Search Results

Search found 10883 results on 436 pages for 'ms expression'.

Page 182/436 | < Previous Page | 178 179 180 181 182 183 184 185 186 187 188 189  | Next Page >

  • Twitter 2 for Android crash every time I try uploading multi photos [closed]

    - by Hazz
    Hello, I'm using the new Twitter 2 on Android 2.1. Whenever I hit the button which enables me to upload multiple photos in a single tweet, I always get the error "The application Camera (process com.sonyericsson.camera) has stopped unexpectidly. Please try again". However, uploading a single photo using the camera button in Twitter have no problem, it works. My phone is Sony Ericsson x10 mini pro. I tried signing out and back in, same result. Anything I can do to fix this? This is the log info I got using Log Collector: 02-23 15:05:57.328 I/ActivityManager( 1240): Starting activity: Intent { act=com.twitter.android.post.status cmp=com.twitter.android/.PostActivity } 02-23 15:05:57.338 D/PhoneWindow(15095): couldn't save which view has focus because the focused view com.android.internal.policy.impl.PhoneWindow$DecorView@45726938 has no id. 02-23 15:05:57.688 I/ActivityManager( 1240): Displayed activity com.twitter.android/.PostActivity: 340 ms (total 340 ms) 02-23 15:05:59.018 I/ActivityManager( 1240): Starting activity: Intent { act=android.intent.action.PICK typ=vnd.android.cursor.dir/image cmp=com.sonyericsson.camera/com.sonyericsson.album.grid.GridActivity } 02-23 15:05:59.038 I/ActivityManager( 1240): Start proc com.sonyericsson.camera for activity com.sonyericsson.camera/com.sonyericsson.album.grid.GridActivity: pid=15113 uid=10057 gids={1006, 1015, 3003} 02-23 15:05:59.128 I/dalvikvm(15113): Debugger thread not active, ignoring DDM send (t=0x41504e4d l=38) 02-23 15:05:59.158 I/dalvikvm(15113): Debugger thread not active, ignoring DDM send (t=0x41504e4d l=50) 02-23 15:05:59.448 I/ActivityManager( 1240): Displayed activity com.sonyericsson.camera/com.sonyericsson.album.grid.GridActivity: 423 ms (total 423 ms) 02-23 15:05:59.458 W/dalvikvm(15113): threadid=15: thread exiting with uncaught exception (group=0x4001e160) 02-23 15:05:59.458 E/AndroidRuntime(15113): Uncaught handler: thread AsyncTask #1 exiting due to uncaught exception 02-23 15:05:59.468 E/AndroidRuntime(15113): java.lang.RuntimeException: An error occured while executing doInBackground() 02-23 15:05:59.468 E/AndroidRuntime(15113): at android.os.AsyncTask$3.done(AsyncTask.java:200) 02-23 15:05:59.468 E/AndroidRuntime(15113): at java.util.concurrent.FutureTask$Sync.innerSetException(FutureTask.java:273) 02-23 15:05:59.468 E/AndroidRuntime(15113): at java.util.concurrent.FutureTask.setException(FutureTask.java:124) 02-23 15:05:59.468 E/AndroidRuntime(15113): at java.util.concurrent.FutureTask$Sync.innerRun(FutureTask.java:307) 02-23 15:05:59.468 E/AndroidRuntime(15113): at java.util.concurrent.FutureTask.run(FutureTask.java:137) 02-23 15:05:59.468 E/AndroidRuntime(15113): at java.util.concurrent.ThreadPoolExecutor.runWorker(ThreadPoolExecutor.java:1068) 02-23 15:05:59.468 E/AndroidRuntime(15113): at java.util.concurrent.ThreadPoolExecutor$Worker.run(ThreadPoolExecutor.java:561) 02-23 15:05:59.468 E/AndroidRuntime(15113): at java.lang.Thread.run(Thread.java:1096) 02-23 15:05:59.468 E/AndroidRuntime(15113): Caused by: java.lang.IllegalArgumentException: Unsupported MIME type. 02-23 15:05:59.468 E/AndroidRuntime(15113): at com.sonyericsson.album.grid.GridActivity$AlbumTask.doInBackground(GridActivity.java:202) 02-23 15:05:59.468 E/AndroidRuntime(15113): at com.sonyericsson.album.grid.GridActivity$AlbumTask.doInBackground(GridActivity.java:124) 02-23 15:05:59.468 E/AndroidRuntime(15113): at android.os.AsyncTask$2.call(AsyncTask.java:185) 02-23 15:05:59.468 E/AndroidRuntime(15113): at java.util.concurrent.FutureTask$Sync.innerRun(FutureTask.java:305) 02-23 15:05:59.468 E/AndroidRuntime(15113): ... 4 more 02-23 15:05:59.628 E/SemcCheckin(15113): Get crash dump level : java.io.FileNotFoundException: /data/semc-checkin/crashdump 02-23 15:05:59.628 W/ActivityManager( 1240): Unable to start service Intent { act=com.sonyericsson.android.jcrashcatcher.action.BUGREPORT_AUTO cmp=com.sonyericsson.android.jcrashcatcher/.JCrashCatcherService (has extras) }: not found 02-23 15:05:59.648 I/Process ( 1240): Sending signal. PID: 15113 SIG: 3 02-23 15:05:59.648 I/dalvikvm(15113): threadid=7: reacting to signal 3 02-23 15:05:59.778 I/dalvikvm(15113): Wrote stack trace to '/data/anr/traces.txt' 02-23 15:06:00.388 E/SemcCheckin( 1673): Get Crash Level : java.io.FileNotFoundException: /data/semc-checkin/crashdump 02-23 15:06:01.708 I/DumpStateReceiver( 1240): Added state dump to 1 crashes 02-23 15:06:02.008 D/iddd-events( 1117): Registering event com.sonyericsson.idd.probe.android.devicemonitor::ApplicationCrash with 4314 bytes payload. 02-23 15:06:06.968 D/dalvikvm( 1673): GC freed 661 objects / 126704 bytes in 124ms 02-23 15:06:11.928 D/dalvikvm( 1379): GC freed 19753 objects / 858832 bytes in 84ms 02-23 15:06:13.038 I/Process (15113): Sending signal. PID: 15113 SIG: 9 02-23 15:06:13.048 I/WindowManager( 1240): WIN DEATH: Window{4596ecc0 com.sonyericsson.camera/com.sonyericsson.album.grid.GridActivity paused=false} 02-23 15:06:13.048 I/ActivityManager( 1240): Process com.sonyericsson.camera (pid 15113) has died. 02-23 15:06:13.048 I/WindowManager( 1240): WIN DEATH: Window{459db5e8 com.sonyericsson.camera/com.sonyericsson.album.grid.GridActivity paused=false} 02-23 15:06:13.078 I/UsageStats( 1240): Unexpected resume of com.twitter.android while already resumed in com.sonyericsson.camera 02-23 15:06:13.098 W/InputManagerService( 1240): Window already focused, ignoring focus gain of: com.android.internal.view.IInputMethodClient$Stub$Proxy@456e7168 02-23 15:06:21.278 D/dalvikvm( 1745): GC freed 2032 objects / 410848 bytes in 60ms

