (ef.IsKey(primitiveProperty)) { PopIndent(); #> } <#+ } #> } } private <#=code.Escape(primitiveProperty.TypeUsage)#> <#=code.FieldName(primitiveProperty)#><#=code.StringBefore(" = ", code.CreateLiteral(primitiveProperty.DefaultValue))#>; partial void <#=ChangingMethodName(primitiveProperty)#>(<#=code.Escape(primitiveProperty.TypeUsage)#> value); partial void <#=ChangedMethodName(primitiveProperty)#>(); <#+ } Any help would be appreciated. Thanks in advance. EDIT : Didn't find answer to this problem yet, if anyone have ideas to automate this, would really be appreciated.

    Read the article

  • Ubuntu Volume overriding settings set in Alsamixer

    - by Hayek
    Problem: How do I "lock in" the volume I set through alsamixer? I'm running Ubuntu 9.10. I adjusted the bass/treble columns in alsamixer but changing the system volume resets them all back to 100% I did save the settings by running alsactl store but everything is reset once I touch Ubuntu's volume icon in the top menu bar. This is rather painful because the computer is hooked up to a 650watt system with a massive subwoofer. As much as I enjoy my music, there's no need to have the walls vibrate :) What can I do to prevent Ubuntu from overriding the settings?

    Read the article

  • How change the layout (e.g. background-color) of autoplaylists in foobar2000?

    - by UdeF
    A nice feature of the highly customizable music player foobar2000 is to generate autoplaylists. Autoplaylists are filtered lists of music that automatically update when you add new music to your collection. You would usually generate one by searching for something and saving it as new autoplaylists, e.g.: %added% DURING LAST 4 WEEKS %genre% HAS jazz OR %genre% HAS downtempo %date% GREATER 1949 AND %date% LESS 1970 Autoplaylist playlists are locked: You can't add or delete files. You can note that thanks to the little icon in the status bar at the bottom of your screen: foobar2000 let's you customize nearly everything, so here is my question: Is there a way to change the layout of the autoplaylists? For example i want to change the background-color in my playlist view. I use the Columns UI component.

    Read the article

  • Pivot tables in excel

    - by andreas
    Hey GUYS i have my account bank account statement and what i wanna do is group the description oof transactions together with their debit or credit and sum their total . So that i can see that for ebay.com my total debit was 2000 $ etc... no the data are like this (btw how do you format this?) Description Debit Credit A 1 B 1 A 1 B 1 C 1 D 1 A 1 ETC.... what i wanna do is using a pivot table Description Debit Credit A 3 B 2 C 1 D 1 I can seem to be able to do that as i cant group the description and have additional debit and credit columns.....as i get them all in rows with blanks

    Read the article

  • How can I create matrices of data in Excel?

    - by sandeep
    I want to create a 4*4 matrix in excel 2007 by taking three or more columns or conditions for example Column index Row index Name 1 2 x 2 3 y 3 4 z 4 1 p this is how data looks and i want it for 1*1 cell as p and 1*2 cell as x and so on. and I want out put as follows matrix 1 2 3 4 1 p x y z 2 p x y z 3 p x y z 4 p x y z and I have very huge data like this some times the matrix size goes up to 60*60 also.

