Search Results

Search found 4865 results on 195 pages for 'special k'.

Page 192/195 | < Previous Page | 188 189 190 191 192 193 194 195  | Next Page >

  • Why wont this entire word doc file generate from my php script?

    - by CheeseConQueso
    Here's the php script I'm using on a linux environment: <?php include("../_inc/odbcw.php"); //connect string $cat = $_GET["cat"]; if($_GET["st"]){$crs_query = "select crs_no, title, credits, abstr, prereq, coreq, lab_fee from xxx where active = 'Y' and cat = '".$cat."' and spec_top = 'Y' and prog='UNDG' order by crs_no";} else {$crs_query = "select crs_no, title, credits, abstr, prereq, coreq, lab_fee from xxx where active = 'Y' and cat = '".$cat."' and prog='UNDG' order by crs_no";} $crs_result = @mysql_query($crs_query); header("Content-type: application/vnd.ms-word"); header("Content-Disposition: attachment;Filename=cat.doc"); echo "<html>"; echo "<meta http-equiv=\"Content-Type\" content=\"text/html; charset=Windows-1252\">"; echo "<body>"; echo '<table border=0 width = 700>'; if($_GET["st"]){echo '<tr><td><font face=arial size=2><center>CATALOGUE<br>COURSE DESCRIPTIONS - '.$cat.'<br>SPECIAL TOPICS</center></font></td></tr>';} else {echo '<tr><td><font face=arial size=2><center>CATALOGUE<br>COURSE DESCRIPTIONS - '.$cat.'</center></font></td></tr>';} echo '</table>'; echo '<hr width=700>'; while($row = mysql_fetch_array($crs_result)) { $crs_no = $row['crs_no']; $title = $row['title']; $credits = $row['credits']; $abstr = $row['abstr']; $prereq = $row['prereq']; $coreq = $row['coreq']; $lab_fee = $row['lab_fee']; $rowspan = 2; if($prereq) {$rowspan++;} if($coreq) {$rowspan++;} if($lab_fee=="Y") {$rowspan++;} echo "<table border=0 width = 700>"; echo "<tr>"; echo "<td rowspan=".$rowspan." valign=top width=100><font face=arial size=2>".$crs_no."</font></td>"; echo "<td valign=top><font face=arial size=2><u>".$title."</u></font></td> <td valign=top align=right><font face=arial size=2>".$credits."</font></td>"; echo "</tr>"; echo "<tr>"; echo "<td colspan=2 valign=top align=justify><font face=arial size=2>".$abstr."</font></td>"; echo "</tr>"; if($prereq) { echo "<tr>"; echo "<td colspan=2 valign=top><font face=arial size=2>Prerequisite: ".$prereq."</font></td>"; echo "</tr>"; } if($coreq) { echo "<tr>"; echo "<td colspan=2 valign=top><font face=arial size=2>Coerequisite: ".$coreq."</font></td>"; echo "</tr>"; } if($lab_fee=="Y") { echo "<tr>"; echo "<td colspan=2 valign=top><font face=arial size=2>Lab Fee Required</font></td>"; echo "</tr>"; } echo "</table>"; echo "<br>"; } echo "</body>"; echo "</html>"; ?> Everything works fine before the inclusion of: header("Content-type: application/vnd.ms-word"); header("Content-Disposition: attachment;Filename=cat.doc"); echo "<html>"; echo "<meta http-equiv=\"Content-Type\" content=\"text/html; charset=Windows-1252\">"; echo "<body>"; These lines successfully bring up the dialogue box to open or save cat.doc, but after I open it, the only lines printed are: CATALOGUE COURSE DESCRIPTIONS - and the <HR> beneath this echoed text. It seems to go on lunch break for the while loop echoing section. Any ideas?

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • Java style FOR loop in a clojure interpeter ?

    - by Kevin
    I have a basic interpreter in clojure. Now i need to implement for (initialisation; finish-test; loop-update) { statements } inside my interpreter. I will attach my interpreter code I got so far. Any help is appreciated. Interpreter (declare interpret make-env) ;; (def do-trace false) ;; ;; simple utilities (def third ; return third item in a list (fn [a-list] (second (rest a-list)))) (def fourth ; return fourth item in a list (fn [a-list] (third (rest a-list)))) (def run ; make it easy to test the interpreter (fn [e] (println "Processing: " e) (println "=> " (interpret e (make-env))))) ;; for the environment (def make-env (fn [] '())) (def add-var (fn [env var val] (cons (list var val) env))) (def lookup-var (fn [env var] (cond (empty? env) 'error (= (first (first env)) var) (second (first env)) :else (lookup-var (rest env) var)))) ;; -- define numbers (def is-number? (fn [expn] (number? expn))) (def interpret-number (fn [expn env] expn)) ;; -- define symbols (def is-symbol? (fn [expn] (symbol? expn))) (def interpret-symbol (fn [expn env] (lookup-var env expn))) ;; -- define boolean (def is-boolean? (fn [expn] (or (= expn 'true) (= expn 'false)))) (def interpret-boolean (fn [expn env] expn)) ;; -- define functions (def is-function? (fn [expn] (and (list? expn) (= 3 (count expn)) (= 'lambda (first expn))))) (def interpret-function (fn [expn env] expn)) ;; -- define addition (def is-plus? (fn [expn] (and (list? expn) (= 3 (count expn)) (= '+ (first expn))))) (def interpret-plus (fn [expn env] (+ (interpret (second expn) env) (interpret (third expn) env)))) ;; -- define subtraction (def is-minus? (fn [expn] (and (list? expn) (= 3 (count expn)) (= '- (first expn))))) (def interpret-minus (fn [expn env] (- (interpret (second expn) env) (interpret (third expn) env)))) ;; -- define multiplication (def is-times? (fn [expn] (and (list? expn) (= 3 (count expn)) (= '* (first expn))))) (def interpret-times (fn [expn env] (* (interpret (second expn) env) (interpret (third expn) env)))) ;; -- define division (def is-divides? (fn [expn] (and (list? expn) (= 3 (count expn)) (= '/ (first expn))))) (def interpret-divides (fn [expn env] (/ (interpret (second expn) env) (interpret (third expn) env)))) ;; -- define equals test (def is-equals? (fn [expn] (and (list? expn) (= 3 (count expn)) (= '= (first expn))))) (def interpret-equals (fn [expn env] (= (interpret (second expn) env) (interpret (third expn) env)))) ;; -- define greater-than test (def is-greater-than? (fn [expn] (and (list? expn) (= 3 (count expn)) (= '> (first expn))))) (def interpret-greater-than (fn [expn env] (> (interpret (second expn) env) (interpret (third expn) env)))) ;; -- define not (def is-not? (fn [expn] (and (list? expn) (= 2 (count expn)) (= 'not (first expn))))) (def interpret-not (fn [expn env] (not (interpret (second expn) env)))) ;; -- define or (def is-or? (fn [expn] (and (list? expn) (= 3 (count expn)) (= 'or (first expn))))) (def interpret-or (fn [expn env] (or (interpret (second expn) env) (interpret (third expn) env)))) ;; -- define and (def is-and? (fn [expn] (and (list? expn) (= 3 (count expn)) (= 'and (first expn))))) (def interpret-and (fn [expn env] (and (interpret (second expn) env) (interpret (third expn) env)))) ;; -- define with (def is-with? (fn [expn] (and (list? expn) (= 3 (count expn)) (= 'with (first expn))))) (def interpret-with (fn [expn env] (interpret (third expn) (add-var env (first (second expn)) (interpret (second (second expn)) env))))) ;; -- define if (def is-if? (fn [expn] (and (list? expn) (= 4 (count expn)) (= 'if (first expn))))) (def interpret-if (fn [expn env] (cond (interpret (second expn) env) (interpret (third expn) env) :else (interpret (fourth expn) env)))) ;; -- define function-application (def is-function-application? (fn [expn env] (and (list? expn) (= 2 (count expn)) (is-function? (interpret (first expn) env))))) (def interpret-function-application (fn [expn env] (let [function (interpret (first expn) env)] (interpret (third function) (add-var env (first (second function)) (interpret (second expn) env)))))) ;; the interpreter itself (def interpret (fn [expn env] (cond do-trace (println "Interpret is processing: " expn)) (cond ; basic values (is-number? expn) (interpret-number expn env) (is-symbol? expn) (interpret-symbol expn env) (is-boolean? expn) (interpret-boolean expn env) (is-function? expn) (interpret-function expn env) ; built-in functions (is-plus? expn) (interpret-plus expn env) (is-minus? expn) (interpret-minus expn env) (is-times? expn) (interpret-times expn env) (is-divides? expn) (interpret-divides expn env) (is-equals? expn) (interpret-equals expn env) (is-greater-than? expn) (interpret-greater-than expn env) (is-not? expn) (interpret-not expn env) (is-or? expn) (interpret-or expn env) (is-and? expn) (interpret-and expn env) ; special syntax (is-with? expn) (interpret-with expn env) (is-if? expn) (interpret-if expn env) ; functions (is-function-application? expn env) (interpret-function-application expn env) :else 'error)))

    Read the article

  • I asked this yesterday, after the input given I'm still having trouble implementing..

    - by Josh
    I'm not sure how to fix this or what I did wrong, but whenever I enter in a value it just closes out the run prompt. So, seems I do have a problem somewhere in my coding. Whenever I run the program and input a variable, it always returns the same answer.."The content at location 76 is 0." On that note, someone told me that "I don't know, but I suspect that Program A incorrectly has a fixed address being branched to on instructions 10 and 11." - mctylr but I'm not sure how to fix that.. I'm trying to figure out how to incorporate this idea from R Samuel Klatchko.. I'm still not sure what I'm missing but I can't get it to work.. const int OP_LOAD = 3; const int OP_STORE = 4; const int OP_ADD = 5; ... const int OP_LOCATION_MULTIPLIER = 100; mem[0] = OP_LOAD * OP_LOCATION_MULTIPLIER + ...; mem[1] = OP_ADD * OP_LOCATION_MULTIPLIER + ...; operand = memory[ j ] % OP_LOCATION_MULTIPLIER; operation = memory[ j ] / OP_LOCATION_MULTIPLIER; I'm new to programming, I'm not the best, so I'm going for simplicity. Also this is an SML program. Anyway, this IS a homework assignment and I'm wanting a good grade on this. So I was looking for input and making sure this program will do what I'm hoping they are looking for. Anyway, here are the instructions: Write SML (Simpletron Machine language) programs to accomplish each of the following task: A) Use a sentinel-controlled loop to read positive number s and compute and print their sum. Terminate input when a neg number is entered. B) Use a counter-controlled loop to read seven numbers, some positive and some negative, and compute + print the avg. C) Read a series of numbers, and determine and print the largest number. The first number read indicates how many numbers should be processed. Without further a due, here is my program. All together. int main() { const int READ = 10; const int WRITE = 11; const int LOAD = 20; const int STORE = 21; const int ADD = 30; const int SUBTRACT = 31; const int DIVIDE = 32; const int MULTIPLY = 33; const int BRANCH = 40; const int BRANCHNEG = 41; const int BRANCHZERO = 41; const int HALT = 43; int mem[100] = {0}; //Making it 100, since simpletron contains a 100 word mem. int operation; //taking the rest of these variables straight out of the book seeing as how they were italisized. int operand; int accum = 0; // the special register is starting at 0 int j; // This is for part a, it will take in positive variables in a sent-controlled loop and compute + print their sum. Variables from example in text. memory [0] = 1010; memory [01] = 2009; memory [02] = 3008; memory [03] = 2109; memory [04] = 1109; memory [05] = 4300; memory [06] = 1009; j = 0; //Makes the variable j start at 0. while ( true ) { operand = memory[ j ]%100; // Finds the op codes from the limit on the memory (100) operation = memory[ j ]/100; //using a switch loop to set up the loops for the cases switch ( operation ){ case 10: //reads a variable into a word from loc. Enter in -1 to exit cout <<"\n Input a positive variable: "; cin >> memory[ operand ]; break; case 11: // takes a word from location cout << "\n\nThe content at location " << operand << "is " << memory[operand]; break; case 20:// loads accum = memory[ operand ]; break; case 21: //stores memory[ operand ] = accum; break; case 30: //adds accum += mem[operand]; break; case 31: // subtracts accum-= memory[ operand ]; break; case 32: //divides accum /=(memory[ operand ]); break; case 33: // multiplies accum*= memory [ operand ]; break; case 40: // Branches to location j = -1; break; case 41: //branches if acc. is < 0 if (accum < 0) j = 5; break; case 42: //branches if acc = 0 if (accum == 0) j = 5; break; case 43: // Program ends exit(0); break; } j++; } return 0; }

    Read the article

  • clicking a button via javascript does not cause a post

    - by Andreas Niedermair
    hi there! <!DOCTYPE html PUBLIC "-//W3C//DTD XHTML 1.1//EN" "http://www.w3.org/TR/xhtml11/DTD/xhtml11.dtd"> <html xmlns="http://www.w3.org/1999/xhtml" > <head> <script type="text/javascript" src="http://ajax.googleapis.com/ajax/libs/jquery/1.4.2/jquery.js"></script> <script type="text/javascript" src="http://ajax.googleapis.com/ajax/libs/jqueryui/1.8.2/jquery-ui.js"></script> </head> <body> <form id="fooForm"> <script type="text/javascript"> function FooMethod() { alert('hello'); } var fooButton; var fooForm; $(document).ready(function() { InitializeVariables(); InitiliazeDialog(); InitiliazeForm(); }); function InitializeVariables() { fooButton = $('#fooButton'); fooForm = $('#fooForm'); } function InitiliazeDialog() { var dialog = $('<div/>'); dialog.css('display', 'none'); var content = $('<p/>'); var icon = $('<span/>'); icon.addClass('ui-icon ui-icon-alert'); icon.css('float', 'left'); icon.css('margin', '0px 7px 20px 0px'); content.text('do you really want to hurt me?'); icon.prependTo(content); content.appendTo(dialog); var dialogOpenMethod = function () { dialog.dialog('open'); return false; }; var dialogOpenHandlerMethod = function (event, ui) { var widget = dialog.dialog('widget'); widget.appendTo(fooForm); var overlay = widget.prev(); overlay.css('z-index', 999); overlay.appendTo(fooForm); widget.css('position', 'fixed'); widget.css('top', '50%'); widget.css('margin-top', widget.height() / 2 * -1); widget.css('left', '50%'); widget.css('margin-left', widget.width() / 2 * -1); }; var submitMethod = function () { dialog.dialog('option', 'closeOnEscape', false); var widget = dialog.dialog('widget'); var yesButton = $(':button:eq(0)', widget); var noButton = $(':button:eq(1)', widget); var closeButton = $('a.ui-dialog-titlebar-close', widget); noButton.remove(); closeButton.remove(); fooButton.unbind('click', dialogOpenMethod); fooButton.click(); }; dialog.dialog({ autoOpen: false, modal: true, buttons: { 'Ja': submitMethod, 'Nein': function () { dialog.dialog('close'); } }, open: dialogOpenHandlerMethod }); fooButton.bind('click', dialogOpenMethod); } function InitiliazeForm() { fooButton.button(); fooForm.submit(function () { alert('doing a submit'); }); } </script> <input type="submit" id="fooButton" value="submit it!" onclick="FooMethod();"></input> </form> </body> </html> what am i doing? i want a modal-confirmation: user clicks on button, confirmation "do you really want to...?", user clicks "yes", this click unbinds the original click-handler and clicks the button again (which should cause a submit). what/why is not working? indeed you need a special case. this demo won't work, unless you set modal: false. interesting to mention: the original handler (onclick="FooMethod();") is called in modal and non-modal dialog. can anybody help me out? thanks in advance! i also opened a ticket on jqueryUI for this

    Read the article

  • Multiple (variant) arguments overloading in Java: What's the purpose?