    Read the article

  • Can GoogleApps exist with Exchange 2003

    - by Adam M.
    I am looking at the next step in our Groupware solutions. Rather got with a conventional add a new MS Server/MS Exchange to allow for growth and expanding offices. Could an Office operate with both an existing Exchange server setup and migrate a portion of mailboxes to the GoogleApps platform? I want to see if the we could use the GoogleApps for managers and larger mailboxes, and leave a large amount of small mailboxes on the existing hardware that is configured for Exchange/outlook? Can the two co-exist in an longterm configuration, where they can 'play nice' together? Is there any options that would allow for for this and would this have limitations? Such as the Free/busy connectors (Calendaring)? Is there any pitfalls for this type of design? Thanks

    Read the article

  • What can cause peaks in pagetables in /proc/meminfo ?

    - by Fuzzy76
    I have a gameserver running Debian Lenny on a VPS host. Even when experiencing a fairly low load, the players start experiencing major lag (ping times rise from 50 ms to 150-500 ms) in bursts of 3 - 10 seconds. I have installed Munin server monitoring, but when looking at the graphs it looks like the server has plenty of CPU, RAM and bandwidth available. The only weird thing I noticed is some peaks in the memory graph attributed to "page_tables" which maps to PageTables in /proc/meminfo but I can't find any good information on what this might mean. Any ideas what might be causing this? If you need any more graps, just let me know. The interrupts/second count is at roughly 400-600 during this period (nearly all from eth0). The drop in committed was caused by me trying to lower the allocated memory for the server from 512MB to 256MB, but that didn't seem to help.

    Read the article

  • Advanced Regex: Smart auto detect and replace URLs with anchor tags

    - by Robert Koritnik
    I've written a regular expression that automatically detects URLs in free text that users enter. This is not such a simple task as it may seem at first. Jeff Atwood writes about it in his post. His regular expression works, but needs extra code after detection is done. I've managed to write a regular expression that does everything in a single go. This is how it looks like (I've broken it down into separate lines to make it more understandable what it does): 1 (?<outer>\()? 2 (?<scheme>http(?<secure>s)?://)? 3 (?<url> 4 (?(scheme) 5 (?:www\.)? 6 | 7 www\. 8 ) 9 [a-z0-9] 10 (?(outer) 11 [-a-z0-9/+&@#/%?=~_()|!:,.;cšžcd]+(?=\)) 12 | 13 [-a-z0-9/+&@#/%?=~_()|!:,.;cšžcd]+ 14 ) 15 ) 16 (?<ending>(?(outer)\))) As you may see, I'm using named capture groups (used later in Regex.Replace()) and I've also included some local characters (cšžcd), that allow our localised URLs to be parsed as well. You can easily omit them if you'd like. Anyway. Here's what it does (referring to line numbers): 1 - detects if URL starts with open braces (is contained inside braces) and stores it in "outer" named capture group 2 - checks if it starts with URL scheme also detecting whether scheme is SSL or not 3 - start parsing URL itself (will store it in "url" named capture group) 4-8 - if statement that says: if "sheme" was present then www. part is optional, otherwise mandatory for a string to be a link (so this regular expression detects all strings that start with either http or www) 9 - first character after http:// or www. should be either a letter or a number (this can be extended if you'd like to cover even more links, but I've decided not to because I can't think of a link that would start with some obscure character) 10-14 - if statement that says: if "outer" (braces) was present capture everything up to the last closing braces otherwise capture all 15 - closes the named capture group for URL 16 - if open braces were present, capture closing braces as well and store it in "ending" named capture group First and last line used to have \s* in them as well, so user could also write open braces and put a space inside before pasting link. Anyway. My code that does link replacement with actual anchor HTML elements looks exactly like this: value = Regex.Replace( value, @"(?<outer>\()?(?<scheme>http(?<secure>s)?://)?(?<url>(?(scheme)(?:www\.)?|www\.)[a-z0-9](?(outer)[-a-z0-9/+&@#/%?=~_()|!:,.;cšžcd]+(?=\))|[-a-z0-9/+&@#/%?=~_()|!:,.;cšžcd]+))(?<ending>(?(outer)\)))", "${outer}<a href=\"http${secure}://${url}\">http${secure}://${url}</a>${ending}", RegexOptions.Compiled | RegexOptions.CultureInvariant | RegexOptions.IgnoreCase); As you can see I'm using named capture groups to replace link with an Anchor tag: "${outer}<a href=\"http${secure}://${url}\">http${secure}://${url}</a>${ending}" I could as well omit the http(s) part in anchor display to make links look friendlier, but for now I decided not to. Question I would like my links to be replaced with shortenings as well. So when user copies a very long link (for instance if they would copy a link from google maps that usually generates long links) I would like to shorten the visible part of the anchor tag. Link would work, but visible part of an anchor tag would be shortened to some number of characters. I could as well append ellipsis at the end of at all possible (and make things even more perfect). Does Regex.Replace() method support replacement notations so that I can still use a single call? Something similar as string.Format() method does when you'd like to format values in string format (decimals, dates etc...).