    Read the article

  • C# - Must declare the scalar variable "@ms_id" - Error

    - by user1075106
    I'm writing an web-app that keeps track of deadlines. With this app you have to be able to update records that are being saved in an SQL DB. However I'm having some problem with my update in my aspx-file. <asp:GridView ID="gv_editMilestones" runat="server" DataSourceID="sql_ds_milestones" CellPadding="4" ForeColor="#333333" GridLines="None" Font-Size="Small" AutoGenerateColumns="False" DataKeyNames="id" Visible="false" onrowupdated="gv_editMilestones_RowUpdated" onrowupdating="gv_editMilestones_RowUpdating" onrowediting="gv_editMilestones_RowEditing"> <RowStyle BackColor="#F7F6F3" ForeColor="#333333" /> <Columns> <asp:CommandField ShowEditButton="True" /> <asp:BoundField DataField="id" HeaderText="id" SortExpression="id" ReadOnly="True" Visible="false"/> <asp:BoundField DataField="ms_id" HeaderText="ms_id" SortExpression="ms_id" ReadOnly="True"/> <asp:BoundField DataField="ms_description" HeaderText="ms_description" SortExpression="ms_description"/> <%-- <asp:BoundField DataField="ms_resp_team" HeaderText="ms_resp_team" SortExpression="ms_resp_team"/>--%> <asp:TemplateField HeaderText="ms_resp_team" SortExpression="ms_resp_team"> <ItemTemplate> <%# Eval("ms_resp_team") %> </ItemTemplate> <EditItemTemplate> <asp:DropDownList ID="DDL_ms_resp_team" runat="server" DataSourceID="sql_ds_ms_resp_team" DataTextField="team_name" DataValueField="id"> <%--SelectedValue='<%# Bind("ms_resp_team") %>'--%> </asp:DropDownList> </EditItemTemplate> </asp:TemplateField> <asp:BoundField DataField="ms_focal_point" HeaderText="ms_focal_point" SortExpression="ms_focal_point" /> <asp:BoundField DataField="ms_exp_date" HeaderText="ms_exp_date" SortExpression="ms_exp_date" DataFormatString="{0:d}"/> <asp:BoundField DataField="ms_deal" HeaderText="ms_deal" SortExpression="ms_deal" ReadOnly="True"/> <asp:CheckBoxField DataField="ms_active" HeaderText="ms_active" SortExpression="ms_active"/> </Columns> <FooterStyle BackColor="#CCCC99" /> <PagerStyle BackColor="#F7F7DE" ForeColor="Black" HorizontalAlign="Right" /> <SelectedRowStyle BackColor="#CE5D5A" Font-Bold="True" ForeColor="White" /> <HeaderStyle BackColor="#5D7B9D" Font-Bold="True" ForeColor="White" /> <AlternatingRowStyle BackColor="White" /> <EditRowStyle BackColor="#999999" /> </asp:GridView> <asp:SqlDataSource ID="sql_ds_milestones" runat="server" ConnectionString="<%$ ConnectionStrings:testServer %>" SelectCommand="SELECT [id] ,[ms_id] ,[ms_description] ,(SELECT [team_name] FROM [NSBP].[dbo].[tbl_teams] as teams WHERE milestones.[ms_resp_team] = teams.[id]) as 'ms_resp_team' ,[ms_focal_point] ,[ms_exp_date] ,(SELECT [deal] FROM [NSBP].[dbo].[tbl_deals] as deals WHERE milestones.[ms_deal] = deals.[id]) as 'ms_deal' ,[ms_active] FROM [NSBP].[dbo].[tbl_milestones] as milestones" UpdateCommand="UPDATE [NSBP].[dbo].[tbl_milestones] SET [ms_description] = @ms_description ,[ms_focal_point] = @ms_focal_point ,[ms_active] = @ms_active WHERE [ms_id] = @ms_id"> <UpdateParameters> <asp:Parameter Name="ms_description" Type="String" /> <%-- <asp:Parameter Name="ms_resp_team" Type="String" />--%> <asp:Parameter Name="ms_focal_point" Type="String" /> <asp:Parameter Name="ms_exp_date" Type="DateTime" /> <asp:Parameter Name="ms_active" Type="Boolean" /> <%-- <asp:Parameter Name="ms_id" Type="String" />--%> </UpdateParameters> </asp:SqlDataSource> You can see my complete GridView-structure + my datasource bound to this GridView. There is nothing written in my onrowupdating-function in my code-behind file. Thx in advance

    Read the article

  • Recomposing data structure in Excel

    - by Velletti
    I've got a sheet of 35k rows of the following kind of data that I want to reshape into table below. So, I want to reshape this data in a way to get all the people within a specific GroupID in separate columns. I suppose that I should add a counter for each row within specific group id? Also, I suppose these kind of issues are a lot more comfortable to be done in databases? Since I often have this kind of data, I need be much quicker about solving it, then I am now.

