Search Results

Search found 34831 results on 1394 pages for 'blacking out text'.

Page 19/1394 | < Previous Page | 15 16 17 18 19 20 21 22 23 24 25 26  | Next Page >

  • Coloring NSTableView Text per row

    - by Tristan
    I have a NSTableView that is displaying an array of objects I have. For each of these objects (rows) I would like to change the color of the text displayed depending on the results of a function I run on each object; So for example all the object in the table that exist in another list (or some other requirement) I want to display them in green text, and objects that don't exist display in red. How would I go about doing this?

    Read the article

  • Find text position

    - by serhiyiv
    Hi. Could you please help me !!!! For example, I load some page into opera/Firefox etc., there is a text on the page (which is a link). What I need is to find position of the text on the screen and send mouse click to that position. Is it possible to do? If you can, give an example please!!!!

    Read the article

  • exact full text search - sql server 2005

    - by csetzkorn
    Hi, Is it possible to do an 'exact full text search' with CONTAINS. I have removed all noise words etc. but the dbms still seems to manipulate the 'exact word' (e.g. 'j-blade - blade'). Can I disable this? Thanks. Christian PS: I would like to avoid like because it is too slow and with exact I mean that the text contains the exact word.

    Read the article

  • How to Enable Full-Text Index on Sql Server 2008 Table

    - by michaeldelorenzo
    Not sure what's happening with this, but here's my question. I have a Sql Server 2008 database that I need to be able to do full-text indexing/searching but when I try to setup my indices on the table, I get the following: I've tried running this stored procedure on my database and it's successful: EXEC sp_fulltext_database @action = 'enable' But I still get the above window and my full-text searches don't return any results when they should. What am I missing?

    Read the article

  • Modifying text files and executing programs with command line parameters in c# or c++ on Linux

    - by Robert Harvey
    I have a need to create a utility in Suze Linux. The utility will make modifications to some text files, and then use the information in those text files to program a device in the computer using a different executable which accepts command line parameters. I am fluent in c#, but have never worked with Linux. Should I take the time to learn Gnu C++ to do this, or install Mono? How would I execute the programming utility and pass it command line parameters?

    Read the article

  • How to convert Xml files to Text Files 2

    - by John
    Hi all, I have around 8000 xml files that needs to be converted into text files. The text file must contain title, description and keywords of the xml file without the tags and removing other elements and attributes as well. In other words, i need to create 8000 text files containing the title,description and keywords of the xml file. I need codings for this to be done systematically. Any help would be greatly appreciated. Thanks in advance. Hey all thank you all so so much with your replies. Here's a sample of what my xml looks like: <?xml version="1.0"?> <metadata> <identifier>43productionsNightatthegraveyard</identifier> <title>Night at the graveyard</title> <collection>opensource_movies</collection> <mediatype>movies</mediatype> <resource>movies</resource> <upload_application appid="ccPublisher" version="2.2.1"/> <uploader>[email protected]</uploader> <description>una noche en el cementerio (terror)</description> <license>http://creativecommons.org/licenses/by-nc/3.0/</license> <title>Night at the graveyard</title> <format>Video</format> <adder>[email protected]</adder> <licenseurl>http://creativecommons.org/licenses/by-nc/3.0/</licenseurl> <year>2007</year> <keywords>Night,at,the,graveyard,43,productions</keywords> <holder>43 productions</holder> <publicdate>2007-04-11 19:52:28</publicdate> </metadata> And this would be the output: una noche en el cementerio (terror) Night at the graveyard Night,at,the,graveyard,43,productions This need to be saved with the same name but in text format. Thanks all so much if any more suggestions would be much appreciated.