    Read the article

  • What is this "Change to Display" of math equations and why does it change the equation style in Word 2010?

    - by ysap
    I am writing an equation with the "new" Equation Editor in MS Word 2010 (Insert - Equation). When using one of the "large operators", for example the Sigma, with lower and upper limits, there are two styles for displaying the limits - below and above the Sigma, or to the right as super/subscripts. I am choosing the first style - limits above and below to get the standard notation, but Word formats the equation the other way. Now, the object has a bounding box with a context menu on its right. In this menu, I can select Change to Display and the equation is moved to a new line, w/o adjacent text - but, now the sigma limits appear as requested! Then, selecting Change to Inline reverts to the previous form. So, I want to know if there is away to force the requested form with an "inline" attribute? I know that I can use a MS Equation 3.0 object, but I want to remain with the new, "native" editor.

    Read the article

  • Windows 8, NVIDIA graphics recognition fails

    - by Roy Grubb
    I just installed Windows 8 Pro OEM 64-bit (clean install) and it won't properly recognize my graphics adapter. When I installed Win8, it automatically installed the BasicDisplay.sys driver dated 6/21/2006. 6.2.9200.16384 (win8_rtm.120725-1247). Hardware - Mobo:MSi G41M-P33 Combo CPU:Intel CoreDuo 6600 Graphics:NVIDIA GeForce 9400GT *OS* - Windows 8 Pro 64-bit OEM The graphics adapter worked fine in Windows XP. The PC is a generic box, bought locally and its mobo failed recently, so I replaced it with the G41M. Microsoft wouldn't let me re-activate Windows XP with a different mobo, so I installed Win8, which appears to work except as described next. Win8 only partially recognizes the graphics adapter and won't allow NVIDIA latest driver installer to see that it's an NVIDIA card. As a result, OpenGL doesn't work, and this is needed by the software I most use. Other than that the graphics look OK. When I say 'partially recognizes', I mean that via the Control Panel, I can see that the adapter is described as NVIDIA, but the driver remains stuck at Microsoft Basic Display Adapter no matter what I try, including "Update driver..." in adapter properties. Display Screen Resolution Advanced Settings Adapter shows: Adapter Type: Microsoft Basic Display Adapter Chip Type: NVIDIA DAC Type: NVIDIA Corporation Bios Information: G27 Board - p381n17 Don't know what this means ... no mention of 9400GT Total Available Graphics Memory: 256 MB Dedicated Video Memory: 0 MB In fact the adapter has 512MB on-board video memory. System Video Memory: 0 MB Shared System Memory: 256 MB And Control Panel Device Manager Display adapters just shows Microsoft Basic Display Adapter. No other graphics adapter, and no unknown device or yellow question mark. What I have tried so far: 1. Cleared CMOS and reset. Updated BIOS and all mobo drivers as follows: 1st I used Driver Reviver to see if any driver updates were required. It found some but I didn't use that to get the drivers. Then I switched to MSi's own mobo driver utility Live Update 5. This also showed the board needed to update several so I used it to fetch the new drivers. After that it showed that everything was up to date and I checked with Driver Reviver again, which also reported no drivers now needed updating. Rebooted. Went to the NVIDIA site to get the latest graphics adapter driver. Their auto-detect "Option 2: Automatically find drivers for my NVIDIA products" said "The NVIDIA Smart Scan was unable to evaluate your system hardware. Please use Option 1 to manually find drivers for your NVIDIA products." So I downloaded 310.70-desktop-win8-win7-winvista-64bit-international-whql.exe, which lists 9400 GT under supported products, but when I run it, it says: "NVIDIA Installer cannot continue This graphics driver could not find compatible graphics hardware." Connected the display to the on-board Intel graphics (G41 Intel Express), removed the NVIDIA card and rebooted, changed to internal graphics in CMOS. Again it installs the MS Basic Display Adapter, and can't properly run my s/w that needs OpenGL. It runs on other machines with Intel Express graphics (WinXP and 7) Shut down and pulled out the power cord. Held start button to discharge all capacitors. Removed and re-inserted NVIDIA adapter in PCI-E slot and made sure properly seated. Connected the monitor to the card, screwed plug to socket. Reconnected power cord. Started and checked in BIOS that Primary Graphics Adapter was set to PCI-E. Started Windows. Uninstalled MS Basic Display Adapter in Device Manager. Screen blanks briefly, reappears. No Graphics adapter entry was then visible in Device Manager. Restarted PC. MS Basic Display Adapter Visible again in Device Manager. Clicked in Device Manager View Show hidden devices. No other graphics adapter appears, no unknown devices. Rebooted. Tried Scan for Hardware changes. None detected. Tried right-click on MS Basic Display Adapter Properties Driver Update Driver... Search automatically. It replied that it had determined driver was up to date. I checked that there were no graphic driver-related entries in Programs and Features that I could delete (none). Searched for any other drivers with nvidia in their name and deleted them, just keeping the 306.97 installer exe file. Did a Windows Update. Ran GPU-Z which shows (main items): Microsoft Basic Display Adapter GPU G72 BIOS 5.72.22.76.88 Device ID 10DE - 01D5 DDR2 Bus Width 32 Bit Memory size 64MB Driver Version nvlddmkm 6.2.9200.16384 (ForceWare 0.00) / Win8 64 NVIDIA SLI Unknown in the drop-down at the foot, "Microsoft Basic Display Adapter" is the only option If I swap hard disks in that machine to one with a Ubuntu 10.4 installation (originally installed on the same PC), lspci shows "VGA compatible controller as NVIDIA Corporation Device 01d5 (rev a1) (prog-if 00 [VGA controller])" and "kernel driver in use: nvidia" I'm out of ideas for new things to try and would be really grateful of suggestions. Thanks!