    - by fortran
    Browsing google's guava collect library code, I've found the following: // Casting to any type is safe because the list will never hold any elements. @SuppressWarnings("unchecked") public static <E> ImmutableList<E> of() { return (ImmutableList<E>) EmptyImmutableList.INSTANCE; } public static <E> ImmutableList<E> of(E element) { return new SingletonImmutableList<E>(element); } public static <E> ImmutableList<E> of(E e1, E e2) { return new RegularImmutableList<E>( ImmutableList.<E>nullCheckedList(e1, e2)); } public static <E> ImmutableList<E> of(E e1, E e2, E e3) { return new RegularImmutableList<E>( ImmutableList.<E>nullCheckedList(e1, e2, e3)); } public static <E> ImmutableList<E> of(E e1, E e2, E e3, E e4) { return new RegularImmutableList<E>( ImmutableList.<E>nullCheckedList(e1, e2, e3, e4)); } public static <E> ImmutableList<E> of(E e1, E e2, E e3, E e4, E e5) { return new RegularImmutableList<E>( ImmutableList.<E>nullCheckedList(e1, e2, e3, e4, e5)); } public static <E> ImmutableList<E> of(E e1, E e2, E e3, E e4, E e5, E e6) { return new RegularImmutableList<E>( ImmutableList.<E>nullCheckedList(e1, e2, e3, e4, e5, e6)); } public static <E> ImmutableList<E> of( E e1, E e2, E e3, E e4, E e5, E e6, E e7) { return new RegularImmutableList<E>( ImmutableList.<E>nullCheckedList(e1, e2, e3, e4, e5, e6, e7)); } public static <E> ImmutableList<E> of( E e1, E e2, E e3, E e4, E e5, E e6, E e7, E e8) { return new RegularImmutableList<E>( ImmutableList.<E>nullCheckedList(e1, e2, e3, e4, e5, e6, e7, e8)); } public static <E> ImmutableList<E> of( E e1, E e2, E e3, E e4, E e5, E e6, E e7, E e8, E e9) { return new RegularImmutableList<E>( ImmutableList.<E>nullCheckedList(e1, e2, e3, e4, e5, e6, e7, e8, e9)); } public static <E> ImmutableList<E> of( E e1, E e2, E e3, E e4, E e5, E e6, E e7, E e8, E e9, E e10) { return new RegularImmutableList<E>(ImmutableList.<E>nullCheckedList( e1, e2, e3, e4, e5, e6, e7, e8, e9, e10)); } public static <E> ImmutableList<E> of( E e1, E e2, E e3, E e4, E e5, E e6, E e7, E e8, E e9, E e10, E e11) { return new RegularImmutableList<E>(ImmutableList.<E>nullCheckedList( e1, e2, e3, e4, e5, e6, e7, e8, e9, e10, e11)); } public static <E> ImmutableList<E> of( E e1, E e2, E e3, E e4, E e5, E e6, E e7, E e8, E e9, E e10, E e11, E e12, E... others) { final int paramCount = 12; Object[] array = new Object[paramCount + others.length]; arrayCopy(array, 0, e1, e2, e3, e4, e5, e6, e7, e8, e9, e10, e11, e12); arrayCopy(array, paramCount, others); return new RegularImmutableList<E>(ImmutableList.<E>nullCheckedList(array)); } And although it seems reasonable to have overloads for empty and single arguments (as they are going to use special instances), I cannot see the reason behind having all the others, when just the last one (with two fixed arguments plus the variable argument instead the dozen) seems to be enough. As I'm writing, one explanation that pops into my head is that the API pre-dates Java 1.5; and although the signatures would be source-level compatible, the binary interface would differ. Isn't it?

    Read the article

  • MVC DropDownListFor not populating the selected value

    - by user2254436
    I'm really having troubles with MVC, in another project I've done the same thing and it worked fine but in this project I just don't understand why the selected item in the dropdown is not populating the class correctly with EF. I have 2 classes: public partial class License { public License() { this.Customers = new HashSet<Customer>(); } public int LicenseID { get; set; } public int Lic_LicenseTypeID { get; set; } public int Lic_LicenseStatusID { get; set; } public string Lic_LicenseComments { get; set; } public virtual EntitiesList LicenseStatus { get; set; } public virtual EntitiesList LicenseType { get; set; } } public partial class EntitiesList { public EntitiesList() { this.LicensesStatus = new HashSet<License>(); this.LicensesType = new HashSet<License>(); } public int ListID { get; set; } public string List_EntityValue { get; set; } public string List_Comments { get; set; } public string List_EntityName { get; set; } public virtual ICollection<License> LicensesStatus { get; set; } public virtual ICollection<License> LicensesType { get; set; } public string List_DisplayName { get { return Regex.Replace(List_EntityName, "([a-z])([A-Z])", "$1 $2"); ; } } public string List_DisplayValue { get { return Regex.Replace(List_EntityValue, "([a-z])([A-Z])", "$1 $2"); } } } The EntitiesList is table in db that have all my "enum" lists. For example: ListID - 0 List_EntityValue - Activate List_EntityName - LicenseStatus ListID - 1 List_EntityValue - Basic List_EntityName - LicenseType This is my model: public class LicenseModel { public License License { get; set; } public SelectList LicenseStatuses { get; set; } public int SelectedStatus { get; set; } public SelectList LicenseTypes { get; set; } public int SelectedType { get; set; } } My controller for create: public ActionResult Create() { LicenseModel model = new LicenseModel(); model.License = new License(); model.LicenseStatuses = new SelectList(managerLists.GetAllLicenseStatuses(), "ListID", "List_DisplayValue"); model.LicenseTypes = new SelectList(managerLists.GetAllLicenseTypes(), "ListID", "List_DisplayValue"); return View(model); } [HttpPost] [ValidateAntiForgeryToken] public ActionResult Create(LicenseModel model) { if (ModelState.IsValid) { model.License.Lic_LicenseTypeID = model.SelectedType; model.License.Lic_LicenseStatusID = model.SelectedStatus; managerLicense.AddNewObject(model.License); return RedirectToAction("Index"); } return View(model); } managerLists and managerLicense are the managers that connect between the entities in db and the MVC UI, nothing special... they contains queries for adding new objects, getting the lists, editing and so on. And the view for creating the License: @using (Html.BeginForm()) { @Html.AntiForgeryToken() @Html.ValidationSummary(true) <fieldset> <legend>License</legend> <div class="form-group"> @Html.LabelFor(model => model.License.Lic_LicenseTypeID) @Html.DropDownListFor(model => model.SelectedType, Model.LicenseTypes, new { @class = "form-control" }) <p class="help-block">@Html.ValidationMessageFor(model => model.License.Lic_LicenseTypeID)</p> </div> <div class="form-group"> @Html.LabelFor(model => model.License.Lic_LicenseStatusID) @Html.DropDownListFor(model => model.SelectedStatus, Model.LicenseStatuses, new { @class = "form-control" }) <p class="help-block">@Html.ValidationMessageFor(model => model.License.Lic_LicenseStatusID)</p> </div> <div class="form-group"> @Html.LabelFor(model => model.License.Lic_LicenseComments) @Html.TextAreaFor(model => model.License.Lic_LicenseComments, new { @class = "form-control", rows = "3" }) <p class="help-block">@Html.ValidationMessageFor(model => model.License.Lic_LicenseComments)</p> </div> <p> <input type="submit" value="Create" /> </p> </fieldset> } Now, when I'm trying to save the new license, when it gets to the db.SaveChanges() in the manager I'm getting: "Validation failed for one or more entities. See 'EntityValidationErrors' property for more details." In breakpoint, the Lic_LicenseTypeID and Lic_LicenseStatusID are getting correctly the ID's from the selected item in the dropdown but the LicenseStatus and LicenseStatus properties are null. What an I missing?

    Read the article

  • Implicit constructor available for all types derived from Base excepted the current type?

    - by Vincent
    The following code sum up my problem : template<class Parameter> class Base {}; template<class Parameter1, class Parameter2, class Parameter> class Derived1 : public Base<Parameter> { }; template<class Parameter1, class Parameter2, class Parameter> class Derived2 : public Base<Parameter> { public : // Copy constructor Derived2(const Derived2& x); // An EXPLICIT constructor that does a special conversion for a Derived2 // with other template parameters template<class OtherParameter1, class OtherParameter2, class OtherParameter> explicit Derived2( const Derived2<OtherParameter1, OtherParameter2, OtherParameter>& x ); // Now the problem : I want an IMPLICIT constructor that will work for every // type derived from Base EXCEPT // Derived2<OtherParameter1, OtherParameter2, OtherParameter> template<class Type, class = typename std::enable_if</* SOMETHING */>::type> Derived2(const Type& x); }; How to restrict an implicit constructor to all classes derived from the parent class excepted the current class whatever its template parameters, considering that I already have an explicit constructor as in the example code ? EDIT : For the implicit constructor from Base, I can obviously write : template<class OtherParameter> Derived2(const Base<OtherParameter>& x); But in that case, do I have the guaranty that the compiler will not use this constructor as an implicit constructor for Derived2<OtherParameter1, OtherParameter2, OtherParameter> ? EDIT2: Here I have a test : (LWS here : http://liveworkspace.org/code/cd423fb44fb4c97bc3b843732d837abc) #include <iostream> template<typename Type> class Base {}; template<typename Type> class Other : public Base<Type> {}; template<typename Type> class Derived : public Base<Type> { public: Derived() {std::cout<<"empty"<<std::endl;} Derived(const Derived<Type>& x) {std::cout<<"copy"<<std::endl;} template<typename OtherType> explicit Derived(const Derived<OtherType>& x) {std::cout<<"explicit"<<std::endl;} template<typename OtherType> Derived(const Base<OtherType>& x) {std::cout<<"implicit"<<std::endl;} }; int main() { Other<int> other0; Other<double> other1; std::cout<<"1 = "; Derived<int> dint1; // <- empty std::cout<<"2 = "; Derived<int> dint2; // <- empty std::cout<<"3 = "; Derived<double> ddouble; // <- empty std::cout<<"4 = "; Derived<double> ddouble1(ddouble); // <- copy std::cout<<"5 = "; Derived<double> ddouble2(dint1); // <- explicit std::cout<<"6 = "; ddouble = other0; // <- implicit std::cout<<"7 = "; ddouble = other1; // <- implicit std::cout<<"8 = "; ddouble = ddouble2; // <- nothing (normal : default assignment) std::cout<<"\n9 = "; ddouble = Derived<double>(dint1); // <- explicit std::cout<<"10 = "; ddouble = dint2; // <- implicit : WHY ?!?! return 0; } The last line worry me. Is it ok with the C++ standard ? Is it a bug of g++ ?

    Read the article

  • Memory error, access violation.

    - by Ordo
    Hello! I'm learning C on my own and as a exercise i have written a program but it does not work. The program is splitted into 3 parts. A header file, a main file for executing the program a file to define the functions. I'm not using all the functions yet but that shouldn't be the problem. Here is my header file, nothing special in it. #ifndef EMPLOYEE_H #define EMPLOYEE_H struct Employee { char first[21]; char last[21]; char title[21]; int salary; }; struct Employee* createEmployee(char*, char*, char*, int); // Creates a struct Employee object on the heap. char* getfirstname (struct Employee*); char* getlastname (struct Employee*); char* gettitle (struct Employee*); int getsalary (struct Employee*); void setfirstname (struct Employee*, char*); void setlastname (struct Employee*, char*); void settitle (struct Employee*, char*); void setsalary (struct Employee*, int); void printEmployee(struct Employee*); #endif In this file i define the functions and how they work: #include "7.1.h" #include <stdio.h> #include <stdlib.h> #include <string.h> struct Employee* createEmployee(char* first, char* last, char* title, int salary) // Creates a struct Employee object on the heap. { struct Employee* p = (struct Employee*) malloc(sizeof(struct Employee)); if (p != NULL) { strcpy(p->first, first); strcpy(p->last, last); strcpy(p->title, title); p->salary, salary; } return p; } char* getfirstname (struct Employee* p) { if (p != NULL) return p ? p->first : ""; } char* getlastname (struct Employee* p) { if (p != NULL) return p ? p->last : ""; } char* gettitle (struct Employee* p) { if (p != NULL) return p ? p->title : ""; } int getsalary (struct Employee* p) { if (p != NULL) return p ? p->salary : 0; } void setfirstname (struct Employee* p, char* first) { if (p != NULL) strcpy(p->first, first); } void setlastname (struct Employee* p, char* last) { if (p != NULL) strcpy(p->last, last); } void settitle (struct Employee* p, char* title) { if (p != NULL) strcpy(p->title, title); } void setsalary (struct Employee* p, char* salary) { if (p != NULL) p->salary, salary; } void printEmployee(struct Employee* p) { if (p != NULL) { printf("%s, %s, %s, %d", p->first, p->last, p->salary, p->salary ); } } And the last file is used to executed the program/functions: #include "7.1.h" #include <stdio.h> #include <stdlib.h> int main () { char decision; struct Employee emp; struct Employee* emps[3]; for ( int i = 0; i < 1; i ++) { printf("Please type in the emplooyes data.\nFirstname:"); scanf("%s", emp.first); printf("Lastname:"); scanf("%s", emp.last); printf("Title:"); scanf("%s", emp.title); printf("Salary:"); scanf("%d", &emp.salary); emps[i] = createEmployee(emp.first, emp.last, emp.title, emp.salary); } printf("Do you want to print out your information? (Y/N):"); scanf("%c", &decision); if (decision == 'y' || decision == 'Y') { printEmployee(emps[1]); } } I don't know what the problem is. I 'm always getting the following error message after typing in first, last, title and salary for the first time. The error is written in german. It means: Unhandled exception at 0x102de42e (msvcr100d.dll) in 7.1.exe: 0xC0000005: Access violation when writing to 0xCCCCCCCC position. I could fix the first problem with the hints given below. Now when i want to print out the employee data using the function:printEmployee(emps[1]);, I get the same kind of error with access violation.

    Read the article

  • How should I implement simple caches with concurrency on Redis?

    - by solublefish
    Background I have a 2-tier web service - just my app server and an RDBMS. I want to move to a pool of identical app servers behind a load balancer. I currently cache a bunch of objects in-process. I hope to move them to a shared Redis. I have a dozen or so caches of simple, small-sized business objects. For example, I have a set of Foos. Each Foo has a unique FooId and an OwnerId. One "owner" may own multiple Foos. In a traditional RDBMS this is just a table with an index on the PK FooId and one on OwnerId. I'm caching this in one process simply: Dictionary<int,Foo> _cacheFooById; Dictionary<int,HashSet<int>> _indexFooIdsByOwnerId; Reads come straight from here, and writes go here and to the RDBMS. I usually have this invariant: "For a given group [say by OwnerId], the whole group is in cache or none of it is." So when I cache miss on a Foo, I pull that Foo and all the owner's other Foos from the RDBMS. Updates make sure to keep the index up to date and respect the invariant. When an owner calls GetMyFoos I never have to worry that some are cached and some aren't. What I did already The first/simplest answer seems to be to use plain ol' SET and GET with a composite key and json value: SET( "ServiceCache:Foo:" + theFoo.Id, JsonSerialize(theFoo)); I later decided I liked: HSET( "ServiceCache:Foo", theFoo.FooId, JsonSerialize(theFoo)); That lets me get all the values in one cache as HVALS. It also felt right - I'm literally moving hashtables to Redis, so perhaps my top-level items should be hashes. This works to first order. If my high-level code is like: UpdateCache(myFoo); AddToIndex(myFoo); That translates into: HSET ("ServiceCache:Foo", theFoo.FooId, JsonSerialize(theFoo)); var myFoos = JsonDeserialize( HGET ("ServiceCache:FooIndex", theFoo.OwnerId) ); myFoos.Add(theFoo.OwnerId); HSET ("ServiceCache:FooIndex", theFoo.OwnerId, JsonSerialize(myFoos)); However, this is broken in two ways. Two concurrent operations can read/modify/write at the same time. The latter "wins" the final HSET and the former's index update is lost. Another operation could read the index in between the first and second lines. It would miss a Foo that it should find. So how do I index properly? I think I could use a Redis set instead of a json-encoded value for the index. That would solve part of the problem since the "add-to-index-if-not-already-present" would be atomic. I also read about using MULTI as a "transaction" but it doesn't seem like it does what I want. Am I right that I can't really MULTI; HGET; {update}; HSET; EXEC since it doesn't even do the HGET before I issue the EXEC? I also read about using WATCH and MULTI for optimistic concurrency, then retrying on failure. But WATCH only works on top-level keys. So it's back to SET/GET instead of HSET/HGET. And now I need a new index-like-thing to support getting all the values in a given cache. If I understand it right, I can combine all these things to do the job. Something like: while(!succeeded) { WATCH( "ServiceCache:Foo:" + theFoo.FooId ); WATCH( "ServiceCache:FooIndexByOwner:" + theFoo.OwnerId ); WATCH( "ServiceCache:FooIndexAll" ); MULTI(); SET ("ServiceCache:Foo:" + theFoo.FooId, JsonSerialize(theFoo)); SADD ("ServiceCache:FooIndexByOwner:" + theFoo.OwnerId, theFoo.FooId); SADD ("ServiceCache:FooIndexAll", theFoo.FooId); EXEC(); //TODO somehow set succeeded properly } Finally I'd have to translate this pseudocode into real code depending how my client library uses WATCH/MULTI/EXEC; it looks like they need some sort of context to hook them together. All in all this seems like a lot of complexity for what has to be a very common case; I can't help but think there's a better, smarter, Redis-ish way to do things that I'm just not seeing. How do I lock properly? Even if I had no indexes, there's still a (probably rare) race condition. A: HGET - cache miss B: HGET - cache miss A: SELECT B: SELECT A: HSET C: HGET - cache hit C: UPDATE C: HSET B: HSET ** this is stale data that's clobbering C's update. Note that C could just be a really-fast A. Again I think WATCH, MULTI, retry would work, but... ick. I know in some places people use special Redis keys as locks for other objects. Is that a reasonable approach here? Should those be top-level keys like ServiceCache:FooLocks:{Id} or ServiceCache:Locks:Foo:{Id}? Or make a separate hash for them - ServiceCache:Locks with subkeys Foo:{Id}, or ServiceCache:Locks:Foo with subkeys {Id} ? How would I work around abandoned locks, say if a transaction (or a whole server) crashes while "holding" the lock?