    Read the article

  • Writing text file on local server MVC 2.0

    - by Liado
    Hi, i'm trying to write a text file on remote server, i'm using the following code: [AcceptVerbs(HttpVerbs.Post)] public ActionResult Index(UserModels model) { if (!ModelState.IsValid) { return View("Index"); } try { using (StreamWriter w = new StreamWriter(Server.MapPath(TEXT_FILE_NAME), true)) { w.WriteLine(model.Email.ToString()); // Write the text } } catch { } the folder is still empty, can someone help? what should be the problem? Thanks

    Read the article

  • Reading a Text file in xcode

    - by Nicolaj Zefting
    First off, I'm a complete beginner. This might be a stupid question, but here it goes: I'm currently working on an App than contains Latin texts that the users can view and read. I'm using Xcode 4 with the storybord function. Theway the app is built: user selects author - then the book - then app shows the text. I am kind of confused because i need to have various text files, depending on the users choice.

    Read the article

  • Generating text file from database

    - by Goldmember
    I have a requirement to hand-code an text file from data residing in a SQL table. Just wondering if there are any best practices here. Should I write it as an XMLDocument first and transform using XSL or just use Streamwriter and skip transformation altogether? The generated text file will be in EDIFACT format, so layout is very specific.

    Read the article

  • Text extra aliased(jagged) in IE - looks terrible - but OK in FF and Chrome

    - by jon
    I am building a website - http://www.efficaxdevelopment.com As you can see when you load the page(in IE) the text on the page that isn't an image or the menu looks terrible, while in FF and Chrome the text looks fine. you can view the source on the page and the css is here http://www.efficaxdevelopment.com/styles/mainstyle.css Also, the sliding bar over the menu appears a few pixels left of where it appears in FF and IE. Any ideas?

    Read the article

  • Appcelerator Titanium - auto height table views break with shortish text

    - by ceejayoz
    I posted this on the Appcelerator Titanium dev Q&A site, but maybe someone here has had this issue... KitchenSink 1.1 illustrates this issue. In table_view_api_auto_height.js, changing row: addRow(0,'This is some long text. This is some long text. This is some long text. This is some long text. This is some long text. This is some long text. This is some long text. This is some long text. This is some long text. This is some long text. This is some long text. This is some long text. This is some long text. This is some long text. This is some long text. This is some long text. This is some long text. This is some long text.'); to something like: addRow(0,'This is some long text. This is some long text.'); results in incorrect left padding on the row. See screenshot:

    Read the article

  • Webrat says it can't find some text, but the text is actually there

    - by Jason
    I have a webpage that has a form button on it called "delete", and a cuke scenario that has the line: And I should see "delete" When I run the scenario, I get this error: expected the following element's content to include "delete" ...and it dumps the webrat page to stdout and the "delete" is, in fact, not there. So far so good. However, when I tell webrat to show me the page before the error happens: Then show me the page And I should see "delete" ...Safari fires up and shows me the page, and in Safari there's the "delete" button, totally there. Why is webrat not finding the form button? I've also had this same problem with form fields, such as text inputs that have a value in them when the page loads, but webrat says there's nothing there. Looking at it in Safari shows, again, that the field does have the right text in it. Is this a bug, or is webrat just not suitable for checking form elements? Is there a different way to do this? Thanks!

    Read the article

  • Change input text to regular text on blur and ability to edit jQuery

    - by eknown
    I'm creating a form where I'm eliminating the use of a save button. The form is made up of input text boxes and textareas. After the user enters data into the input field, I want to trigger an onBlur function and change the input into a span that contains the information that the user entered. I also want to have the ability to edit this information, so if the user clicks on the newly created span with text, it will turn back into the input field with the current information for their editing pleasure. For reference, I'm looking to have a functionality pretty much like on editing a photo title on Flickr. If possible, I'd also like to have the textbox show "saving..." for half a second after the blur to reflect interaction with server.