    Read the article

  • Long string insertion with sed

    - by Luis Varca
    I am trying to use this expression to insert the contents of one text file into another after a give string. This is a simple bash script: TEXT=`cat file1.txt` sed -i "/teststring/a \ $TEXT" file2.txt This returns an error, "sed: -e expression #1, char 37: unknown command: `M'" The issue is in the fact that the contents of file1.txt are actually a private certificate so it's a large amount of text and unusual characters which seems to be causing an issue. If I replace $TEXT with a simple ASCII value it works but when it reads the large content of file1.txt it fails with that error. Is there some way to carry out this action? Is my syntax off with sed or my quote placement wrong?

    Read the article

  • Keyboard shortcuts in non-English version of Microsoft Office

    - by Squall
    I have a big problem with the Portuguese version of MS Office 2007 and 2010. The standard shortcuts that any common application uses are changed. Some shortcuts that are not working: Ctrl+S (save), Ctrl+F (find) and Ctrl+A (select all). I want to configure it to use the shortcuts of the English version. There is an option that allow to configure each shortcut separately. Furthermore, I have to configure for each app, if I configure in Word, I will have to configure again for Excel. How to use the shortcuts of the English version of MS Office regardless of the Office language? Thanks

    Read the article

  • Common reasons not to use Open Office

    - by Dan McG
    I personally use it on both Windows and Linux, but have MS Office installed at work. I understand that in some business situations there are thousands (upon thousands) of existing MS Office documents that may or may not convert cleanly to Open Office. Not everyone is in that situation though. Among non IT folk, I rarely see OOo. Why is this so? What are common reasons for people not using OpenOffice.org? Are they from before it is even tried, or is it from unsatisfactory experiences when actually using it?

    Read the article

  • dnsmasq local network works for some but hostnames are not resolving for others

    - by prggmr
    I have set up a local network and it seems that some of us can use it properly while others can't. The problem seems to be that the local hostnames I setup don't get resolved for everyone. To overview how the network is setup: I am running an Ubuntu 10.01 server using dnsmasq, this server is setup to act as our primary DNS server, configured via our router. dnsmasq is configured using the options of domain-needed bogus-priv I use the /etc/hosts file to determain the hostnames 192.168.1.10 ra.xsi 192.168.1.10 test.xsi From my machine: If I dig the hostnames they resolve properly ; <<>> DiG 9.4.3-P1 <<>> ra.xsi ;; global options: printcmd ;; Got answer: ;; ->>HEADER<<- opcode: QUERY, status: NOERROR, id: 61671 ;; flags: qr aa rd ra; QUERY: 1, ANSWER: 1, AUTHORITY: 0, ADDITIONAL: 0 ;; QUESTION SECTION: ;ra.xsi. IN A ;; ANSWER SECTION: ra.xsi. 0 IN A 192.168.1.10 ;; Query time: 9 msec ;; SERVER: 192.168.1.10#53(192.168.1.10) ;; WHEN: Wed Nov 9 12:28:34 2011 ;; MSG SIZE rcvd: 40 Ping also works: PING ra.xsi (192.168.1.10): 56 data bytes 64 bytes from 192.168.1.10: icmp_seq=0 ttl=64 time=0.834 ms 64 bytes from 192.168.1.10: icmp_seq=1 ttl=64 time=0.699 ms ^C --- ra.xsi ping statistics --- 2 packets transmitted, 2 packets received, 0% packet loss round-trip min/avg/max/stddev = 0.699/0.766/0.834/0.068 ms And login via SSH works using the hostname. For those that cannot connect using hostnames, if I dig from their machine it appears the name is being resolved, but they cannot ping, SSH or http access the hostname. ; <<>> DiG 9.6.0-APPLE-P2 <<>> ra ;; global options: +cmd ;; Got answer: ;; ->>HEADER<<- opcode: QUERY, status: NOERROR, id: 12554 ;; flags: qr aa rd ra; QUERY: 1, ANSWER: 1, AUTHORITY: 0, ADDITIONAL: 0 ;; QUESTION SECTION: ;ra.xsi. IN A ;; ANSWER SECTION: ra.xsi. 0 IN A 192.168.1.10 ;; Query time: 8 msec ;; SERVER: 192.168.1.10#53(192.168.1.10) ;; WHEN: Wed Nov 9 12:05:50 2011 ;; MSG SIZE rcvd: 36 I've been banging my head at this and just can't seem to figure it out.