    Read the article

  • Windows 7 SP1 not being offered on Windows Update

    - by Ian Boyd
    i have no option to install Windows 7 Service Pack 1 (SP1) on my computer. Why is the option to install Windows 7 SP1 missing from Windows Update? i'm less interested in why the option is missing, and more interested in how to diagnose why the option to install Windows 7 SP1 is being hidden. Following the suggestions in KB2498452 - You do not have the option of downloading Windows 7 SP1 when you use Windows Update to check for updates: Confirm that Windows 7 SP1 is not already installed and that you are not running a prerelease version of Windows 7 SP1 i am not already running SP1, or a pre-release SP1: Check for pending updates Update 976902 may have to be installed on your computer before Windows 7 SP1 will be offered in Windows Update. i already have 976902 installed: Verify that an incompatible version of SafeCentral is not installed on your computer Windows SP1 may not appear in Windows Update if certain versions of SafeCentral are installed on your computer. SafeCentral is a security program that is manufactured by SafeCentral, Inc. i do not have SafeCentral installed (i've never heard of such a thing): Check whether you have Intel integrated graphics driver Igdkmd32.sys or Igdkmd64.sys and whether you upgraded the driver i do not have an Intel GMA: Make sure that you did not use vLite to customize your Windows 7 installation i did not use vLite to customize my Windows 7 installation. Again, i've never heard of such a thing. Update One: Here's proof that i've checked for updates "today" (3/2/2011): And that i'm not being presented the option of installing SP1 (i dispatched an update to Silverlight and a fix for IE9 being hosted in a Direct2D or Direct3D application; so updates themselves do work): Update Two Tried the Windows Update Troubleshooter: Window 7 Service Pack 1 is still not available. Update Three Here is the tail end of windowsupdate.log. It speaks of Evaluating application rules: Found 2 updates and 65 categories in search; evaluated appl. rules of 1324 out of 1832 deployed entities These must be the rules that say i'm not allowed to see SP1: 2011-03-03 09:21:08:091 924 db4 AU Triggering AU detection through DetectNow API 2011-03-03 09:21:08:091 924 db4 AU Triggering Online detection (interactive) 2011-03-03 09:21:08:091 924 950 AU ############# 2011-03-03 09:21:08:092 924 950 AU ## START ## AU: Search for updates 2011-03-03 09:21:08:092 924 950 AU ######### 2011-03-03 09:21:08:093 924 950 AU <<## SUBMITTED ## AU: Search for updates [CallId = {8517376A-B8A3-488B-B4D4-67DFC75788C8}] 2011-03-03 09:21:08:093 924 ca8 Agent ************* 2011-03-03 09:21:08:093 924 ca8 Agent ** START ** Agent: Finding updates [CallerId = AutomaticUpdates] 2011-03-03 09:21:08:093 924 ca8 Agent ********* 2011-03-03 09:21:08:093 924 ca8 Agent * Online = Yes; Ignore download priority = No 2011-03-03 09:21:08:093 924 ca8 Agent * Criteria = "IsInstalled=0 and DeploymentAction='Installation' or IsPresent=1 and DeploymentAction='Uninstallation' or IsInstalled=1 and DeploymentAction='Installation' and RebootRequired=1 or IsInstalled=0 and DeploymentAction='Uninstallation' and RebootRequired=1" 2011-03-03 09:21:08:093 924 ca8 Agent * ServiceID = {7971F918-A847-4430-9279-4A52D1EFE18D} Third party service 2011-03-03 09:21:08:093 924 ca8 Agent * Search Scope = {Machine} 2011-03-03 09:21:08:094 924 ca8 Misc Validating signature for C:\Windows\SoftwareDistribution\WuRedir\9482F4B4-E343-43B6-B170-9A65BC822C77\muv4wuredir.cab: 2011-03-03 09:21:08:097 924 ca8 Misc Microsoft signed: Yes 2011-03-03 09:21:08:287 924 ca8 Misc Validating signature for C:\Windows\SoftwareDistribution\WuRedir\9482F4B4-E343-43B6-B170-9A65BC822C77\muv4wuredir.cab: 2011-03-03 09:21:08:289 924 ca8 Misc Microsoft signed: Yes 2011-03-03 09:21:08:292 924 ca8 Agent Checking for updated auth cab for service 7971f918-a847-4430-9279-4a52d1efe18d at http://download.windowsupdate.com/v9/microsoftupdate/redir/muauth.cab 2011-03-03 09:21:08:292 924 ca8 Misc Validating signature for C:\Windows\SoftwareDistribution\AuthCabs\authcab.cab: 2011-03-03 09:21:08:294 924 ca8 Misc Microsoft signed: Yes 2011-03-03 09:21:08:354 924 ca8 Misc Validating signature for C:\Windows\SoftwareDistribution\AuthCabs\authcab.cab: 2011-03-03 09:21:08:356 924 ca8 Misc Microsoft signed: Yes 2011-03-03 09:21:08:356 924 ca8 Setup Checking for agent SelfUpdate 2011-03-03 09:21:08:356 924 ca8 Setup Client version: Core: 7.3.7600.16385 Aux: 7.3.7600.16385 2011-03-03 09:21:08:357 924 ca8 Misc Validating signature for C:\Windows\SoftwareDistribution\WuRedir\9482F4B4-E343-43B6-B170-9A65BC822C77\muv4wuredir.cab: 2011-03-03 09:21:08:359 924 ca8 Misc Microsoft signed: Yes 2011-03-03 09:21:08:418 924 ca8 Misc Validating signature for C:\Windows\SoftwareDistribution\WuRedir\9482F4B4-E343-43B6-B170-9A65BC822C77\muv4wuredir.cab: 2011-03-03 09:21:08:420 924 ca8 Misc Microsoft signed: Yes 2011-03-03 09:21:08:422 924 ca8 Misc Validating signature for C:\Windows\SoftwareDistribution\SelfUpdate\wuident.cab: 2011-03-03 09:21:08:424 924 ca8 Misc Microsoft signed: Yes 2011-03-03 09:21:08:655 924 ca8 Misc Validating signature for C:\Windows\SoftwareDistribution\SelfUpdate\wuident.cab: 2011-03-03 09:21:08:658 924 ca8 Misc Microsoft signed: Yes 2011-03-03 09:21:08:659 924 ca8 Setup Skipping SelfUpdate check based on the /SKIP directive in wuident 2011-03-03 09:21:08:659 924 ca8 Setup SelfUpdate check completed. SelfUpdate is NOT required. 2011-03-03 09:21:08:808 924 ca8 Misc Validating signature for C:\Windows\SoftwareDistribution\WuRedir\7971F918-A847-4430-9279-4A52D1EFE18D\muv4muredir.cab: 2011-03-03 09:21:08:810 924 ca8 Misc Microsoft signed: Yes 2011-03-03 09:21:08:872 924 ca8 Misc Validating signature for C:\Windows\SoftwareDistribution\WuRedir\7971F918-A847-4430-9279-4A52D1EFE18D\muv4muredir.cab: 2011-03-03 09:21:08:874 924 ca8 Misc Microsoft signed: Yes 2011-03-03 09:21:08:876 924 ca8 PT +++++++++++ PT: Synchronizing server updates +++++++++++ 2011-03-03 09:21:08:877 924 ca8 PT + ServiceId = {7971F918-A847-4430-9279-4A52D1EFE18D}, Server URL = https://www.update.microsoft.com/v6/ClientWebService/client.asmx 2011-03-03 09:21:13:958 924 ca8 Misc Validating signature for C:\Windows\SoftwareDistribution\WuRedir\7971F918-A847-4430-9279-4A52D1EFE18D\muv4muredir.cab: 2011-03-03 09:21:13:960 924 ca8 Misc Microsoft signed: Yes 2011-03-03 09:21:14:083 924 ca8 Misc Validating signature for C:\Windows\SoftwareDistribution\WuRedir\7971F918-A847-4430-9279-4A52D1EFE18D\muv4muredir.cab: 2011-03-03 09:21:14:085 924 ca8 Misc Microsoft signed: Yes 2011-03-03 09:21:14:087 924 ca8 PT +++++++++++ PT: Synchronizing extended update info +++++++++++ 2011-03-03 09:21:14:087 924 ca8 PT + ServiceId = {7971F918-A847-4430-9279-4A52D1EFE18D}, Server URL = https://www.update.microsoft.com/v6/ClientWebService/client.asmx 2011-03-03 09:21:14:395 924 ca8 Agent * Added update {414642E2-5F20-4AD1-AA5A-773061238B5F}.101 to search result 2011-03-03 09:21:14:395 924 ca8 Agent * Added update {56D5FC3D-9AC8-44F1-A248-8C397A24D02F}.100 to search result 2011-03-03 09:21:14:395 924 ca8 Agent * Found 2 updates and 65 categories in search; evaluated appl. rules of 1324 out of 1832 deployed entities 2011-03-03 09:21:14:396 924 ca8 Agent ********* 2011-03-03 09:21:14:396 924 ca8 Agent ** END ** Agent: Finding updates [CallerId = AutomaticUpdates] 2011-03-03 09:21:14:396 924 ca8 Agent ************* 2011-03-03 09:21:14:404 924 ce0 AU >>## RESUMED ## AU: Search for updates [CallId = {8517376A-B8A3-488B-B4D4-67DFC75788C8}] 2011-03-03 09:21:14:404 924 ce0 AU # 2 updates detected 2011-03-03 09:21:14:404 924 ce0 AU ######### 2011-03-03 09:21:14:404 924 ce0 AU ## END ## AU: Search for updates [CallId = {8517376A-B8A3-488B-B4D4-67DFC75788C8}] 2011-03-03 09:21:14:404 924 ce0 AU ############# 2011-03-03 09:21:14:404 924 ce0 AU Successfully wrote event for AU health state:0 2011-03-03 09:21:14:405 924 ce0 AU ############# 2011-03-03 09:21:14:405 924 ce0 AU ## START ## AU: Refresh featured updates info 2011-03-03 09:21:14:405 924 ce0 AU ######### 2011-03-03 09:21:14:405 924 ce0 AU No featured updates available. 2011-03-03 09:21:14:405 924 ce0 AU ######### 2011-03-03 09:21:14:405 924 ce0 AU ## END ## AU: Refresh featured updates info 2011-03-03 09:21:14:405 924 ce0 AU ############# 2011-03-03 09:21:14:405 924 ce0 AU No featured updates notifications to show 2011-03-03 09:21:14:405 924 ce0 AU AU setting next detection timeout to 2011-03-04 08:03:53 2011-03-03 09:21:14:405 924 ce0 AU Setting AU scheduled install time to 2011-03-04 08:00:00 2011-03-03 09:21:14:405 924 ce0 AU Successfully wrote event for AU health state:0 2011-03-03 09:21:14:406 924 ce0 AU Successfully wrote event for AU health state:0 2011-03-03 09:21:14:407 924 db4 AU Getting featured update notifications. fIncludeDismissed = true 2011-03-03 09:21:14:408 924 db4 AU No featured updates available. 2011-03-03 09:21:19:396 924 ca8 Report REPORT EVENT: {633538B3-030E-4CAD-BE6B-33C6ED65AFF1} 2011-03-03 09:21:14:395-0500 1 147 101 {00000000-0000-0000-0000-000000000000} 0 0 AutomaticUpdates Success Software Synchronization Windows Update Client successfully detected 2 updates. 2011-03-03 09:21:19:396 924 ca8 Report CWERReporter finishing event handling. (00000000) i'm less interested in why the option to install Windows 7 SP1 is missing, and more interested in how to diagnose why the option to install Windows 7 SP1 is being hidden. The KB article says that SP1 will not be offered if your machine doesn't meet some secret special criteria. How can i discover what that secret criteria is? i presume it is logged somewhere. Nor am i particularly interested in a direct download link. i want to learn here. i want to be able to diagnose (i.e. in the future) why an update is not being offered. i'm a superuser here. Rather than others coming up with a checklist of things to try, i want to be able to come up with the checklist.

    Read the article

  • IIS Strategies for Accessing Secured Network Resources

    - by ErikE
    Problem: A user connects to a service on a machine, such as an IIS web site or a SQL Server database. The site or the database need to gain access to network resources such as file shares (the most common) or a database on a different server. Permission is denied. This is because the user the service is running under doesn't have network permissions in the first place, or if it does, it doesn't have rights to access the remote resource. I keep running into this problem over and over again and am tired of not having a really solid way of handling it. Here are some workarounds I'm aware of: Run IIS as a custom-created domain user who is granted high permissions If permissions are granted one file share at a time, then every time I want to read from a new share, I would have to ask a network admin to add it for me. Eventually, with many web sites reading from many shares, it is going to get really complicated. If permissions are just opened up wide for the user to access any file shares in our domain, then this seems like an unnecessary security surface area to present. This also applies to all the sites running on IIS, rather than just the selected site or virtual directory that needs the access, a further surface area problem. Still use the IUSR account but give it network permissions and set up the same user name on the remote resource (not a domain user, a local user) This also has its problems. For example, there's a file share I am using that I have full rights to for sharing, but I can't log in to the machine. So I have to find the right admin and ask him to do it for me. Any time something has to change, it's another request to an admin. Allow IIS users to connect as anonymous, but set the account used for anonymous access to a high-privilege one This is even worse than giving the IIS IUSR full privileges, because it means my web site can't use any kind of security in the first place. Connect using Kerberos, then delegate This sounds good in principle but has all sorts of problems. First of all, if you're using virtual web sites where the domain name you connect to the site with is not the base machine name (as we do frequently), then you have to set up a Service Principal Name on the webserver using Microsoft's SetSPN utility. It's complicated and apparently prone to errors. Also, you have to ask your network/domain admin to change security policy for both the web server and the domain account so they are "trusted for delegation." If you don't get everything perfectly right, suddenly your intended Kerberos authentication is NTLM instead, and you can only impersonate rather than delegate, and thus no reaching out over the network as the user. Also, this method can be problematic because sometimes you need the web site or database to have permissions that the connecting user doesn't have. Create a service or COM+ application that fetches the resource for the web site Services and COM+ packages are run with their own set of credentials. Running as a high-privilege user is okay since they can do their own security and deny requests that are not legitimate, putting control in the hands of the application developer instead of the network admin. Problems: I am using a COM+ package that does exactly this on Windows Server 2000 to deliver highly sensitive images to a secured web application. I tried moving the web site to Windows Server 2003 and was suddenly denied permission to instantiate the COM+ object, very likely registry permissions. I trolled around quite a bit and did not solve the problem, partly because I was reluctant to give the IUSR account full registry permissions. That seems like the same bad practice as just running IIS as a high-privilege user. Note: This is actually really simple. In a programming language of your choice, you create a class with a function that returns an instance of the object you want (an ADODB.Connection, for example), and build a dll, which you register as a COM+ object. In your web server-side code, you create an instance of the class and use the function, and since it is running under a different security context, calls to network resources work. Map drive letters to shares This could theoretically work, but in my mind it's not really a good long-term strategy. Even though mappings can be created with specific credentials, and this can be done by others than a network admin, this also is going to mean that there are either way too many shared drives (small granularity) or too much permission is granted to entire file servers (large granularity). Also, I haven't figured out how to map a drive so that the IUSR gets the drives. Mapping a drive is for the current user, I don't know the IUSR account password to log in as it and create the mappings. Move the resources local to the web server/database There are times when I've done this, especially with Access databases. Does the database have to live out on the file share? Sometimes, it was just easiest to move the database to the web server or to the SQL database server (so the linked server to it would work). But I don't think this is a great all-around solution, either. And it won't work when the resource is a service rather than a file. Move the service to the final web server/database I suppose I could run a web server on my SQL Server database, so the web site can connect to it using impersonation and make me happy. But do we really want random extra web servers on our database servers just so this is possible? No. Virtual directories in IIS I know that virtual directories can help make remote resources look as though they are local, and this supports using custom credentials for each virtual directory. I haven't been able to come up with, yet, how this would solve the problem for system calls. Users could reach file shares directly, but this won't help, say, classic ASP code access resources. I could use a URL instead of a file path to read remote data files in a web page, but this isn't going to help me make a connection to an Access database, a SQL server database, or any other resource that uses a connection library rather than being able to just read all the bytes and work with them. I wish there was some kind of "service tunnel" that I could create. Think about how a VPN makes remote resources look like they are local. With a richer aliasing mechanism, perhaps code-based, why couldn't even database connections occur under a defined security context? Why not a special Windows component that lets you specify, per user, what resources are available and what alternate credentials are used for the connection? File shares, databases, web sites, you name it. I guess I'm almost talking about a specialized local proxy server. Anyway, so there's my list. I may update it if I think of more. Does anyone have any ideas for me? My current problem today is, yet again, I need a web site to connect to an Access database on a file share. Here we go again...