    Read the article

  • Mysql InnoDB and quickly applying large updates

    - by Tim
    Basically my problem is that I have a large table of about 17,000,000 products that I need to apply a bunch of updates to really quickly. The table has 30 columns with the id set as int(10) AUTO_INCREMENT. I have another table which all of the updates for this table are stored in, these updates have to be pre-calculated as they take a couple of days to calculate. This table is in the format of [ product_id int(10), update_value int(10) ]. The strategy I'm taking to issue these 17 million updates quickly is to load all of these updates into memory in a ruby script and group them in a hash of arrays so that each update_value is a key and each array is a list of sorted product_id's. { 150: => [1,2,3,4,5,6], 160: => [7,8,9,10] } Updates are then issued in the format of UPDATE product SET update_value = 150 WHERE product_id IN (1,2,3,4,5,6); UPDATE product SET update_value = 160 WHERE product_id IN (7,8,9,10); I'm pretty sure I'm doing this correctly in the sense that issuing the updates on sorted batches of product_id's should be the optimal way to do it with mysql / innodb. I'm hitting a weird issue though where when I was testing with updating ~13 million records, this only took around 45 minutes. Now I'm testing with more data, ~17 million records and the updates are taking closer to 120 minutes. I would have expected some sort of speed decrease here but not to the degree that I'm seeing. Any advice on how I can speed this up or what could be slowing me down with this larger record set? As far as server specs go they're pretty good, heaps of memory / cpu, the whole DB should fit into memory with plenty of room to grow.

    Read the article

  • How to lookup a value in a table with multiple criteria

    - by php-b-grader
    I have a data sheet with multiple values in multiple columns. I have a qty and a current price which when multiplied out gives me the current revenue (CurRev). I want to use this lookup table to give me the new revenue (NewRev) from the new price but can't figure out how to do multiple ifs in a lookup. What I want is to build a new column that checks the "Product", "Tier" and "Location/State" and gives me the new price from the lookup table (above) and then multiply that by the qty. e.g. Data > Product, Tier, Location, Qty, CurRev, NewRev > Product1, Tier1, VIC, 2, $1000.00, $6000 (2 x $3000) > Product2, Tier3, NSW, 1, $100.00, $200 (1 x $200) > Product1, Tier3, SA, 5, $250.00, $750 (5 x $150) > Product3, Tier1, ACT, 5, $100.00, $500(5 x $100) > Product2, Tier3, QLD, 2, $150.00, $240 (2 x $240) Worst case, if I just get the new rate I can create another column

    Read the article

  • Unable to get my master & details gridview to work.

    - by Javier
    I'm unable to get this to work. I'm very new at programming and would appreciate any help on this. <%@ Page Language="C#" %> <!DOCTYPE html PUBLIC "-//W3C//DTD XHTML 1.0 Transitional//EN" "http://www.w3.org/TR/xhtml1/DTD/xhtml1-transitional.dtd"> <script runat="server"> protected void Page_Load(object sender, EventArgs e) { } protected void DataGridSqlDataSource_Selecting(object sender, SqlDataSourceSelectingEventArgs e) { } </script> <html xmlns="http://www.w3.org/1999/xhtml"> <head runat="server"> <title>Untitled Page</title> </head> <body> <form id="form1" runat="server"> <div> <asp:SqlDataSource ID="DataGrid2SqlDataSource" runat="server" ConnectionString="<%$ ConnectionStrings:JobPostings1ConnectionString %>" SelectCommand="SELECT [Jobs_PK], [Position_Title], [Educ_Level], [Grade], [JP_Description], [Job_Status], [Position_ID] FROM [Jobs]" FilterExpression="Jobs_PK='@Jobs_PK'"> <filterparameters> <asp:ControlParameter Name="Jobs_PK" ControlId="GridView1" PropertyName="SelectedValue" /> </filterparameters> </asp:SqlDataSource> <asp:SqlDataSource ID="DataGridSqlDataSource" runat="server" ConnectionString="<%$ ConnectionStrings:JobPostings1ConnectionString %>" SelectCommand="SELECT [Position_Title], [Jobs_PK] FROM [Jobs]" onselecting="DataGridSqlDataSource_Selecting"> </asp:SqlDataSource> <asp:GridView ID="GridView1" runat="server" AutoGenerateColumns="False" DataKeyNames="Jobs_PK" DataSourceID="DataGridSqlDataSource" AllowPaging="True" AutoGenerateSelectButton="True" SelectedIndex="0" Width="100px"> <Columns> <asp:BoundField DataField="Position_Title" HeaderText="Position_Title" SortExpression="Position_Title" /> <asp:BoundField DataField="Jobs_PK" HeaderText="Jobs_PK" InsertVisible="False" ReadOnly="True" SortExpression="Jobs_PK" /> </Columns> </asp:GridView> <br /> <asp:DetailsView ID="DetailsView1" runat="server" AutoGenerateRows="False" DataKeyNames="Jobs_PK" DataSourceID="DataGrid2SqlDataSource" Height="50px" Width="125px"> <Fields> <asp:BoundField DataField="Jobs_PK" HeaderText="Jobs_PK" InsertVisible="False" ReadOnly="True" SortExpression="Jobs_PK" /> <asp:BoundField DataField="Position_Title" HeaderText="Position_Title" SortExpression="Position_Title" /> <asp:BoundField DataField="Educ_Level" HeaderText="Educ_Level" SortExpression="Educ_Level" /> <asp:BoundField DataField="Grade" HeaderText="Grade" SortExpression="Grade" /> <asp:BoundField DataField="JP_Description" HeaderText="JP_Description" SortExpression="JP_Description" /> <asp:BoundField DataField="Job_Status" HeaderText="Job_Status" SortExpression="Job_Status" /> <asp:BoundField DataField="Position_ID" HeaderText="Position_ID" SortExpression="Position_ID" /> </Fields> </asp:DetailsView> </div> </form> </body> error message: Cannot perform '=' operation on System.Int32 and System.String. Description: An unhandled exception occurred during the execution of the current web request. Please review the stack trace for more information about the error and where it originated in the code. Exception Details: System.Data.EvaluateException: Cannot perform '=' operation on System.Int32 and System.String.