    Read the article

  • Why ping another inet machine from MacBook get netgate's ip address?

    - by Xinwang
    I have three machine in my home network connected by a wireless router. One is server installed linux at 192.168.1.1, another is Thinkpad with MS Windows XP at 192.168.1.2, last one is MacBook Pro with Mac OS X 10.6.3 at 192.168.1.3. When I ping the Linux Server from Thinkpad (MS Windows XP) I can get the correct ip address, but when I ping it from Mac I get the global address of my router, like 61.135.181.175. Could you tell me why this happen? And how do I get same ping result on Mac and Windows. Thanks

    Read the article

  • Identify "Composite Document File"

    - by Steven
    In a folder containing several PowerPoint Presentations and Spreadsheets, I discovered the following file: Name: ppt115.tmp Size: 160 MB Meta: No EXIF or other metadata Type: (as identified by the cygwin / linux program 'file') Composite Document File V2 Document, No summary info Notes: The filename does not correspond to other files in the directory. Neither MS Power Point nor Excel can open the file. MS Word will only attempt to recover text. Please help me identify this file. Is it just a temporary file that I can safely remove?

    Read the article

  • All invalid hosts gets resolved to "com.org"

    - by Vi
    vi@vi-server:~$ nslookup nonexistent.itransition.com Server: 8.8.8.8 Address: 8.8.8.8#53 ** server can't find nonexistent.itransition.com: NXDOMAIN vi@vi-server:~$ cat /etc/resolv.conf nameserver 8.8.8.8 It does not exist. The same result from dig nonexistent.itransition.com. vi@vi-server:~$ ping nonexistent.itransition.com PING nonexistent.itransition.com.org (216.234.246.153) 56(84) bytes of data. 64 bytes from 99.f6.ead8.static.theplanet.com (216.234.246.153): icmp_seq=1 ttl=46 time=128 ms 64 bytes from 99.f6.ead8.static.theplanet.com (216.234.246.153): icmp_seq=2 ttl=46 time=128 ms It catches all invalid hostnames? Why? How to prevent?

    Read the article

  • Meaning of tcp_delack_min

    - by Phi
    Hi, the current Linux Kernel (e.g. 2.6.36) uses Delayed Acknowledgments (delack). In /include/net/tcp.h it says: define TCP_DELACK_MIN ((unsigned)(HZ/25)) So, for a Kernel using a HZ value of 1000, an ACK should be delayed by a minimum of 40 ms. However, RFC 2581 says a TCP implementation should acknowledge every second full sized segment without further delay. Does anybody know whether the Linux Kernel follows that 'should' or whether the TCP_DELACK_MIN value means that even after a full sized segment was received, the ACK continues to be delayed until 40 ms have passed?

    Read the article

  • What's the difference between a normal ActiveX killbit update and one for IDX?

    - by Bob
    I'm looking back at some old MS security bulletin for distribution to new clients and when I look at downloads for the last set of MS ActiveX killbits, KB article here, under each platform I see links with the term IDX. For instance there will be an entry that says "For Windows 7 for 32-bit versions" and then one a few rows down that says "For Windows 7 IDX for 32-bit versions". What's the difference between the two? I understand from a little digging that idx is one of the field names for the database that ActiveX controls are stored in, but that's not really helpful.