    Read the article

  • External USB attached drive works in Windows XP but not in Windows 7. How to fix?

    - by irrational John
    Earlier this week I purchased this "N52300 EZQuest Pro" external hard drive enclosure from here. I can connect the enclosure using USB 2.0 and access the files in both NTFS partitions on the MBR partitioned drive when I use either Windows XP (SP3) or Mac OS X 10.6. So it works as expected in XP & Snow Leopard. However, the enclosure does not work in Windows 7 (Home Premium) either 64-bit or 32-bit or in Ubuntu 10.04 (kernel 2.6.32-23-generic). I'm thinking this must be a Windows 7 driver problem because the enclosure works in XP & Snow Leopard. I do know that no special drivers are required to use this enclosure. It is supported using the USB mass storage drivers included with XP and OS X. It should also work fine using the mass storage support in Windows 7, no? FWIW, I have also tried using 32-bit Windows 7 on both my desktop, a Gigabyte GA-965P-DS3 with a Pentium Dual-Core E6500 @ 2.93GHz, and on my early 2008 MacBook. I see the same failure in both cases that I see with 64-bit Windows 7. So it doesn't appear to be specific to one hardware platform. I'm hoping someone out there can help me either get the enclosure to work in Windows 7 or convince me that the enclosure hardware is bad and should be RMAed. At the moment though an RMA seems pointless since this appears to be a (Windows 7) device driver problem. I have tried to track down any updates to the mass storage drivers included with Windows 7 but have so far come up empty. Heck, I can't even figure out how to place a bug report with Microsoft since apparently the grace period for Windows 7 email support is only a few months. I came across a link to some USB troubleshooting steps in another question. I haven't had a chance to look over the suggestions on that site or try them yet. Maybe tomorrow if I have time ... ;-) I'll finish up with some more details about the problem. When I connect the enclosure using USB to Windows 7 at first it appears everything worked. Windows detects the drive and installs a driver for it. Looking in Device Manager there is an entry under the Hard Drives section with the title, Hitachi HDT721010SLA360 USB Device. When you open Windows Disk Management the first time after the enclosure has been attached the drive appears as "Not initialize" and I'm prompted to initialize it. This is bogus. After all, the drive worked fine in XP so I know it has already been initialized, partitioned, and formatted. So of course I never try to initialize it "again". (It's a 1 GB drive and I don't want to lose the data on it). Except for this first time, the drive never shows up in Disk Management again unless I uninstall the Hitachi HDT721010SLA360 USB Device entry under Hard Drives, unplug, and then replug the enclosure. If I do that then the process in the previous paragraph repeats. In Ubuntu the enclosure never shows up at all at the file system level. Below are an excerpt from kern.log and an excerpt from the result of lsusb -v after attaching the enclosure. It appears that Ubuntu at first recongnizes the enclosure and is attempting to attach it, but encounters errors which prevent it from doing so. Unfortunately, I don't know whether any of this info is useful or not. excerpt from kern.log [ 2684.240015] usb 1-2: new high speed USB device using ehci_hcd and address 22 [ 2684.393618] usb 1-2: configuration #1 chosen from 1 choice [ 2684.395399] scsi17 : SCSI emulation for USB Mass Storage devices [ 2684.395570] usb-storage: device found at 22 [ 2684.395572] usb-storage: waiting for device to settle before scanning [ 2689.390412] usb-storage: device scan complete [ 2689.390894] scsi 17:0:0:0: Direct-Access Hitachi HDT721010SLA360 ST6O PQ: 0 ANSI: 4 [ 2689.392237] sd 17:0:0:0: Attached scsi generic sg7 type 0 [ 2689.395269] sd 17:0:0:0: [sde] 1953525168 512-byte logical blocks: (1.00 TB/931 GiB) [ 2689.395632] sd 17:0:0:0: [sde] Write Protect is off [ 2689.395636] sd 17:0:0:0: [sde] Mode Sense: 11 00 00 00 [ 2689.395639] sd 17:0:0:0: [sde] Assuming drive cache: write through [ 2689.412003] sd 17:0:0:0: [sde] Assuming drive cache: write through [ 2689.412009] sde: sde1 sde2 [ 2689.455759] sd 17:0:0:0: [sde] Assuming drive cache: write through [ 2689.455765] sd 17:0:0:0: [sde] Attached SCSI disk [ 2692.620017] usb 1-2: reset high speed USB device using ehci_hcd and address 22 [ 2707.740014] usb 1-2: device descriptor read/64, error -110 [ 2722.970103] usb 1-2: device descriptor read/64, error -110 [ 2723.200027] usb 1-2: reset high speed USB device using ehci_hcd and address 22 [ 2738.320019] usb 1-2: device descriptor read/64, error -110 [ 2753.550024] usb 1-2: device descriptor read/64, error -110 [ 2753.780020] usb 1-2: reset high speed USB device using ehci_hcd and address 22 [ 2758.810147] usb 1-2: device descriptor read/8, error -110 [ 2763.940142] usb 1-2: device descriptor read/8, error -110 [ 2764.170014] usb 1-2: reset high speed USB device using ehci_hcd and address 22 [ 2769.200141] usb 1-2: device descriptor read/8, error -110 [ 2774.330137] usb 1-2: device descriptor read/8, error -110 [ 2774.440069] usb 1-2: USB disconnect, address 22 [ 2774.440503] sd 17:0:0:0: Device offlined - not ready after error recovery [ 2774.590023] usb 1-2: new high speed USB device using ehci_hcd and address 23 [ 2789.710020] usb 1-2: device descriptor read/64, error -110 [ 2804.940020] usb 1-2: device descriptor read/64, error -110 [ 2805.170026] usb 1-2: new high speed USB device using ehci_hcd and address 24 [ 2820.290019] usb 1-2: device descriptor read/64, error -110 [ 2835.520027] usb 1-2: device descriptor read/64, error -110 [ 2835.750018] usb 1-2: new high speed USB device using ehci_hcd and address 25 [ 2840.780085] usb 1-2: device descriptor read/8, error -110 [ 2845.910079] usb 1-2: device descriptor read/8, error -110 [ 2846.140023] usb 1-2: new high speed USB device using ehci_hcd and address 26 [ 2851.170112] usb 1-2: device descriptor read/8, error -110 [ 2856.300077] usb 1-2: device descriptor read/8, error -110 [ 2856.410027] hub 1-0:1.0: unable to enumerate USB device on port 2 [ 2856.730033] usb 3-2: new full speed USB device using uhci_hcd and address 11 [ 2871.850017] usb 3-2: device descriptor read/64, error -110 [ 2887.080014] usb 3-2: device descriptor read/64, error -110 [ 2887.310011] usb 3-2: new full speed USB device using uhci_hcd and address 12 [ 2902.430021] usb 3-2: device descriptor read/64, error -110 [ 2917.660013] usb 3-2: device descriptor read/64, error -110 [ 2917.890016] usb 3-2: new full speed USB device using uhci_hcd and address 13 [ 2922.911623] usb 3-2: device descriptor read/8, error -110 [ 2928.051753] usb 3-2: device descriptor read/8, error -110 [ 2928.280013] usb 3-2: new full speed USB device using uhci_hcd and address 14 [ 2933.301876] usb 3-2: device descriptor read/8, error -110 [ 2938.431993] usb 3-2: device descriptor read/8, error -110 [ 2938.540073] hub 3-0:1.0: unable to enumerate USB device on port 2 excerpt from lsusb -v Bus 001 Device 017: ID 0dc4:0000 Macpower Peripherals, Ltd Device Descriptor: bLength 18 bDescriptorType 1 bcdUSB 2.00 bDeviceClass 0 (Defined at Interface level) bDeviceSubClass 0 bDeviceProtocol 0 bMaxPacketSize0 64 idVendor 0x0dc4 Macpower Peripherals, Ltd idProduct 0x0000 bcdDevice 0.01 iManufacturer 1 EZ QUEST iProduct 2 USB Mass Storage iSerial 3 220417 bNumConfigurations 1 Configuration Descriptor: bLength 9 bDescriptorType 2 wTotalLength 32 bNumInterfaces 1 bConfigurationValue 1 iConfiguration 5 Config0 bmAttributes 0xc0 Self Powered MaxPower 0mA Interface Descriptor: bLength 9 bDescriptorType 4 bInterfaceNumber 0 bAlternateSetting 0 bNumEndpoints 2 bInterfaceClass 8 Mass Storage bInterfaceSubClass 6 SCSI bInterfaceProtocol 80 Bulk (Zip) iInterface 4 Interface0 Endpoint Descriptor: bLength 7 bDescriptorType 5 bEndpointAddress 0x01 EP 1 OUT bmAttributes 2 Transfer Type Bulk Synch Type None Usage Type Data wMaxPacketSize 0x0200 1x 512 bytes bInterval 0 Endpoint Descriptor: bLength 7 bDescriptorType 5 bEndpointAddress 0x81 EP 1 IN bmAttributes 2 Transfer Type Bulk Synch Type None Usage Type Data wMaxPacketSize 0x0200 1x 512 bytes bInterval 0 Device Qualifier (for other device speed): bLength 10 bDescriptorType 6 bcdUSB 2.00 bDeviceClass 0 (Defined at Interface level) bDeviceSubClass 0 bDeviceProtocol 0 bMaxPacketSize0 64 bNumConfigurations 1 Device Status: 0x0001 Self Powered Update: Results using Firewire to connect. Today I recieved a 1394b 9 pin to 1394a 6 pin cable which allowed me to connect the "EZQuest Pro" via Firewire. Everything works. When I use Firewire I can connect whether I'm using Windows 7 or Ubuntu 10.04. I even tried booting my Gigabyte desktop as an OS X 10.6.3 Hackintosh and it worked there as well. (Though if I recall correctly, it also worked when using USB 2.0 and booting OS X on the desktop. Certainly it works with USB 2.0 and my MacBook.) I believe the firmware on the device is at the latest level available, v1.07. I base this on the excerpt below from the OS X System Profiler which shows Firmware Revision: 0x107. Bottom line: It's nice that the enclosure is actually usable when I connect with Firewire. But I am still searching for an answer as to why it does not work correctly when using USB 2.0 in Windows 7 (and Ubuntu ... but really Windows 7 is my biggest concern). OXFORD IDE Device 1: Manufacturer: EZ QUEST Model: 0x0 GUID: 0x1D202E0220417 Maximum Speed: Up to 800 Mb/sec Connection Speed: Up to 400 Mb/sec Sub-units: OXFORD IDE Device 1 Unit: Unit Software Version: 0x10483 Unit Spec ID: 0x609E Firmware Revision: 0x107 Product Revision Level: ST6O Sub-units: OXFORD IDE Device 1 SBP-LUN: Capacity: 1 TB (1,000,204,886,016 bytes) Removable Media: Yes BSD Name: disk3 Partition Map Type: MBR (Master Boot Record) S.M.A.R.T. status: Not Supported

    Read the article

  • IIS Strategies for Accessing Secured Network Resources

    - by Emtucifor
    Problem: A user connects to a service on a machine, such as an IIS web site or a SQL Server database. The site or the database need to gain access to network resources such as file shares (the most common) or a database on a different server. Permission is denied. This is because the user the service is running as doesn't have network permissions in the first place, or if it does, it doesn't have rights to access the remote resource. I keep running into this problem over and over again and am tired of not having a really solid way of handling it. Here are some workarounds I'm aware of: Run IIS as a custom-created domain user who is granted high permissions If permissions are granted one file share at a time, then every time I want to read from a new share, I would have to ask a network admin to add it for me. Eventually, with many web sites reading from many shares, it is going to get really complicated. If permissions are just opened up wide for the user to access any file shares in our domain, then this seems like an unnecessary security surface area to present. This also applies to all the sites running on IIS, rather than just the selected site or virtual directory that needs the access, a further surface area problem. Still use the IUSR account but give it network permissions and set up the same user name on the remote resource (not a domain user, a local user) This also has its problems. For example, there's a file share I am using that I have full rights to for sharing, but I can't log in to the machine. So I have to find the right admin and ask him to do it for me. Any time something has to change, it's another request to an admin. Allow IIS users to connect as anonymous, but set the account used for anonymous access to a high-privilege one This is even worse than giving the IIS IUSR full privileges, because it means my web site can't use any kind of security in the first place. Connect using Kerberos, then delegate This sounds good in principle but has all sorts of problems. First of all, if you're using virtual web sites where the domain name you connect to the site with is not the base machine name (as we do frequently), then you have to set up a Service Principal Name on the webserver using Microsoft's SetSPN utility. It's complicated and apparently prone to errors. Also, you have to ask your network/domain admin to change security policy for the web server so it is "trusted for delegation." If you don't get everything perfectly right, suddenly your intended Kerberos authentication is NTLM instead, and you can only impersonate rather than delegate, and thus no reaching out over the network as the user. Also, this method can be problematic because sometimes you need the web site or database to have permissions that the connecting user doesn't have. Create a service or COM+ application that fetches the resource for the web site Services and COM+ packages are run with their own set of credentials. Running as a high-privilege user is okay since they can do their own security and deny requests that are not legitimate, putting control in the hands of the application developer instead of the network admin. Problems: I am using a COM+ package that does exactly this on Windows Server 2000 to deliver highly sensitive images to a secured web application. I tried moving the web site to Windows Server 2003 and was suddenly denied permission to instantiate the COM+ object, very likely registry permissions. I trolled around quite a bit and did not solve the problem, partly because I was reluctant to give the IUSR account full registry permissions. That seems like the same bad practice as just running IIS as a high-privilege user. Note: This is actually really simple. In a programming language of your choice, you create a class with a function that returns an instance of the object you want (an ADODB.Connection, for example), and build a dll, which you register as a COM+ object. In your web server-side code, you create an instance of the class and use the function, and since it is running under a different security context, calls to network resources work. Map drive letters to shares This could theoretically work, but in my mind it's not really a good long-term strategy. Even though mappings can be created with specific credentials, and this can be done by others than a network admin, this also is going to mean that there are either way too many shared drives (small granularity) or too much permission is granted to entire file servers (large granularity). Also, I haven't figured out how to map a drive so that the IUSR gets the drives. Mapping a drive is for the current user, I don't know the IUSR account password to log in as it and create the mappings. Move the resources local to the web server/database There are times when I've done this, especially with Access databases. Does the database have to live out on the file share? Sometimes, it was just easiest to move the database to the web server or to the SQL database server (so the linked server to it would work). But I don't think this is a great all-around solution, either. And it won't work when the resource is a service rather than a file. Move the service to the final web server/database I suppose I could run a web server on my SQL Server database, so the web site can connect to it using impersonation and make me happy. But do we really want random extra web servers on our database servers just so this is possible? No. Virtual directories in IIS I know that virtual directories can help make remote resources look as though they are local, and this supports using custom credentials for each virtual directory. I haven't been able to come up with, yet, how this would solve the problem for system calls. Users could reach file shares directly, but this won't help, say, classic ASP code access resources. I could use a URL instead of a file path to read remote data files in a web page, but this isn't going to help me make a connection to an Access database, a SQL server database, or any other resource that uses a connection library rather than being able to just read all the bytes and work with them. I wish there was some kind of "service tunnel" that I could create. Think about how a VPN makes remote resources look like they are local. With a richer aliasing mechanism, perhaps code-based, why couldn't even database connections occur under a defined security context? Why not a special Windows component that lets you specify, per user, what resources are available and what alternate credentials are used for the connection? File shares, databases, web sites, you name it. I guess I'm almost talking about a specialized local proxy server. Anyway, so there's my list. I may update it if I think of more. Does anyone have any ideas for me? My current problem today is, yet again, I need a web site to connect to an Access database on a file share. Here we go again...

    Read the article

  • How to get full control of umask/PAM/permissions?