    Read the article

  • Can I insert rows next to a locked column in Excel?

    - by Tom
    If I lock cells A1:A3000, is there a way to insert rows in columns B-Z? I highlight them and I don't get the option to insert even though it is selected in the lock options. (Bottom line is that I need column A static, not to move.) Any ideas? Is it even possible? Better yet, is there any way to have formulas in column A static, as I insert rows in column B? Column A formulas change cell location when I do so.

    Read the article

  • What is a good "free-form" ("type anywhere" or canvas-like) text editor? [on hold]

    - by scorpiodawg
    My 5-1/2 y.o. son is starting to use a computer and one of the things he likes to do is to type stuff into an editor. He has used TuxPaint before and is familiar with the idea of a "canvas" for painting stuff (where painting anything anywhere on the canvas is fair game). When he opened the text editor (this was gedit on Qimo Linux), he attempted to do the same thing -- he pointed the text cursor to an arbitrary location within the editor window and expected to be able to type there (like a "text canvas", if you will). I had to explain to him that he would have to press Enter a few times to create new lines, as well as press Space a few times to create columns before he could do that. This is sub-optimal. My question: are there any free-form, canvas-like text editors that I can have him use? Almost like hex editors of yore. I am not interested in getting him to create "text areas" in a paint program.

    Read the article

  • Merged rows in column, bottom row fixed height

    - by Styxxy
    I've been struggling some time now with a specific problem using Tables in MS Word (2010). I have a table with 2 rows and 2 columns and the last column, the rows are merged. Now it can happen that this last cell will expand, and I would like to have the last row in the first column to be of a fixed height and the first row has to expand. What happens now is that the last row expands and the first row has a "fixed" height. A picture of the behaviour at this moment: And this is how I would like it to behave: I have been looking through all properties and settings, but I don't seem to find any option. Neither can I found anything by searching online (probably not using the exact right keywords). Any help is appreciated.

    Read the article

  • Easily Plotting Multiple Data Series in Excel

    - by John
    I really need help figuring out how to speed up graphing multiple series on a graph. I have seperate devices that give monthly readings for several variables like pressure, temperature, and salinity. Each of these variables is going to be its own graph with devices being the series. My x-axis is going to be the dates that these values were taken. The problem is that it takes ages to do this for each spreadsheet since I have monthly dates from 1950 up to the present and I have about 50 devices in each spreadsheet. I also have graphs for calculated values that are in columns next to them. Each of these devices is going to become a data series in the graph. E.g. In one of my graphs I have all the pressures from the devices and each of the data series' names is the name of the device. I want a fast way to do this. Doing this manually is taking a very long time. Please help! Is there any easier way to do this? It is consistent and the dates all line up. I am just repeating the same clicks over and over again Thank you!

    Read the article

  • Excel: Find a specific cell and paste the value from a control cell into it

    - by G-Edinburgh
    I have two columns one containing the room number, e.g. B-CL102, the other containing a varying integer. I want to enter a different, manually determined, integer in a third column. Whether by macro or native Excel, is there a way to use two control cells at the top of the sheet, type the room number into one and the different integer matching that room into another. I have minimal experience with macros essentially just the basics. I tried to use a V-Lookup formula to look at the two control cells (Range) and then fill in the new column, however I don't know how to then fix that value so that it doesn't change when I change the values in the control cells.

    Read the article

< Previous Page | 164 165 166 167 168 169 170 171 172 173 174 175  | Next Page >