    Read the article

  • trie reg exp parse step over char and continue

    - by forest.peterson
    Setup: 1) a string trie database formed from linked nodes and a vector array linking to the next node terminating in a leaf, 2) a recursive regular expression function that if A) char '*' continues down all paths until string length limit is reached, then continues down remaining string paths if valid, and B) char '?' continues down all paths for 1 char and then continues down remaining string paths if valid. 3) after reg expression the candidate strings are measured for edit distance against the 'try' string. Problem: the reg expression works fine for adding chars or swapping ? for a char but if the remaining string has an error then there is not a valid path to a terminating leaf; making the matching function redundant. I tried adding a 'step-over' ? char if the end of the node vector was reached and then followed every path of that node - allowing this step-over only once; resulted in a memory exception; I cannot find logically why it is accessing the vector out of range - bactracking? Questions: 1) how can the regular expression step over an invalid char and continue with the path? 2) why is swapping the 'sticking' char for '?' resulting in an overflow? Function: void Ontology::matchRegExpHelper(nodeT *w, string inWild, Set<string> &matchSet, string out, int level, int pos, int stepover) { if (inWild=="") { matchSet.add(out); } else { if (w->alpha.size() == pos) { int testLength = out.length() + inWild.length(); if (stepover == 0 && matchSet.size() == 0 && out.length() > 8 && testLength == tokenLength) {//candidate generator inWild[0] = '?'; matchRegExpHelper(w, inWild, matchSet, out, level, 0, stepover+1); } else return; //giveup on this path } if (inWild[0] == '?' || (inWild[0] == '*' && (out.length() + inWild.length() ) == level ) ) { //wild matchRegExpHelper(w->alpha[pos].next, inWild.substr(1), matchSet, out+w->alpha[pos].letter, level, 0, stepover);//follow path -> if ontology is full, treat '*' like a '?' } else if (inWild[0] == '*') matchRegExpHelper(w->alpha[pos].next, '*'+inWild.substr(1), matchSet, out+w->alpha[pos].letter, level, 0, stepover); //keep adding chars if (inWild[0] == w->alpha[pos].letter) //follow self matchRegExpHelper(w->alpha[pos].next, inWild.substr(1), matchSet, out+w->alpha[pos].letter, level, 0, stepover); //follow char matchRegExpHelper(w, inWild, matchSet, out, level, pos+1, stepover);//check next path } } Error Message: +str "Attempt to access index 1 in a vector of size 1." std::basic_string<char,std::char_traits<char>,std::allocator<char> > +err {msg="Attempt to access index 1 in a vector of size 1." } ErrorException Note: this function works fine for hundreds of test strings with '*' wilds if the extra stepover gate is not used Semi-Solved: I place a pos < w->alpha.size() condition on each path that calls w->alpha[pos]... - this prevented the backtrack calls from attempting to access the vector with an out of bounds index value. Still have other issues to work out - it loops infinitely adding the ? and backtracking to remove it, then repeat. But, moving forward now. Revised question: why during backtracking is the position index accumulating and/or not deincrementing - so at somepoint it calls w->alpha[pos]... with an invalid position that is either remaining from the next node or somehow incremented pos+1 when passing upward?

    Read the article

  • Unable to run Microsoft Office 2010 install file

    - by Len
    This problem began when I noticed that the icons in the Windows 7 task bar for MS Word and Outlook were generic. I rebuilt the icon cache. Still not the right icons, but not the generic "document" icons either, and both are identical (to each other). The two programs seem to be working OK. So then I tried to repair MS Office. I ran the setup file. It extracts the files, I get the splash screen, and then the message, "Setup has stopped working. A problem caused the program to stop working correctly. Windows will close the program and notify you if a solution is available." with a "Close program" button. Microsoft does not notify me about a solution. What I have tried: 1. running two other copies of the setup program; 2. doing an in-place re-install of Windows 7.

    Read the article

  • HP Wireless Printer not working

    - by Omri Spector
    I have installed an HP DeskJet 4620 driver on a win 7 machine. All works perfectly for several days, and than printing is not longer possible. Instead I get the message: "Unable to communicate with printer". This happened on every Win 7 PC I tried, and none of the HP/MS sites contain any relevant info... (Posting this so that the answer appears online, as I did solve it after much work) Solution: It appears that HP installation puts a unique "port" called "HP Network re-discovery". It stops working after some time (possibly after the first time the printer/pc enter sleep mode). BUT, the standard MS TCP port works just fine. So: Go to "Printers" Right click Printer Click "Printer properties" and then "Printer" or "Fax" (for both - do all this twice) Click "Add Port..." Select "Standard TCP Port" Fill in details Move printer to use the new port by un-checking the old one and checking the new one Happy printing.

    Read the article

  • How to find if a Item in a ListBox has the focus?

    - by eitan barazani
    I have a List box defined like this: <ListBox x:Name="EmailList" ItemsSource="{Binding MailBoxManager.Inbox.EmailList}" SelectedItem="{Binding SelectedMessage, Mode=TwoWay}" Grid.Row="1"> <ListBox.ItemTemplate> <DataTemplate> <usrctrls:MessageSummary /> </DataTemplate> </ListBox.ItemTemplate> </ListBox> The UserControl is defined like this: <UserControl x:Class="UserControls.MessageSummary" xmlns="http://schemas.microsoft.com/winfx/2006/xaml/presentation" xmlns:x="http://schemas.microsoft.com/winfx/2006/xaml" xmlns:d="http://schemas.microsoft.com/expression/blend/2008" xmlns:mc="http://schemas.openxmlformats.org/markup-compatibility/2006" mc:Ignorable="d" d:DesignHeight="300" d:DesignWidth="600"> <UserControl.Resources> </UserControl.Resources> <Grid HorizontalAlignment="Left"> <Grid.ColumnDefinitions> <ColumnDefinition Width="50" /> <ColumnDefinition Width="*" /> </Grid.ColumnDefinitions> <CheckBox Grid.Column="0" VerticalAlignment="Center" /> <Grid Grid.Column="1" Margin="0,0,12,0"> <Grid.RowDefinitions> <RowDefinition /> <RowDefinition /> <RowDefinition /> </Grid.RowDefinitions> <Grid Grid.Row="0" Grid.Column="0" HorizontalAlignment="Stretch"> <Grid.ColumnDefinitions> <ColumnDefinition Width="30" /> <ColumnDefinition Width="*" /> <ColumnDefinition Width="80" /> <ColumnDefinition Width="80" /> </Grid.ColumnDefinitions> <Image x:Name="FlaggedImage" Grid.Column="0" Width="20" Height="10" Margin="0" VerticalAlignment="Center" HorizontalAlignment="Center" Source="/Assets/ico_flagged_white.png" /> <TextBlock x:Name="Sender" Grid.Column="1" Text="{Binding EmailProperties.DisplayFrom}" Style="{StaticResource TextBlock_SenderRowTitle}" HorizontalAlignment="Left" VerticalAlignment="Center" /> <Grid x:Name="ImagesContainer" Grid.Column="2" VerticalAlignment="Center"> <Grid.ColumnDefinitions> <ColumnDefinition Width="*" /> <ColumnDefinition Width="*" /> <ColumnDefinition Width="*" /> <ColumnDefinition Width="*" /> </Grid.ColumnDefinitions> <Image x:Name="ImgImportant" Grid.Column="0" Width="20" Height="20" VerticalAlignment="Center" HorizontalAlignment="Center" Source="ms-appx:///Assets/ico_important_red.png" /> <Image x:Name="ImgFolders" Grid.Column="1" Width="20" Height="20" VerticalAlignment="Center" HorizontalAlignment="Center" Source="ms-appx:///Assets/ico_ico_addtofolder.png" /> <Image x:Name="ImgAttachment" Grid.Column="2" Width="20" Height="20" VerticalAlignment="Center" HorizontalAlignment="Center" Source="ms-appx:///Assets/ico_attachment_lightgray.png" /> <Image x:Name="ImgFlag" Grid.Column="3" Width="20" Height="20" VerticalAlignment="Center" HorizontalAlignment="Center" Source="ms-appx:///Assets/ico_flag.png" /> </Grid> <TextBlock x:Name="Time" Grid.Column="3" Text="{Binding EmailProperties.DateReceived, Converter={StaticResource EmailHeaderTimeConverter}}" TextAlignment="Center" FontSize="16" VerticalAlignment="Center" Margin="0" /> </Grid> <TextBlock Grid.Row="1" Text="{Binding EmailProperties.Subject}" TextTrimming="WordEllipsis" Margin="0,10" /> <TextBlock Grid.Row="2" Text="{Binding EmailProperties.Preview}" TextTrimming="WordEllipsis" /> </Grid> </Grid> The MessageSummary is a UserControl. I would like to bind the foreground color of the Items of the ListBox to whether the item is the one selected in the list box, i.e. I would like the Item's foreground color to be Black if not selected and White if the item is selected. How can it be done? Thanks,