    - by plua
    OUR SITUATION Several people from our company log in to a server and upload files. They all need to be able to upload and overwrite the same files. They have different usernames, but are all part of the same group. However, this is an internet server, so the "other" users should have (in general) just read-only access. So what I want to have is these standard permissions: files: 664 directories: 771 My goal is that all users do not need to worry about permissions. The server should be configured in such a way that these permissions apply to all files and directories, newly created, copied, or over-written. Only when we need some special permissions we'd manually change this. We upload files to the server by SFTP-ing in Nautilus, by mounting the server using sshfs and accessing it in Nautilus as if it were a local folder, and by SCP-ing in the command line. That basically covers our situation and what we aim to do. Now, I have read many things about the beautiful umask functionality. From what I understand umask (together with PAM) should allow me to do exactly what I want: set standard permissions for new files and directories. However, after many many hours of reading and trial-and-error, I still do not get this to work. I get many unexpected results. I really like to get a solid grasp of umask and have many question unanswered. I will post these questions below, together with my findings and an explanation of my trials that led to these questions. Given that many things appear to go wrong, I think that I am doing several things wrong. So therefore, there are many questions. NOTE: I am using Ubuntu 9.10 and therefore can not change the sshd_config to set the umask for the SFTP server. Installed SSH OpenSSH_5.1p1 Debian-6ubuntu2 < required OpenSSH 5.4p1. So here go the questions. 1. DO I NEED TO RESTART FOR PAM CHANGS TO TAKE EFFECT? Let's start with this. There were so many files involved and I was unable to figure out what does and what does not affect things, also because I did not know whether or not I have to restart the whole system for PAM changes to take effect. I did do so after not seeing the expected results, but is this really necessary? Or can I just log out from the server and log back in, and should new PAM policies be effective? Or is there some 'PAM' program to reload? 2. IS THERE ONE SINGLE FILE TO CHANGE THAT AFFECTS ALL USERS FOR ALL SESSIONS? So I ended up changing MANY files, as I read MANY different things. I ended up setting the umask in the following files: ~/.profile -> umask=0002 ~/.bashrc -> umask=0002 /etc/profile -> umask=0002 /etc/pam.d/common-session -> umask=0002 /etc/pam.d/sshd -> umask=0002 /etc/pam.d/login -> umask=0002 I want this change to apply to all users, so some sort of system-wide change would be best. Can it be achieved? 3. AFTER ALL, THIS UMASK THING, DOES IT WORK? So after changing umask to 0002 at every possible place, I run tests. ------------SCP----------- TEST 1: scp testfile (which has 777 permissions for testing purposes) server:/home/ testfile 100% 4 0.0KB/s 00:00 Let's check permissions: user@server:/home$ ls -l total 4 -rwx--x--x 1 user uploaders 4 2011-02-05 17:59 testfile (711) ---------SSH------------ TEST 2: ssh server user@server:/home$ touch anotherfile user@server:/home$ ls -l total 4 -rw-rw-r-- 1 user uploaders 0 2011-02-05 18:03 anotherfile (664) --------SFTP----------- Nautilus: sftp://server/home/ Copy and paste newfile from client to server (777 on client) TEST 3: user@server:/home$ ls -l total 4 -rwxrwxrwx 1 user uploaders 3 2011-02-05 18:05 newfile (777) Create a new file through Nautilus. Check file permissions in terminal: TEST 4: user@server:/home$ ls -l total 4 -rw------- 1 user uploaders 0 2011-02-05 18:06 newfile (600) I mean... WHAT just happened here?! We should get 644 every single time. Instead I get 711, 777, 600, and then once 644. And the 644 is only achieved when creating a new, blank file through SSH, which is the least probable scenario. So I am asking, does umask/pam work after all? 4. SO WHAT DOES IT MEAN TO UMASK SSHFS? Sometimes we mount a server locally, using sshfs. Very useful. But again, we have permissions issues. Here is how we mount: sshfs -o idmap=user -o umask=0113 user@server:/home/ /mnt NOTE: we use umask = 113 because apparently, sshfs starts from 777 instead of 666, so with 113 we get 664 which is the desired file permission. But what now happens is that we see all files and directories as if they are 664. We browse in Nautilus to /mnt and: Right click - New File (newfile) --- TEST 5 Right click - New Folder (newfolder) --- TEST 6 Copy and paste a 777 file from our local client --- TEST 7 So let's check on the command line: user@client:/mnt$ ls -l total 8 -rw-rw-r-- 1 user 1007 3 Feb 5 18:05 copyfile (664) -rw-rw-r-- 1 user 1007 0 Feb 5 18:15 newfile (664) drw-rw-r-- 1 user 1007 4096 Feb 5 18:15 newfolder (664) But hey, let's check this same folder on the server-side: user@server:/home$ ls -l total 8 -rwxrwxrwx 1 user uploaders 3 2011-02-05 18:05 copyfile (777) -rw------- 1 user uploaders 0 2011-02-05 18:15 newfile (600) drwx--x--x 2 user uploaders 4096 2011-02-05 18:15 newfolder (711) What?! The REAL file permissions are very different from what we see in Nautilus. So does this umask on sshfs just create a 'filter' that shows unreal file permissions? And I tried to open a file from another user but the same group that had real 600 permissions but 644 'fake' permissions, and I could still not read this, so what good is this filter?? 5. UMASK IS ALL ABOUT FILES. BUT WHAT ABOUT DIRECTORIES? From my tests I can see that the umask that is being applied also somehow influences the directory permissions. However, I want my files to be 664 (002) and my directories to be 771 (006). So is it possible to have a different umask for directories? 6. PERHAPS UMASK/PAM IS REALLY COOL, BUT UBUNTU IS JUST BUGGY? On the one hand, I have read topics of people that have had success with PAM/UMASK and Ubuntu. On the other hand, I have found many older and newer bugs regarding umask/PAM/fuse on Ubuntu: https://bugs.launchpad.net/ubuntu/+source/gdm/+bug/241198 https://bugs.launchpad.net/ubuntu/+source/fuse/+bug/239792 https://bugs.launchpad.net/ubuntu/+source/pam/+bug/253096 https://bugs.launchpad.net/ubuntu/+source/sudo/+bug/549172 http://bugs.debian.org/cgi-bin/bugreport.cgi?bug=314796 So I do not know what to believe anymore. Should I just give up? Would ACL solve all my problems? Or do I have again problems using Ubuntu? One word of caution with backups using tar. Red Hat /Centos distributions support acls in the tar program but Ubuntu does not support acls when backing up. This means that all acls will be lost when you create a backup. I am very willing to upgrade to Ubuntu 10.04 if that would solve my problems too, but first I want to understand what is happening.

    Read the article

  • Slow draw on some apps and dynamic clocks not working properly with ATI/AMD proprietary drivers

    - by Rakeka
    I've recently purchased a new computer (around July 2010) and I've been having some problems with proprietary video drivers on Linux. The hardware is: Video: ATI/AMD Radeon HD 5870 (XFX HD-587X-ZNFC); Motherboard: Asus P7P55D-E Deluxe; Processor: Intel i5 750; Memory: Kingston Hyperx KHX1600C8D3K2/4GX (2x - 8GB Total); Power Supply: XFX P1-750B-CAG9; There are no overclocks, not even the memories (they are at 1333mhz due processor memory controller limitation). The operational system is a homebrew Linux distribution with the following software: Architecture: x86_64 (multilib) Kernel: 2.6.35.10 Xorg: 7.5 Window Manager: wmii-3.9.2 Video Driver: ATI/AMD Catalyst 10.12 There are no desktop effects programs like compiz fusion or beryl. The problems: With ATI/AMD proprietary driver, some applications are with slow draw/redraw, and, the same applications make the driver to increase the card clocks to maximum (0% gpu activity, only the clocks are increased). I dunno exactly how to describe the slow draw but I'll list some applications and symptoms. xterm Flickers a lot when drawing continuous output; When I'm in a workspace with fullscreen xterm, The gpu load stays at 12% in idle, and, with smaller xterm, smaller GPU load. "aticonfig --odgc" output: Default Adapter - ATI Radeon HD 5800 Series Core (MHz) Memory (MHz) Current Clocks : 157 300 Current Peak : 850 1200 Configurable Peak Range : [600-900] [900-1300] GPU load : 12% "aticonfig --pplib-cmd 'get activity'" output: Current Activity is Core Clock: 157MHZ Memory Clock: 300MHZ VDDC: 950 Activity: 12 percent Performance Level: 0 Bus Speed: 5000 Bus Lanes: 16 Maximum Bus Lanes: 16 More examples: mplayer time info flickers on terminal; "find /" flickers a lot (It takes some time to stop with control-c. But, If I change the workspace or put some window upon it, just after the control-c, it stops instantly); "cat somefile" if the file is big (Xorg.0.log for example) it takes some time to display; vim and less (ex: find / | less) don't have much problems, just a little flicker when scrolling; mplayer (no gui) Slow reproduction and seek with -vo x11; Tearing with -vo xv; Time info flickers on terminal (xterm consequence); gvim A little slow draw when scrolling with page up/page down; Firefox Slow draw/redraw on some pages like www.boadica.com.br and sometimes on www.youtube.com with flash enable (never noticed on many pages); Corruptions when informative yellow boxes are showing and scroll the page (an gray box appears at the same place of the informative box); "Wallpaper" After minimizing a fullscreen window or changing to an empty workspace it takes some time to redraw wallpaper. "Video Card" The core and memory clocks are increased with the events described above and on other situations like change workspace (even without wallpaper), minimize, maximize or move a window; Idle clocks: Core: 157mhz, Memory: 300mhz Full clocks: Core: 850mhz, Memory: 1200mhz xpdf Painful slow scrolling; display (from ImageMagick) Slow menus and sometimes slow image redraw; Programs that I use and are apparently without problems: gimp; pidgin; mplayer (-vo gl, gl2); blender; unigine heaven (better fps than on Windows); doom3; tibia; penumbra overture; amnesia the dark descent (wine); diablo 2 (wine); No problems on Windows (Windows 7 Ultimate 64bit). And special note to this: Full desktop effects from Debian and Ubuntu gnome appearance cpanel don't cause ANY problems, even the core and memory clocks don't increase when change workspace, minimize, maximize or move a window. What I've tested: Unsuccessful tests: Tested all drivers versions since 10.6 (released approximately when I've installed the first slackware in this PC); Tested other video card - ATI/AMD Radeon HD 5570 (XFX HD-557X-ZHF2); Tested some options on xorg.conf and that I've found googling (some of these options are commented on my xorg.conf. I'll send the links at the end of post); Tested some patches like 107_fedora_dont_fill_bg_none.patch and xserver-xorg-backclear.patch from Arch Linux Catalyst page (https://wiki.archlinux.org/index.php/ATI_Catalyst); Tested other distros and software versions: Tested XORG-7.6 on my own distribution; Tested Debian Squeeze (testing - from 2010-12-20); Tested Ubuntu Marverick (10.10); Tested Slackware 13.1; Distros info: Architecture: i386 Debian and Ubuntu with all default software (kernel, gnome, xorg, drivers); Slackware with Catalyst from AMD page and default window managers like: fvwm, xfce, and my own build of wmii; Successful tests: Tested other video card (only on my homebrew distro) - NVIDIA Geforce 7300GS with driver 260.19.29; That didn't shown the slow draw problems, but that card is a bit obsolete, so, dunno if that lacks features like the dynamic clocks. I don't dispose of other video cards like nvidia g/gt/gts/gtx 200~400~500 or Radeon HD 3000/4000/6000 to make more tests. Tested other hardware: Video: ATI/AMD Radeon HD 5570 (XFX HD-557X-ZHF2); Motherboard: Intel DG31PR; Processor: Core 2 Duo E6750; Software for that hardware: Fresh install of same distros (except for the mine) with same program versions; That video card (HD 5570) were full time at the maximum clocks (something like 500/750, don't remember) in all the operational systems (Windows XP and Windows 7 too), but it didn't shown the same problems that I have here. I've googled a lot about common problems with ATI/AMD proprietary drivers for Linux and didn't find similar problems, except by the Firefox corruptions, that the solutions were to disable ATI Direct2DAccel and use XAA. With XAA the problems persists and the other applications like pidgin and rest of Firefox showed the same problems of slow draw/redraw. Open source Drivers: With open source drivers (xf86-video-ati-6.13.2) I hadn't the same slow draw problems, but, had other problems, that, for now, make it no viable solution. I'll not discuss it here because this is another line of problems and will confuse everything. If it happens to be the only solution, I'll make another thread to discuss it. Logs and Configs: kernel .config dmesg xorg package list xorg.conf Xorg.0.log