    Read the article

  • ASP.NET Conditionally Change ButtonField text at runTime

    - by Rodney Vinyard
    ASP.NET Conditionally Change ButtonField text at runTime   <asp:ButtonField CommandName="Edit" HeaderText="" Text="Edit" ButtonType="Link" />       protected void gvRequests_RowDataBound(object sender, GridViewRowEventArgs e)     {         if (e.Row.RowType == DataControlRowType.DataRow)         {             //----------------------------------------------------             // If status = "Saved", change buttonField.LinkButton.Text to "Copy"             //----------------------------------------------------             if (e.Row.Cells[(int)gCol.Status].Text == "Saved")             {                 //----------------------------------------------------                 // no !                 //----------------------------------------------------                 //string x = e.Row.Cells[(int)gCol.EditLink].Text;                 //e.Row.Cells[(int)gCol.EditLink].Text = "Copy";                   //----------------------------------------------------                 // yes !                 //----------------------------------------------------                 LinkButton linkButton = (LinkButton)e.Row.Cells[(int)gCol.EditLink].Controls[0];                 linkButton.Text = "Copy";             }         }     }

    Read the article

  • Issue with parsed text with HTMLCleaner - spaces at the begining of text

    - by ansol90
    Im able to get text using HTMLCleaner from website. The problem is that when I set the text to a TextView it shows the beginning of the text with a big space on it. Here is the screenshot of what im talking about. I have tried android:gravity but nothing happened. Please help. Here is my Code: private class SiteParser extends AsyncTask<String, Void, String> { protected String doInBackground(String... arg) { String output = null; try { HtmlHelper hh = new HtmlHelper(new URL(arg[0])); List<TagNode> news = hh.getnewsByClass("TextoPrint"); for (Iterator<TagNode> iterator = newss.iterator(); iterator .hasNext();) { TagNode divElement = (TagNode) iterator.next(); output = divElement.getText().toString(); } } catch (Exception e) { e.printStackTrace(); } return output; } protected void onPostExecute(String output) { Bundle bundle=new Bundle(); bundle.putString("body",output); Intent mainIntent = new Intent(act, MyView.class); mainIntent.putExtras(bundle); startActivity(mainIntent); act.finish(); } } public class HtmlHelper { TagNode rootNode; public HtmlHelper(URL htmlPage) throws IOException, XPatherException { HtmlCleaner cleaner = new HtmlCleaner(); rootNode = cleaner.clean(htmlPage); } List<TagNode> getnewsByClass(String Classname){ List<TagNode> newsList = new ArrayList<TagNode>(); TagNode divElements[] = rootNode.getElementsByName("div", true); for (int i = 0; divElements != null && i < divElements.length; i++) { String classType = divElements[i].getAttributeByName("id"); if (classType != null && classType.equals(Classname)) { newsList.add(divElements[i]); } } return newsList; } }

    Read the article

  • Send SMS text messages for FREE using Java ME

    - by hinkmond
    Here's a way to get around those nasty SMS text messages charges (and maybe a way to get around the Pakistan SMS text censors too!). Use this Java ME SMS text app for your Java ME mobile phone, called JaxtrSMS: See: JaxtrSMS free Java ME SMS Here's a quote: JaxtrSMS lets you send FREE SMS and txt messages to any mobile phone in the world. Best of all, the receiver does not have to have the JaxtrSMS app. International and local SMS/texting can be expensive but with JaxtrSMS you can text anyone in the world for FREE! Great! Now, you can send 2,000 text messages from your phone every month and not worry about a huge bill. You don't send 2,000 text message in a month? Well, get it for your teenage kids then. They certainly send 2,000 text messages in a month... Hinkmond

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • knockout bind text label to dropdown value selected option text

    - by Adam Levitt
    Is there a simple way to bind the textbox of a div to change based on the text value of the selected option in a dropdown on the same page? <div data-bind="text: dropdownValue"></div> <select> <option value="1">Value1</option> <option value="2">Value2</option> </select> Please note, I don't want to put the values into the select element using javascript. I'd like to bind to the value straight from the HTML. I can also include jQuery to make it work.

    Read the article

< Previous Page | 15 16 17 18 19 20 21 22 23 24 25 26  | Next Page >