    Read the article

  • Windows 2008 Server on VMWare (hardware)

    - by Bill
    I want to setup a single server to run a few virtual servers for our datacenter. I do not have a lot of money to spend so I am trying to gain bang for the buck. My budget is around $2,000. So I was thinking about building the following as the VMWare physical server: Intel iCore 7 950 (LGA1366, 4 cores,8 threads) Gigabyte GA-X58-USB3 LGA 1366 X58 ATX Intel Motherboard 24 GB of Viper II Series, Sector 7 Edition, Extreme Performance DDR3-1600 (PC3-12800) CL9 Triple Channel Memory VelociRaptor 300GB 10,000 RPM SATA 3.0Gb/s 3.5" Internal Hard Drive I am planning on running the newest version of VMWare ESXi (64-bit). On these I am planning on running a few various servers: Windows 2008 Server R2 w/ IIS (several custom built ASP.NET Apps) Windows 2008 Server R2 w/ MS SQL 2008 Database Server Linux Web Server w/ Several WordPress Blogs (XAMPP?) Windows 2008 Server R2 w/ IIS (DEV ENVIRONMENT) Windows 2008 Server R2 w/ MS SQL 2008 Database Server (DEV ENVIRONMENT) In your opinion, will this hardware be sufficient to run the above load with room for possible 2-3 more virtual machines (probably lightweight web servers)?

    Read the article

  • WCF/REST Get image into picturebox?

    - by Garrith
    So I have wcf rest service which succesfuly runs from a console app, if I navigate to: http://localhost:8000/Service/picture/300/400 my image is displayed note the 300/400 sets the width and height of the image within the body of the html page. The code looks like this: namespace WcfServiceLibrary1 { [ServiceContract] public interface IReceiveData { [OperationContract] [WebInvoke(Method = "GET", BodyStyle = WebMessageBodyStyle.Wrapped, ResponseFormat = WebMessageFormat.Xml, UriTemplate = "picture/{width}/{height}")] Stream GetImage(string width, string height); } public class RawDataService : IReceiveData { public Stream GetImage(string width, string height) { int w, h; if (!Int32.TryParse(width, out w)) { w = 640; } // Handle error if (!Int32.TryParse(height, out h)) { h = 400; } Bitmap bitmap = new Bitmap(w, h); for (int i = 0; i < bitmap.Width; i++) { for (int j = 0; j < bitmap.Height; j++) { bitmap.SetPixel(i, j, (Math.Abs(i - j) < 2) ? Color.Blue : Color.Yellow); } } MemoryStream ms = new MemoryStream(); bitmap.Save(ms, System.Drawing.Imaging.ImageFormat.Jpeg); ms.Position = 0; WebOperationContext.Current.OutgoingResponse.ContentType = "image/jpeg"; return ms; } } } What I want to do now is use a client application "my windows form app" and add that image into a picturebox. Im abit stuck as to how this can be achieved as I would like the width and height of the image from my wcf rest service to be set by the width and height of the picturebox. I have tryed this but on two of the lines have errors and im not even sure if it will work as the code for my wcf rest service seperates width and height with a "/" if you notice in the url. string uri = "http://localhost:8080/Service/picture"; private void button1_Click(object sender, EventArgs e) { StringBuilder sb = new StringBuilder(); sb.AppendLine("<picture>"); sb.AppendLine("<width>" + pictureBox1.Image.Width + "</width>"); // the url looks like this http://localhost:8080/Service/picture/300/400 when accessing the image so I am trying to set this here sb.AppendLine("<height>" + pictureBox1.Image.Height + "</height>"); sb.AppendLine("</picture>"); string picture = sb.ToString(); byte[] getimage = Encoding.UTF8.GetBytes(picture); // not sure this is right HttpWebRequest req = WebRequest.Create(uri); //cant convert webrequest to httpwebrequest req.Method = "GET"; req.ContentType = "image/jpg"; req.ContentLength = getimage.Length; MemoryStream reqStrm = req.GetRequestStream(); //cant convert IO stream to IO Memory stream reqStrm.Write(getimage, 0, getimage.Length); reqStrm.Close(); HttpWebResponse resp = req.GetResponse(); // cant convert web respone to httpwebresponse MessageBox.Show(resp.StatusDescription); pictureBox1.Image = Image.FromStream(reqStrm); reqStrm.Close(); resp.Close(); } So just wondering if some one could help me out with this futile attempt at adding a variable image size from my rest service to a picture box on button click. This is the host app aswell: namespace ConsoleApplication1 { class Program { static void Main(string[] args) { string baseAddress = "http://" + Environment.MachineName + ":8000/Service"; ServiceHost host = new ServiceHost(typeof(RawDataService), new Uri(baseAddress)); host.AddServiceEndpoint(typeof(IReceiveData), new WebHttpBinding(), "").Behaviors.Add(new WebHttpBehavior()); host.Open(); Console.WriteLine("Host opened"); Console.ReadLine();