    Read the article

  • Make errors when compiling HPL-2.1 on MOSIX-clustered Debian server

    - by tlake
    I'm trying to compile HPL 2.1 on a MOSIX-clustered Debian server, but the make process terminates with errors as seen below. Included are my makefile and two versions of output: one from a standard execution, and one from an execution run with the debug flag. Any help and guidance would be very much appreciated! The makefile: # ---------------------------------------------------------------------- # - shell -------------------------------------------------------------- # ---------------------------------------------------------------------- # SHELL = /bin/bash # CD = cd CP = cp LN_S = ln -s MKDIR = mkdir RM = /bin/rm -f TOUCH = touch # # ---------------------------------------------------------------------- # - Platform identifier ------------------------------------------------ # ---------------------------------------------------------------------- # ARCH = Linux_PII_CBLAS # # ---------------------------------------------------------------------- # - HPL Directory Structure / HPL library ------------------------------ # ---------------------------------------------------------------------- # TOPdir = $(HOME)/hpl-2.1 INCdir = $(TOPdir)/include BINdir = $(TOPdir)/bin/$(ARCH) LIBdir = $(TOPdir)/lib/$(ARCH) # HPLlib = $(LIBdir)/libhpl.a # # ---------------------------------------------------------------------- # - Message Passing library (MPI) -------------------------------------- # ---------------------------------------------------------------------- # MPinc tells the C compiler where to find the Message Passing library # header files, MPlib is defined to be the name of the library to be # used. The variable MPdir is only used for defining MPinc and MPlib. # MPdir = /usr/local MPinc = -I$(MPdir)/include MPlib = $(MPdir)/lib/libmpi.so # # ---------------------------------------------------------------------- # - Linear Algebra library (BLAS or VSIPL) ----------------------------- # ---------------------------------------------------------------------- # LAinc tells the C compiler where to find the Linear Algebra library # header files, LAlib is defined to be the name of the library to be # used. The variable LAdir is only used for defining LAinc and LAlib. # LAdir = $(HOME)/CBLAS/lib LAinc = LAlib = $(LAdir)/cblas_LINUX.a # # ---------------------------------------------------------------------- # - F77 / C interface -------------------------------------------------- # ---------------------------------------------------------------------- # You can skip this section if and only if you are not planning to use # a BLAS library featuring a Fortran 77 interface. Otherwise, it is # necessary to fill out the F2CDEFS variable with the appropriate # options. **One and only one** option should be chosen in **each** of # the 3 following categories: # # 1) name space (How C calls a Fortran 77 routine) # # -DAdd_ : all lower case and a suffixed underscore (Suns, # Intel, ...), [default] # -DNoChange : all lower case (IBM RS6000), # -DUpCase : all upper case (Cray), # -DAdd__ : the FORTRAN compiler in use is f2c. # # 2) C and Fortran 77 integer mapping # # -DF77_INTEGER=int : Fortran 77 INTEGER is a C int, [default] # -DF77_INTEGER=long : Fortran 77 INTEGER is a C long, # -DF77_INTEGER=short : Fortran 77 INTEGER is a C short. # # 3) Fortran 77 string handling # # -DStringSunStyle : The string address is passed at the string loca- # tion on the stack, and the string length is then # passed as an F77_INTEGER after all explicit # stack arguments, [default] # -DStringStructPtr : The address of a structure is passed by a # Fortran 77 string, and the structure is of the # form: struct {char *cp; F77_INTEGER len;}, # -DStringStructVal : A structure is passed by value for each Fortran # 77 string, and the structure is of the form: # struct {char *cp; F77_INTEGER len;}, # -DStringCrayStyle : Special option for Cray machines, which uses # Cray fcd (fortran character descriptor) for # interoperation. # F2CDEFS = # # ---------------------------------------------------------------------- # - HPL includes / libraries / specifics ------------------------------- # ---------------------------------------------------------------------- # HPL_INCLUDES = -I$(INCdir) -I$(INCdir)/$(ARCH) $(LAinc) $(MPinc) HPL_LIBS = $(HPLlib) $(LAlib) $(MPlib) # # - Compile time options ----------------------------------------------- # # -DHPL_COPY_L force the copy of the panel L before bcast; # -DHPL_CALL_CBLAS call the cblas interface; # -DHPL_CALL_VSIPL call the vsip library; # -DHPL_DETAILED_TIMING enable detailed timers; # # By default HPL will: # *) not copy L before broadcast, # *) call the BLAS Fortran 77 interface, # *) not display detailed timing information. # HPL_OPTS = -DHPL_CALL_CBLAS # # ---------------------------------------------------------------------- # HPL_DEFS = $(F2CDEFS) $(HPL_OPTS) $(HPL_INCLUDES) # # ---------------------------------------------------------------------- # - Compilers / linkers - Optimization flags --------------------------- # ---------------------------------------------------------------------- # CC = /usr/bin/gcc CCNOOPT = $(HPL_DEFS) CCFLAGS = $(HPL_DEFS) -fomit-frame-pointer -O3 -funroll-loops # # On some platforms, it is necessary to use the Fortran linker to find # the Fortran internals used in the BLAS library. # LINKER = ~/BLAS LINKFLAGS = $(CCFLAGS) # ARCHIVER = ar ARFLAGS = r RANLIB = echo # # ---------------------------------------------------------------------- Make output: ~/BLAS -DHPL_CALL_CBLAS -I/homes/laket/hpl-2.1/include -I/homes/laket/hpl-2.1/include/Linux_PII_CBLAS -I/usr/local/include -fomit-frame-pointer -O3 -funroll-loops -o /homes/laket/hpl-2.1/bin/Linux_PII_CBLAS/xhpl HPL_pddriver.o HPL_pdinfo.o HPL_pdtest.o /homes/laket/hpl-2.1/lib/Linux_PII_CBLAS/libhpl.a /homes/laket/CBLAS/lib/cblas_LINUX.a /usr/local/lib/libmpi.so /bin/bash: /homes/laket/BLAS: Is a directory make[2]: *** [dexe.grd] Error 126 make[2]: Target `all' not remade because of errors. make[2]: Leaving directory `/homes/laket/hpl-2.1/testing/ptest/Linux_PII_CBLAS' make[1]: *** [build_tst] Error 2 make[1]: Leaving directory `/homes/laket/hpl-2.1' make: *** [build] Error 2 make: Target `all' not remade because of errors. Make -d output: Considering target file `/homes/laket/hpl-2.1/lib/Linux_PII_CBLAS/libhpl.a'. Looking for an implicit rule for `/homes/laket/hpl-2.1/lib/Linux_PII_CBLAS/libhpl.a'. Trying pattern rule with stem `libhpl.a'. Trying implicit prerequisite `/homes/laket/hpl-2.1/lib/Linux_PII_CBLAS/libhpl.a,v'. Trying pattern rule with stem `libhpl.a'. Trying implicit prerequisite `/homes/laket/hpl-2.1/lib/Linux_PII_CBLAS/RCS/libhpl.a,v'. Trying pattern rule with stem `libhpl.a'. Trying implicit prerequisite `/homes/laket/hpl-2.1/lib/Linux_PII_CBLAS/RCS/libhpl.a'. Trying pattern rule with stem `libhpl.a'. Trying implicit prerequisite `/homes/laket/hpl-2.1/lib/Linux_PII_CBLAS/s.libhpl.a'. Trying pattern rule with stem `libhpl.a'. Trying implicit prerequisite `/homes/laket/hpl-2.1/lib/Linux_PII_CBLAS/SCCS/s.libhpl.a'. No implicit rule found for `/homes/laket/hpl-2.1/lib/Linux_PII_CBLAS/libhpl.a'. Finished prerequisites of target file `/homes/laket/hpl-2.1/lib/Linux_PII_CBLAS/libhpl.a'. No need to remake target `/homes/laket/hpl-2.1/lib/Linux_PII_CBLAS/libhpl.a'. Finished prerequisites of target file `dexe.grd'. Must remake target `dexe.grd'. ~/BLAS -DHPL_CALL_CBLAS -I/homes/laket/hpl-2.1/include -I/homes/laket/hpl-2.1/include/Linux_PII_CBLAS -I/usr/local/include -fomit-frame-pointer -O3 -funroll-loops -o /homes/laket/hpl-2.1/bin/Linux_PII_CBLAS/xhpl HPL_pddriver.o HPL_pdinfo.o HPL_pdtest.o /homes/laket/hpl-2.1/lib/Linux_PII_CBLAS/libhpl.a /homes/laket/CBLAS/lib/cblas_LINUX.a /usr/local/lib/libmpi.so Putting child 0x0129a2c0 (dexe.grd) PID 24853 on the chain. Live child 0x0129a2c0 (dexe.grd) PID 24853 /bin/bash: /homes/laket/BLAS: Is a directory make[2]: Reaping losing child 0x0129a2c0 PID 24853 *** [dexe.grd] Error 126 Removing child 0x0129a2c0 PID 24853 from chain. Failed to remake target file `dexe.grd'. Finished prerequisites of target file `dexe'. Giving up on target file `dexe'. Finished prerequisites of target file `all'. Giving up on target file `all'. make[2]: Target `all' not remade because of errors. make[2]: Leaving directory `/homes/laket/hpl-2.1/testing/ptest/Linux_PII_CBLAS' Reaping losing child 0x010ce900 PID 24841 make[1]: *** [build_tst] Error 2 Removing child 0x010ce900 PID 24841 from chain. Failed to remake target file `build_tst'. make[1]: Leaving directory `/homes/laket/hpl-2.1' Reaping losing child 0x00d91ae0 PID 24774 make: *** [build] Error 2 Removing child 0x00d91ae0 PID 24774 from chain. Failed to remake target file `build'. Finished prerequisites of target file `install'. make: Target `all' not remade because of errors. Giving up on target file `install'. Finished prerequisites of target file `all'. Giving up on target file `all'. Thanks!

    Read the article

  • Why is Java EE 6 better than Spring ?

    - by arungupta
    Java EE 6 was released over 2 years ago and now there are 14 compliant application servers. In all my talks around the world, a question that is frequently asked is Why should I use Java EE 6 instead of Spring ? There are already several blogs covering that topic: Java EE wins over Spring by Bill Burke Why will I use Java EE instead of Spring in new Enterprise Java projects in 2012 ? by Kai Waehner (more discussion on TSS) Spring to Java EE migration (Part 1 and 2, 3 and 4 coming as well) by David Heffelfinger Spring to Java EE - A Migration Experience by Lincoln Baxter Migrating Spring to Java EE 6 by Bert Ertman and Paul Bakker at NLJUG Moving from Spring to Java EE 6 - The Age of Frameworks is Over at TSS Java EE vs Spring Shootout by Rohit Kelapure and Reza Rehman at JavaOne 2011 Java EE 6 and the Ewoks by Murat Yener Definite excuse to avoid Spring forever - Bert Ertman and Arun Gupta I will try to share my perspective in this blog. First of all, I'd like to start with a note: Thank you Spring framework for filling the interim gap and providing functionality that is now included in the mainstream Java EE 6 application servers. The Java EE platform has evolved over the years learning from frameworks like Spring and provides all the functionality to build an enterprise application. Thank you very much Spring framework! While Spring was revolutionary in its time and is still very popular and quite main stream in the same way Struts was circa 2003, it really is last generation's framework - some people are even calling it legacy. However my theory is "code is king". So my approach is to build/take a simple Hello World CRUD application in Java EE 6 and Spring and compare the deployable artifacts. I started looking at the official tutorial Developing a Spring Framework MVC Application Step-by-Step but it is using the older version 2.5. I wasn't able to find any updated version in the current 3.1 release. Next, I downloaded Spring Tool Suite and thought that would provide some template samples to get started. A least a quick search did not show any handy tutorials - either video or text-based. So I searched and found a link to their SVN repository at src.springframework.org/svn/spring-samples/. I tried the "mvc-basic" sample and the generated WAR file was 4.43 MB. While it was named a "basic" sample it seemed to come with 19 different libraries bundled but it was what I could find: ./WEB-INF/lib/aopalliance-1.0.jar./WEB-INF/lib/hibernate-validator-4.1.0.Final.jar./WEB-INF/lib/jcl-over-slf4j-1.6.1.jar./WEB-INF/lib/joda-time-1.6.2.jar./WEB-INF/lib/joda-time-jsptags-1.0.2.jar./WEB-INF/lib/jstl-1.2.jar./WEB-INF/lib/log4j-1.2.16.jar./WEB-INF/lib/slf4j-api-1.6.1.jar./WEB-INF/lib/slf4j-log4j12-1.6.1.jar./WEB-INF/lib/spring-aop-3.0.5.RELEASE.jar./WEB-INF/lib/spring-asm-3.0.5.RELEASE.jar./WEB-INF/lib/spring-beans-3.0.5.RELEASE.jar./WEB-INF/lib/spring-context-3.0.5.RELEASE.jar./WEB-INF/lib/spring-context-support-3.0.5.RELEASE.jar./WEB-INF/lib/spring-core-3.0.5.RELEASE.jar./WEB-INF/lib/spring-expression-3.0.5.RELEASE.jar./WEB-INF/lib/spring-web-3.0.5.RELEASE.jar./WEB-INF/lib/spring-webmvc-3.0.5.RELEASE.jar./WEB-INF/lib/validation-api-1.0.0.GA.jar And it is not even using any database! The app deployed fine on GlassFish 3.1.2 but the "@Controller Example" link did not work as it was missing the context root. With a bit of tweaking I could deploy the application and assume that the account got created because no error was displayed in the browser or server log. Next I generated the WAR for "mvc-ajax" and the 5.1 MB WAR had 20 JARs (1 removed, 2 added): ./WEB-INF/lib/aopalliance-1.0.jar./WEB-INF/lib/hibernate-validator-4.1.0.Final.jar./WEB-INF/lib/jackson-core-asl-1.6.4.jar./WEB-INF/lib/jackson-mapper-asl-1.6.4.jar./WEB-INF/lib/jcl-over-slf4j-1.6.1.jar./WEB-INF/lib/joda-time-1.6.2.jar./WEB-INF/lib/jstl-1.2.jar./WEB-INF/lib/log4j-1.2.16.jar./WEB-INF/lib/slf4j-api-1.6.1.jar./WEB-INF/lib/slf4j-log4j12-1.6.1.jar./WEB-INF/lib/spring-aop-3.0.5.RELEASE.jar./WEB-INF/lib/spring-asm-3.0.5.RELEASE.jar./WEB-INF/lib/spring-beans-3.0.5.RELEASE.jar./WEB-INF/lib/spring-context-3.0.5.RELEASE.jar./WEB-INF/lib/spring-context-support-3.0.5.RELEASE.jar./WEB-INF/lib/spring-core-3.0.5.RELEASE.jar./WEB-INF/lib/spring-expression-3.0.5.RELEASE.jar./WEB-INF/lib/spring-web-3.0.5.RELEASE.jar./WEB-INF/lib/spring-webmvc-3.0.5.RELEASE.jar./WEB-INF/lib/validation-api-1.0.0.GA.jar 2 more JARs for just doing Ajax. Anyway, deploying this application gave the following error: Caused by: java.lang.NoSuchMethodError: org.codehaus.jackson.map.SerializationConfig.<init>(Lorg/codehaus/jackson/map/ClassIntrospector;Lorg/codehaus/jackson/map/AnnotationIntrospector;Lorg/codehaus/jackson/map/introspect/VisibilityChecker;Lorg/codehaus/jackson/map/jsontype/SubtypeResolver;)V    at org.springframework.samples.mvc.ajax.json.ConversionServiceAwareObjectMapper.<init>(ConversionServiceAwareObjectMapper.java:20)    at org.springframework.samples.mvc.ajax.json.JacksonConversionServiceConfigurer.postProcessAfterInitialization(JacksonConversionServiceConfigurer.java:40)    at org.springframework.beans.factory.support.AbstractAutowireCapableBeanFactory.applyBeanPostProcessorsAfterInitialization(AbstractAutowireCapableBeanFactory.java:407) Seems like some incorrect repos in the "pom.xml". Next one is "mvc-showcase" and the 6.49 MB WAR now has 28 JARs as shown below: ./WEB-INF/lib/aopalliance-1.0.jar./WEB-INF/lib/aspectjrt-1.6.10.jar./WEB-INF/lib/commons-fileupload-1.2.2.jar./WEB-INF/lib/commons-io-2.0.1.jar./WEB-INF/lib/el-api-2.2.jar./WEB-INF/lib/hibernate-validator-4.1.0.Final.jar./WEB-INF/lib/jackson-core-asl-1.8.1.jar./WEB-INF/lib/jackson-mapper-asl-1.8.1.jar./WEB-INF/lib/javax.inject-1.jar./WEB-INF/lib/jcl-over-slf4j-1.6.1.jar./WEB-INF/lib/jdom-1.0.jar./WEB-INF/lib/joda-time-1.6.2.jar./WEB-INF/lib/jstl-api-1.2.jar./WEB-INF/lib/jstl-impl-1.2.jar./WEB-INF/lib/log4j-1.2.16.jar./WEB-INF/lib/rome-1.0.0.jar./WEB-INF/lib/slf4j-api-1.6.1.jar./WEB-INF/lib/slf4j-log4j12-1.6.1.jar./WEB-INF/lib/spring-aop-3.1.0.RELEASE.jar./WEB-INF/lib/spring-asm-3.1.0.RELEASE.jar./WEB-INF/lib/spring-beans-3.1.0.RELEASE.jar./WEB-INF/lib/spring-context-3.1.0.RELEASE.jar./WEB-INF/lib/spring-context-support-3.1.0.RELEASE.jar./WEB-INF/lib/spring-core-3.1.0.RELEASE.jar./WEB-INF/lib/spring-expression-3.1.0.RELEASE.jar./WEB-INF/lib/spring-web-3.1.0.RELEASE.jar./WEB-INF/lib/spring-webmvc-3.1.0.RELEASE.jar./WEB-INF/lib/validation-api-1.0.0.GA.jar The app at least deployed and showed results this time. But still no database! Next I tried building "jpetstore" and got the error: [ERROR] Failed to execute goal on project org.springframework.samples.jpetstore:Could not resolve dependencies for project org.springframework.samples:org.springframework.samples.jpetstore:war:1.0.0-SNAPSHOT: Failed to collect dependencies for [commons-fileupload:commons-fileupload:jar:1.2.1 (compile), org.apache.struts:com.springsource.org.apache.struts:jar:1.2.9 (compile), javax.xml.rpc:com.springsource.javax.xml.rpc:jar:1.1.0 (compile), org.apache.commons:com.springsource.org.apache.commons.dbcp:jar:1.2.2.osgi (compile), commons-io:commons-io:jar:1.3.2 (compile), hsqldb:hsqldb:jar:1.8.0.7 (compile), org.apache.tiles:tiles-core:jar:2.2.0 (compile), org.apache.tiles:tiles-jsp:jar:2.2.0 (compile), org.tuckey:urlrewritefilter:jar:3.1.0 (compile), org.springframework:spring-webmvc:jar:3.0.0.BUILD-SNAPSHOT (compile), org.springframework:spring-orm:jar:3.0.0.BUILD-SNAPSHOT (compile), org.springframework:spring-context-support:jar:3.0.0.BUILD-SNAPSHOT (compile), org.springframework.webflow:spring-js:jar:2.0.7.RELEASE (compile), org.apache.ibatis:com.springsource.com.ibatis:jar:2.3.4.726 (runtime), com.caucho:com.springsource.com.caucho:jar:3.2.1 (compile), org.apache.axis:com.springsource.org.apache.axis:jar:1.4.0 (compile), javax.wsdl:com.springsource.javax.wsdl:jar:1.6.1 (compile), javax.servlet:jstl:jar:1.2 (runtime), org.aspectj:aspectjweaver:jar:1.6.5 (compile), javax.servlet:servlet-api:jar:2.5 (provided), javax.servlet.jsp:jsp-api:jar:2.1 (provided), junit:junit:jar:4.6 (test)]: Failed to read artifact descriptor for org.springframework:spring-webmvc:jar:3.0.0.BUILD-SNAPSHOT: Could not transfer artifact org.springframework:spring-webmvc:pom:3.0.0.BUILD-SNAPSHOT from/to JBoss repository (http://repository.jboss.com/maven2): Access denied to: http://repository.jboss.com/maven2/org/springframework/spring-webmvc/3.0.0.BUILD-SNAPSHOT/spring-webmvc-3.0.0.BUILD-SNAPSHOT.pom It appears the sample is broken - maybe I was pulling from the wrong repository - would be great if someone were to point me at a good target to use here. With a 50% hit on samples in this repository, I started searching through numerous blogs, most of which have either outdated information (using XML-heavy Spring 2.5), some piece of configuration (which is a typical "feature" of Spring) is missing, or too much complexity in the sample. I finally found this blog that worked like a charm. This blog creates a trivial Spring MVC 3 application using Hibernate and MySQL. This application performs CRUD operations on a single table in a database using typical Spring technologies.  I downloaded the sample code from the blog, deployed it on GlassFish 3.1.2 and could CRUD the "person" entity. The source code for this application can be downloaded here. More details on the application statistics below. And then I built a similar CRUD application in Java EE 6 using NetBeans wizards in a couple of minutes. The source code for the application can be downloaded here and the WAR here. The Spring Source Tool Suite may also offer similar wizard-driven capabilities but this blog focus primarily on comparing the runtimes. The lack of STS tutorials was slightly disappointing as well. NetBeans however has tons of text-based and video tutorials and tons of material even by the community. One more bit on the download size of tools bundle ... NetBeans 7.1.1 "All" is 211 MB (which includes GlassFish and Tomcat) Spring Tool Suite  2.9.0 is 347 MB (~ 65% bigger) This blog is not about the tooling comparison so back to the Java EE 6 version of the application .... In order to run the Java EE version on GlassFish, copy the MySQL Connector/J to glassfish3/glassfish/domains/domain1/lib/ext directory and create a JDBC connection pool and JDBC resource as: ./bin/asadmin create-jdbc-connection-pool --datasourceclassname \\ com.mysql.jdbc.jdbc2.optional.MysqlDataSource --restype \\ javax.sql.DataSource --property \\ portNumber=3306:user=mysql:password=mysql:databaseName=mydatabase \\ myConnectionPool ./bin/asadmin create-jdbc-resource --connectionpoolid myConnectionPool jdbc/myDataSource I generated WARs for the two projects and the table below highlights some differences between them: Java EE 6 Spring WAR File Size 0.021030 MB 10.87 MB (~516x) Number of files 20 53 (> 2.5x) Bundled libraries 0 36 Total size of libraries 0 12.1 MB XML files 3 5 LoC in XML files 50 (11 + 15 + 24) 129 (27 + 46 + 16 + 11 + 19) (~ 2.5x) Total .properties files 1 Bundle.properties 2 spring.properties, log4j.properties Cold Deploy 5,339 ms 11,724 ms Second Deploy 481 ms 6,261 ms Third Deploy 528 ms 5,484 ms Fourth Deploy 484 ms 5,576 ms Runtime memory ~73 MB ~101 MB Some points worth highlighting from the table ... 516x WAR file, 10x deployment time - With 12.1 MB of libraries (for a very basic application) bundled in your application, the WAR file size and the deployment time will naturally go higher. The WAR file for Spring-based application is 516x bigger and the deployment time is double during the first deployment and ~ 10x during subsequent deployments. The Java EE 6 application is fully portable and will run on any Java EE 6 compliant application server. 36 libraries in the WAR - There are 14 Java EE 6 compliant application servers today. Each of those servers provide all the functionality like transactions, dependency injection, security, persistence, etc typically required of an enterprise or web application. There is no need to bundle 36 libraries worth 12.1 MB for a trivial CRUD application. These 14 compliant application servers provide all the functionality baked in. Now you can also deploy these libraries in the container but then you don't get the "portability" offered by Spring in that case. Does your typical Spring deployment actually do that ? 3x LoC in XML - The number of XML files is about 1.6x and the LoC is ~ 2.5x. So much XML seems circa 2003 when the Java language had no annotations. The XML files can be further reduced, e.g. faces-config.xml can be replaced without providing i18n, but I just want to compare stock applications. Memory usage - Both the applications were deployed on default GlassFish 3.1.2 installation and any additional memory consumed as part of deployment/access was attributed to the application. This is by no means scientific but at least provides an initial ballpark. This area definitely needs more investigation. Another table that compares typical Java EE 6 compliant application servers and the custom-stack created for a Spring application ... Java EE 6 Spring Web Container ? 53 MB (tcServer 2.6.3 Developer Edition) Security ? 12 MB (Spring Security 3.1.0) Persistence ? 6.3 MB (Hibernate 4.1.0, required) Dependency Injection ? 5.3 MB (Framework) Web Services ? 796 KB (Spring WS 2.0.4) Messaging ? 3.4 MB (RabbitMQ Server 2.7.1) 936 KB (Java client 936) OSGi ? 1.3 MB (Spring OSGi 1.2.1) GlassFish and WebLogic (starting at 33 MB) 83.3 MB There are differentiating factors on both the stacks. But most of the functionality like security, persistence, and dependency injection is baked in a Java EE 6 compliant application server but needs to be individually managed and patched for a Spring application. This very quickly leads to a "stack explosion". The Java EE 6 servers are tested extensively on a variety of platforms in different combinations whereas a Spring application developer is responsible for testing with different JDKs, Operating Systems, Versions, Patches, etc. Oracle has both the leading OSS lightweight server with GlassFish and the leading enterprise Java server with WebLogic Server, both Java EE 6 and both with lightweight deployment options. The Web Container offered as part of a Java EE 6 application server not only deploys your enterprise Java applications but also provide operational management, diagnostics, and mission-critical capabilities required by your applications. The Java EE 6 platform also introduced the Web Profile which is a subset of the specifications from the entire platform. It is targeted at developers of modern web applications offering a reasonably complete stack, composed of standard APIs, and is capable out-of-the-box of addressing the needs of a large class of Web applications. As your applications grow, the stack can grow to the full Java EE 6 platform. The GlassFish Server Web Profile starting at 33MB (smaller than just the non-standard tcServer) provides most of the functionality typically required by a web application. WebLogic provides battle-tested functionality for a high throughput, low latency, and enterprise grade web application. No individual managing or patching, all tested and commercially supported for you! Note that VMWare does have a server, tcServer, but it is non-standard and not even certified to the level of the standard Web Profile most customers expect these days. Customers who choose this risk proprietary lock-in since VMWare does not seem to want to formally certify with either Java EE 6 Enterprise Platform or with Java EE 6 Web Profile but of course it would be great if they were to join the community and help their customers reduce the risk of deploying on VMWare software. Some more points to help you decide choose between Java EE 6 and Spring ... Freedom to choose container - There are 14 Java EE 6 compliant application servers today, with a variety of open source and commercial offerings. A Java EE 6 application can be deployed on any of those containers. So if you deployed your application on GlassFish today and would like to scale up with your demands then you can deploy the same application to WebLogic. And because of the portability of a Java EE 6 application, you can even take it a different vendor altogether. Spring requires a runtime which could be any of these app servers as well. But why use Spring when all the required functionality is already baked into the application server itself ? Spring also has a different definition of portability where they claim to bundle all the libraries in the WAR file and move to any application server. But we saw earlier how bloated that archive could be. The equivalent features in Spring runtime offerings (mainly tcServer) are not all open source, not as mature, and often require manual assembly.  Vendor choice - The Java EE 6 platform is created using the Java Community Process where all the big players like Oracle, IBM, RedHat, and Apache are conritbuting to make the platform successful. Each application server provides the basic Java EE 6 platform compliance and has its own competitive offerings. This allows you to choose an application server for deploying your Java EE 6 applications. If you are not happy with the support or feature of one vendor then you can move your application to a different vendor because of the portability promise offered by the platform. Spring is a set of products from a single company, one price book, one support organization, one sustaining organization, one sales organization, etc. If any of those cause a customer headache, where do you go ? Java EE, backed by multiple vendors, is a safer bet for those that are risk averse. Production support - With Spring, typically you need to get support from two vendors - VMWare and the container provider. With Java EE 6, all of this is typically provided by one vendor. For example, Oracle offers commercial support from systems, operating systems, JDK, application server, and applications on top of them. VMWare certainly offers complete production support but do you really want to put all your eggs in one basket ? Do you really use tcServer ? ;-) Maintainability - With Spring, you are likely building your own distribution with multiple JAR files, integrating, patching, versioning, etc of all those components. Spring's claim is that multiple JAR files allow you to go à la carte and pick the latest versions of different components. But who is responsible for testing whether all these versions work together ? Yep, you got it, its YOU! If something does not work, who patches and maintains the JARs ? Of course, you! Commercial support for such a configuration ? On your own! The Java EE application servers manage all of this for you and provide a well-tested and commercially supported bundle. While it is always good to realize that there is something new and improved that updates and replaces older frameworks like Spring, the good news is not only does a Java EE 6 container offer what is described here, most also will let you deploy and run your Spring applications on them while you go through an upgrade to a more modern architecture. End result, you get the best of both worlds - keeping your legacy investment but moving to a more agile, lightweight world of Java EE 6. A message to the Spring lovers ... The complexity in J2EE 1.2, 1.3, and 1.4 led to the genesis of Spring but that was in 2004. This is 2012 and the name has changed to "Java EE 6" :-) There are tons of improvements in the Java EE platform to make it easy-to-use and powerful. Some examples: Adding @Stateless on a POJO makes it an EJB EJBs can be packaged in a WAR with no special packaging or deployment descriptors "web.xml" and "faces-config.xml" are optional in most of the common cases Typesafe dependency injection is now part of the Java EE platform Add @Path on a POJO allows you to publish it as a RESTful resource EJBs can be used as backing beans for Facelets-driven JSF pages providing full MVC Java EE 6 WARs are known to be kilobytes in size and deployed in milliseconds Tons of other simplifications in the platform and application servers So if you moved away from J2EE to Spring many years ago and have not looked at Java EE 6 (which has been out since Dec 2009) then you should definitely try it out. Just be at least aware of what other alternatives are available instead of restricting yourself to one stack. Here are some workshops and screencasts worth trying: screencast #37 shows how to build an end-to-end application using NetBeans screencast #36 builds the same application using Eclipse javaee-lab-feb2012.pdf is a 3-4 hours self-paced hands-on workshop that guides you to build a comprehensive Java EE 6 application using NetBeans Each city generally has a "spring cleanup" program every year. It allows you to clean up the mess from your house. For your software projects, you don't need to wait for an annual event, just get started and reduce the technical debt now! Move away from your legacy Spring-based applications to a lighter and more modern approach of building enterprise Java applications using Java EE 6. Watch this beautiful presentation that explains how to migrate from Spring -> Java EE 6: List of files in the Java EE 6 project: ./index.xhtml./META-INF./person./person/Create.xhtml./person/Edit.xhtml./person/List.xhtml./person/View.xhtml./resources./resources/css./resources/css/jsfcrud.css./template.xhtml./WEB-INF./WEB-INF/classes./WEB-INF/classes/Bundle.properties./WEB-INF/classes/META-INF./WEB-INF/classes/META-INF/persistence.xml./WEB-INF/classes/org./WEB-INF/classes/org/javaee./WEB-INF/classes/org/javaee/javaeemysql./WEB-INF/classes/org/javaee/javaeemysql/AbstractFacade.class./WEB-INF/classes/org/javaee/javaeemysql/Person.class./WEB-INF/classes/org/javaee/javaeemysql/Person_.class./WEB-INF/classes/org/javaee/javaeemysql/PersonController$1.class./WEB-INF/classes/org/javaee/javaeemysql/PersonController$PersonControllerConverter.class./WEB-INF/classes/org/javaee/javaeemysql/PersonController.class./WEB-INF/classes/org/javaee/javaeemysql/PersonFacade.class./WEB-INF/classes/org/javaee/javaeemysql/util./WEB-INF/classes/org/javaee/javaeemysql/util/JsfUtil.class./WEB-INF/classes/org/javaee/javaeemysql/util/PaginationHelper.class./WEB-INF/faces-config.xml./WEB-INF/web.xml List of files in the Spring 3.x project: ./META-INF ./META-INF/MANIFEST.MF./WEB-INF./WEB-INF/applicationContext.xml./WEB-INF/classes./WEB-INF/classes/log4j.properties./WEB-INF/classes/org./WEB-INF/classes/org/krams ./WEB-INF/classes/org/krams/tutorial ./WEB-INF/classes/org/krams/tutorial/controller ./WEB-INF/classes/org/krams/tutorial/controller/MainController.class ./WEB-INF/classes/org/krams/tutorial/domain ./WEB-INF/classes/org/krams/tutorial/domain/Person.class ./WEB-INF/classes/org/krams/tutorial/service ./WEB-INF/classes/org/krams/tutorial/service/PersonService.class ./WEB-INF/hibernate-context.xml ./WEB-INF/hibernate.cfg.xml ./WEB-INF/jsp ./WEB-INF/jsp/addedpage.jsp ./WEB-INF/jsp/addpage.jsp ./WEB-INF/jsp/deletedpage.jsp ./WEB-INF/jsp/editedpage.jsp ./WEB-INF/jsp/editpage.jsp ./WEB-INF/jsp/personspage.jsp ./WEB-INF/lib ./WEB-INF/lib/antlr-2.7.6.jar ./WEB-INF/lib/aopalliance-1.0.jar ./WEB-INF/lib/c3p0-0.9.1.2.jar ./WEB-INF/lib/cglib-nodep-2.2.jar ./WEB-INF/lib/commons-beanutils-1.8.3.jar ./WEB-INF/lib/commons-collections-3.2.1.jar ./WEB-INF/lib/commons-digester-2.1.jar ./WEB-INF/lib/commons-logging-1.1.1.jar ./WEB-INF/lib/dom4j-1.6.1.jar ./WEB-INF/lib/ejb3-persistence-1.0.2.GA.jar ./WEB-INF/lib/hibernate-annotations-3.4.0.GA.jar ./WEB-INF/lib/hibernate-commons-annotations-3.1.0.GA.jar ./WEB-INF/lib/hibernate-core-3.3.2.GA.jar ./WEB-INF/lib/javassist-3.7.ga.jar ./WEB-INF/lib/jstl-1.1.2.jar ./WEB-INF/lib/jta-1.1.jar ./WEB-INF/lib/junit-4.8.1.jar ./WEB-INF/lib/log4j-1.2.14.jar ./WEB-INF/lib/mysql-connector-java-5.1.14.jar ./WEB-INF/lib/persistence-api-1.0.jar ./WEB-INF/lib/slf4j-api-1.6.1.jar ./WEB-INF/lib/slf4j-log4j12-1.6.1.jar ./WEB-INF/lib/spring-aop-3.0.5.RELEASE.jar ./WEB-INF/lib/spring-asm-3.0.5.RELEASE.jar ./WEB-INF/lib/spring-beans-3.0.5.RELEASE.jar ./WEB-INF/lib/spring-context-3.0.5.RELEASE.jar ./WEB-INF/lib/spring-context-support-3.0.5.RELEASE.jar ./WEB-INF/lib/spring-core-3.0.5.RELEASE.jar ./WEB-INF/lib/spring-expression-3.0.5.RELEASE.jar ./WEB-INF/lib/spring-jdbc-3.0.5.RELEASE.jar ./WEB-INF/lib/spring-orm-3.0.5.RELEASE.jar ./WEB-INF/lib/spring-tx-3.0.5.RELEASE.jar ./WEB-INF/lib/spring-web-3.0.5.RELEASE.jar ./WEB-INF/lib/spring-webmvc-3.0.5.RELEASE.jar ./WEB-INF/lib/standard-1.1.2.jar ./WEB-INF/lib/xml-apis-1.0.b2.jar ./WEB-INF/spring-servlet.xml ./WEB-INF/spring.properties ./WEB-INF/web.xml So, are you excited about Java EE 6 ? Want to get started now ? Here are some resources: Java EE 6 SDK (including runtime, samples, tutorials etc) GlassFish Server Open Source Edition 3.1.2 (Community) Oracle GlassFish Server 3.1.2 (Commercial) Java EE 6 using WebLogic 12c and NetBeans (Video) Java EE 6 with NetBeans and GlassFish (Video) Java EE with Eclipse and GlassFish (Video)