    Read the article

  • Convert text to table

    - by Quattro
    I would like convert text into a table. Here is a link to the text http://www.tcdb.org/public/tcdb Short example: >gnl|TC-DB|A0CIB0|1.A.17.3.1 Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1 MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI >gnl|TC-DB|A0CS82|9.B.82.1.5 Chromosome undetermined scaffold_26, whole genome shotgun sequence - Paramecium tetraurelia. MIIEEQIEEKMIYKAIHRVKVNYQKKIDRYILYKKSRWFFNLLLMLLYAYRIQNIGGFYI VTYIYCVYQLQLLIDYFTPLGLPPVNLEDEEEDDDQFQNDFSELPTTLSNKNELNDKEFR PLLRTTSEFKVWQKSVFSVIFAYFCTYIPIWDIPVYWPFLFCYFFVIVGMSIRKYIKHMK KYGYTILDFTKKK I wanted to have columns for example delimited with pipe | or ; |>gnl|TC-DB|A0CIB0|1.A.17.3.1| Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1| MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI I am working with Windows and I don't know how to do it I just know every row starts with > I want to substitute the first whitespace in a row with a delimiter like | or ; after the first regular expression new line in a row, I want also a delimiter everything between the regular expression first new line and > should go into a new column (it's a sequence of a protein)

    Read the article

  • Can someone help me compare using F# over C# in this specific example (IP Address expressions)?

    - by Phobis
    So, I am writing code to parse and IP Address expression and turn it into a regular expression that could be run against and IP Address string and return a boolean response. I wrote the code in C# (OO) and it was 110 lines of code. I am trying to compare the amount of code and the expressiveness of C# to F# (I am a C# programmer and a noob at F#). I don't want to post both the C# and F#, just because I don't want to clutter the post. If needed, I will do so. Anyway, I will give an example. Here is an expression: 192.168.0.250,244-248,108,51,7;127.0.0.1 I would like to take that and turn it into this regular expression: ((192.168.0.(250|244|245|246|247|248|108|51|7))|(127.0.0.1)) Here are some steps I am following: Operations: Break by ";" 192.168.0.250,244-248,108,51,7 127.0.0.1 Break by "." 192 168 0 250,244-248,108,51,7 Break by "," 250 244-248 108 51 7 Break by "-" 244 248 I came up with F# that produces the output. I am trying to forward-pipe through my operations listed above, as I think that would be more expressive. Can anyone make this code better? Teach me something :) open System let createItemArray (group:bool) (y:char) (items:string[]) = [| let indexes = items.Length - 1 let group = indexes > 0 && group if group then yield "(" for i in 0 .. indexes do yield items.[i].ToString() if i < indexes then yield y.ToString() if group then yield ")" |] let breakBy (group:bool) (x:string) (y:char): string[] = x.Split(y) |> createItemArray group y let breakItem (x:string) (y:char): string[] = breakBy false x y let breakGroup (x:string) (y:char): string[] = breakBy true x y let AddressExpression address:string = let builder = new System.Text.StringBuilder "(" breakGroup address ';' |> Array.collect (fun octet -> breakItem octet '.') |> Array.collect (fun options -> breakGroup options ',') |> Array.collect (fun (ranges : string) -> match (breakGroup ranges '-') with | x when x.Length > 3 -> match (Int32.TryParse(x.[1]), Int32.TryParse(x.[3])) with | ((true, a) ,(true, b)) -> [|a .. b|] |> Array.map (int >> string) |> createItemArray false '-' | _ -> [|ranges|] | _ -> [|ranges|] ) |> Array.iter (fun item -> match item with | ";" -> builder.Append ")|(" | "." -> builder.Append "\." | "," | "-" -> builder.Append "|" | _ -> builder.Append item |> ignore ) builder.Append(")").ToString() let address = "192.168.0.250,244-248,108,51,7;127.0.0.1" AddressExpression address

    Read the article

< Previous Page | 178 179 180 181 182 183 184 185 186 187 188 189  | Next Page >