    Read the article

  • Top things web developers should know about the Visual Studio 2013 release

    - by Jon Galloway
    ASP.NET and Web Tools for Visual Studio 2013 Release NotesASP.NET and Web Tools for Visual Studio 2013 Release NotesSummary for lazy readers: Visual Studio 2013 is now available for download on the Visual Studio site and on MSDN subscriber downloads) Visual Studio 2013 installs side by side with Visual Studio 2012 and supports round-tripping between Visual Studio versions, so you can try it out without committing to a switch Visual Studio 2013 ships with the new version of ASP.NET, which includes ASP.NET MVC 5, ASP.NET Web API 2, Razor 3, Entity Framework 6 and SignalR 2.0 The new releases ASP.NET focuses on One ASP.NET, so core features and web tools work the same across the platform (e.g. adding ASP.NET MVC controllers to a Web Forms application) New core features include new templates based on Bootstrap, a new scaffolding system, and a new identity system Visual Studio 2013 is an incredible editor for web files, including HTML, CSS, JavaScript, Markdown, LESS, Coffeescript, Handlebars, Angular, Ember, Knockdown, etc. Top links: Visual Studio 2013 content on the ASP.NET site are in the standard new releases area: http://www.asp.net/vnext ASP.NET and Web Tools for Visual Studio 2013 Release Notes Short intro videos on the new Visual Studio web editor features from Scott Hanselman and Mads Kristensen Announcing release of ASP.NET and Web Tools for Visual Studio 2013 post on the official .NET Web Development and Tools Blog Scott Guthrie's post: Announcing the Release of Visual Studio 2013 and Great Improvements to ASP.NET and Entity Framework Okay, for those of you who are still with me, let's dig in a bit. Quick web dev notes on downloading and installing Visual Studio 2013 I found Visual Studio 2013 to be a pretty fast install. According to Brian Harry's release post, installing over pre-release versions of Visual Studio is supported.  I've installed the release version over pre-release versions, and it worked fine. If you're only going to be doing web development, you can speed up the install if you just select Web Developer tools. Of course, as a good Microsoft employee, I'll mention that you might also want to install some of those other features, like the Store apps for Windows 8 and the Windows Phone 8.0 SDK, but they do download and install a lot of other stuff (e.g. the Windows Phone SDK sets up Hyper-V and downloads several GB's of VM's). So if you're planning just to do web development for now, you can pick just the Web Developer Tools and install the other stuff later. If you've got a fast internet connection, I recommend using the web installer instead of downloading the ISO. The ISO includes all the features, whereas the web installer just downloads what you're installing. Visual Studio 2013 development settings and color theme When you start up Visual Studio, it'll prompt you to pick some defaults. These are totally up to you -whatever suits your development style - and you can change them later. As I said, these are completely up to you. I recommend either the Web Development or Web Development (Code Only) settings. The only real difference is that Code Only hides the toolbars, and you can switch between them using Tools / Import and Export Settings / Reset. Web Development settings Web Development (code only) settings Usually I've just gone with Web Development (code only) in the past because I just want to focus on the code, although the Standard toolbar does make it easier to switch default web browsers. More on that later. Color theme Sigh. Okay, everyone's got their favorite colors. I alternate between Light and Dark depending on my mood, and I personally like how the low contrast on the window chrome in those themes puts the emphasis on my code rather than the tabs and toolbars. I know some people got pretty worked up over that, though, and wanted the blue theme back. I personally don't like it - it reminds me of ancient versions of Visual Studio that I don't want to think about anymore. So here's the thing: if you install Visual Studio Ultimate, it defaults to Blue. The other versions default to Light. If you use Blue, I won't criticize you - out loud, that is. You can change themes really easily - either Tools / Options / Environment / General, or the smart way: ctrl+q for quick launch, then type Theme and hit enter. Signing in During the first run, you'll be prompted to sign in. You don't have to - you can click the "Not now, maybe later" link at the bottom of that dialog. I recommend signing in, though. It's not hooked in with licensing or tracking the kind of code you write to sell you components. It is doing good things, like  syncing your Visual Studio settings between computers. More about that here. So, you don't have to, but I sure do. Overview of shiny new things in ASP.NET land There are a lot of good new things in ASP.NET. I'll list some of my favorite here, but you can read more on the ASP.NET site. One ASP.NET You've heard us talk about this for a while. The idea is that options are good, but choice can be a burden. When you start a new ASP.NET project, why should you have to make a tough decision - with long-term consequences - about how your application will work? If you want to use ASP.NET Web Forms, but have the option of adding in ASP.NET MVC later, why should that be hard? It's all ASP.NET, right? Ideally, you'd just decide that you want to use ASP.NET to build sites and services, and you could use the appropriate tools (the green blocks below) as you needed them. So, here it is. When you create a new ASP.NET application, you just create an ASP.NET application. Next, you can pick from some templates to get you started... but these are different. They're not "painful decision" templates, they're just some starting pieces. And, most importantly, you can mix and match. I can pick a "mostly" Web Forms template, but include MVC and Web API folders and core references. If you've tried to mix and match in the past, you're probably aware that it was possible, but not pleasant. ASP.NET MVC project files contained special project type GUIDs, so you'd only get controller scaffolding support in a Web Forms project if you manually edited the csproj file. Features in one stack didn't work in others. Project templates were painful choices. That's no longer the case. Hooray! I just did a demo in a presentation last week where I created a new Web Forms + MVC + Web API site, built a model, scaffolded MVC and Web API controllers with EF Code First, add data in the MVC view, viewed it in Web API, then added a GridView to the Web Forms Default.aspx page and bound it to the Model. In about 5 minutes. Sure, it's a simple example, but it's great to be able to share code and features across the whole ASP.NET family. Authentication In the past, authentication was built into the templates. So, for instance, there was an ASP.NET MVC 4 Intranet Project template which created a new ASP.NET MVC 4 application that was preconfigured for Windows Authentication. All of that authentication stuff was built into each template, so they varied between the stacks, and you couldn't reuse them. You didn't see a lot of changes to the authentication options, since they required big changes to a bunch of project templates. Now, the new project dialog includes a common authentication experience. When you hit the Change Authentication button, you get some common options that work the same way regardless of the template or reference settings you've made. These options work on all ASP.NET frameworks, and all hosting environments (IIS, IIS Express, or OWIN for self-host) The default is Individual User Accounts: This is the standard "create a local account, using username / password or OAuth" thing; however, it's all built on the new Identity system. More on that in a second. The one setting that has some configuration to it is Organizational Accounts, which lets you configure authentication using Active Directory, Windows Azure Active Directory, or Office 365. Identity There's a new identity system. We've taken the best parts of the previous ASP.NET Membership and Simple Identity systems, rolled in a lot of feedback and made big enhancements to support important developer concerns like unit testing and extensiblity. I've written long posts about ASP.NET identity, and I'll do it again. Soon. This is not that post. The short version is that I think we've finally got just the right Identity system. Some of my favorite features: There are simple, sensible defaults that work well - you can File / New / Run / Register / Login, and everything works. It supports standard username / password as well as external authentication (OAuth, etc.). It's easy to customize without having to re-implement an entire provider. It's built using pluggable pieces, rather than one large monolithic system. It's built using interfaces like IUser and IRole that allow for unit testing, dependency injection, etc. You can easily add user profile data (e.g. URL, twitter handle, birthday). You just add properties to your ApplicationUser model and they'll automatically be persisted. Complete control over how the identity data is persisted. By default, everything works with Entity Framework Code First, but it's built to support changes from small (modify the schema) to big (use another ORM, store your data in a document database or in the cloud or in XML or in the EXIF data of your desktop background or whatever). It's configured via OWIN. More on OWIN and Katana later, but the fact that it's built using OWIN means it's portable. You can find out more in the Authentication and Identity section of the ASP.NET site (and lots more content will be going up there soon). New Bootstrap based project templates The new project templates are built using Bootstrap 3. Bootstrap (formerly Twitter Bootstrap) is a front-end framework that brings a lot of nice benefits: It's responsive, so your projects will automatically scale to device width using CSS media queries. For example, menus are full size on a desktop browser, but on narrower screens you automatically get a mobile-friendly menu. The built-in Bootstrap styles make your standard page elements (headers, footers, buttons, form inputs, tables etc.) look nice and modern. Bootstrap is themeable, so you can reskin your whole site by dropping in a new Bootstrap theme. Since Bootstrap is pretty popular across the web development community, this gives you a large and rapidly growing variety of templates (free and paid) to choose from. Bootstrap also includes a lot of very useful things: components (like progress bars and badges), useful glyphicons, and some jQuery plugins for tooltips, dropdowns, carousels, etc.). Here's a look at how the responsive part works. When the page is full screen, the menu and header are optimized for a wide screen display: When I shrink the page down (this is all based on page width, not useragent sniffing) the menu turns into a nice mobile-friendly dropdown: For a quick example, I grabbed a new free theme off bootswatch.com. For simple themes, you just need to download the boostrap.css file and replace the /content/bootstrap.css file in your project. Now when I refresh the page, I've got a new theme: Scaffolding The big change in scaffolding is that it's one system that works across ASP.NET. You can create a new Empty Web project or Web Forms project and you'll get the Scaffold context menus. For release, we've got MVC 5 and Web API 2 controllers. We had a preview of Web Forms scaffolding in the preview releases, but they weren't fully baked for RTM. Look for them in a future update, expected pretty soon. This scaffolding system wasn't just changed to work across the ASP.NET frameworks, it's also built to enable future extensibility. That's not in this release, but should also hopefully be out soon. Project Readme page This is a small thing, but I really like it. When you create a new project, you get a Project_Readme.html page that's added to the root of your project and opens in the Visual Studio built-in browser. I love it. A long time ago, when you created a new project we just dumped it on you and left you scratching your head about what to do next. Not ideal. Then we started adding a bunch of Getting Started information to the new project templates. That told you what to do next, but you had to delete all of that stuff out of your website. It doesn't belong there. Not ideal. This is a simple HTML file that's not integrated into your project code at all. You can delete it if you want. But, it shows a lot of helpful links that are current for the project you just created. In the future, if we add new wacky project types, they can create readme docs with specific information on how to do appropriately wacky things. Side note: I really like that they used the internal browser in Visual Studio to show this content rather than popping open an HTML page in the default browser. I hate that. It's annoying. If you're doing that, I hope you'll stop. What if some unnamed person has 40 or 90 tabs saved in their browser session? When you pop open your "Thanks for installing my Visual Studio extension!" page, all eleventy billion tabs start up and I wish I'd never installed your thing. Be like these guys and pop stuff Visual Studio specific HTML docs in the Visual Studio browser. ASP.NET MVC 5 The biggest change with ASP.NET MVC 5 is that it's no longer a separate project type. It integrates well with the rest of ASP.NET. In addition to that and the other common features we've already looked at (Bootstrap templates, Identity, authentication), here's what's new for ASP.NET MVC. Attribute routing ASP.NET MVC now supports attribute routing, thanks to a contribution by Tim McCall, the author of http://attributerouting.net. With attribute routing you can specify your routes by annotating your actions and controllers. This supports some pretty complex, customized routing scenarios, and it allows you to keep your route information right with your controller actions if you'd like. Here's a controller that includes an action whose method name is Hiding, but I've used AttributeRouting to configure it to /spaghetti/with-nesting/where-is-waldo public class SampleController : Controller { [Route("spaghetti/with-nesting/where-is-waldo")] public string Hiding() { return "You found me!"; } } I enable that in my RouteConfig.cs, and I can use that in conjunction with my other MVC routes like this: public class RouteConfig { public static void RegisterRoutes(RouteCollection routes) { routes.IgnoreRoute("{resource}.axd/{*pathInfo}"); routes.MapMvcAttributeRoutes(); routes.MapRoute( name: "Default", url: "{controller}/{action}/{id}", defaults: new { controller = "Home", action = "Index", id = UrlParameter.Optional } ); } } You can read more about Attribute Routing in ASP.NET MVC 5 here. Filter enhancements There are two new additions to filters: Authentication Filters and Filter Overrides. Authentication filters are a new kind of filter in ASP.NET MVC that run prior to authorization filters in the ASP.NET MVC pipeline and allow you to specify authentication logic per-action, per-controller, or globally for all controllers. Authentication filters process credentials in the request and provide a corresponding principal. Authentication filters can also add authentication challenges in response to unauthorized requests. Override filters let you change which filters apply to a given action method or controller. Override filters specify a set of filter types that should not be run for a given scope (action or controller). This allows you to configure filters that apply globally but then exclude certain global filters from applying to specific actions or controllers. ASP.NET Web API 2 ASP.NET Web API 2 includes a lot of new features. Attribute Routing ASP.NET Web API supports the same attribute routing system that's in ASP.NET MVC 5. You can read more about the Attribute Routing features in Web API in this article. OAuth 2.0 ASP.NET Web API picks up OAuth 2.0 support, using security middleware running on OWIN (discussed below). This is great for features like authenticated Single Page Applications. OData Improvements ASP.NET Web API now has full OData support. That required adding in some of the most powerful operators: $select, $expand, $batch and $value. You can read more about OData operator support in this article by Mike Wasson. Lots more There's a huge list of other features, including CORS (cross-origin request sharing), IHttpActionResult, IHttpRequestContext, and more. I think the best overview is in the release notes. OWIN and Katana I've written about OWIN and Katana recently. I'm a big fan. OWIN is the Open Web Interfaces for .NET. It's a spec, like HTML or HTTP, so you can't install OWIN. The benefit of OWIN is that it's a community specification, so anyone who implements it can plug into the ASP.NET stack, either as middleware or as a host. Katana is the Microsoft implementation of OWIN. It leverages OWIN to wire up things like authentication, handlers, modules, IIS hosting, etc., so ASP.NET can host OWIN components and Katana components can run in someone else's OWIN implementation. Howard Dierking just wrote a cool article in MSDN magazine describing Katana in depth: Getting Started with the Katana Project. He had an interesting example showing an OWIN based pipeline which leveraged SignalR, ASP.NET Web API and NancyFx components in the same stack. If this kind of thing makes sense to you, that's great. If it doesn't, don't worry, but keep an eye on it. You're going to see some cool things happen as a result of ASP.NET becoming more and more pluggable. Visual Studio Web Tools Okay, this stuff's just crazy. Visual Studio has been adding some nice web dev features over the past few years, but they've really cranked it up for this release. Visual Studio is by far my favorite code editor for all web files: CSS, HTML, JavaScript, and lots of popular libraries. Stop thinking of Visual Studio as a big editor that you only use to write back-end code. Stop editing HTML and CSS in Notepad (or Sublime, Notepad++, etc.). Visual Studio starts up in under 2 seconds on a modern computer with an SSD. Misspelling HTML attributes or your CSS classes or jQuery or Angular syntax is stupid. It doesn't make you a better developer, it makes you a silly person who wastes time. Browser Link Browser Link is a real-time, two-way connection between Visual Studio and all connected browsers. It's only attached when you're running locally, in debug, but it applies to any and all connected browser, including emulators. You may have seen demos that showed the browsers refreshing based on changes in the editor, and I'll agree that's pretty cool. But it's really just the start. It's a two-way connection, and it's built for extensiblity. That means you can write extensions that push information from your running application (in IE, Chrome, a mobile emulator, etc.) back to Visual Studio. Mads and team have showed off some demonstrations where they enabled edit mode in the browser which updated the source HTML back on the browser. It's also possible to look at how the rendered HTML performs, check for compatibility issues, watch for unused CSS classes, the sky's the limit. New HTML editor The previous HTML editor had a lot of old code that didn't allow for improvements. The team rewrote the HTML editor to take advantage of the new(ish) extensibility features in Visual Studio, which then allowed them to add in all kinds of features - things like CSS Class and ID IntelliSense (so you type style="" and get a list of classes and ID's for your project), smart indent based on how your document is formatted, JavaScript reference auto-sync, etc. Here's a 3 minute tour from Mads Kristensen. The previous HTML editor had a lot of old code that didn't allow for improvements. The team rewrote the HTML editor to take advantage of the new(ish) extensibility features in Visual Studio, which then allowed them to add in all kinds of features - things like CSS Class and ID IntelliSense (so you type style="" and get a list of classes and ID's for your project), smart indent based on how your document is formatted, JavaScript reference auto-sync, etc. Lots more Visual Studio web dev features That's just a sampling - there's a ton of great features for JavaScript editing, CSS editing, publishing, and Page Inspector (which shows real-time rendering of your page inside Visual Studio). Here are some more short videos showing those features. Lots, lots more Okay, that's just a summary, and it's still quite a bit. Head on over to http://asp.net/vnext for more information, and download Visual Studio 2013 now to get started!

    Read the article

  • Using Durandal to Create Single Page Apps

    - by Stephen.Walther
    A few days ago, I gave a talk on building Single Page Apps on the Microsoft Stack. In that talk, I recommended that people use Knockout, Sammy, and RequireJS to build their presentation layer and use the ASP.NET Web API to expose data from their server. After I gave the talk, several people contacted me and suggested that I investigate a new open-source JavaScript library named Durandal. Durandal stitches together Knockout, Sammy, and RequireJS to make it easier to use these technologies together. In this blog entry, I want to provide a brief walkthrough of using Durandal to create a simple Single Page App. I am going to demonstrate how you can create a simple Movies App which contains (virtual) pages for viewing a list of movies, adding new movies, and viewing movie details. The goal of this blog entry is to give you a sense of what it is like to build apps with Durandal. Installing Durandal First things first. How do you get Durandal? The GitHub project for Durandal is located here: https://github.com/BlueSpire/Durandal The Wiki — located at the GitHub project — contains all of the current documentation for Durandal. Currently, the documentation is a little sparse, but it is enough to get you started. Instead of downloading the Durandal source from GitHub, a better option for getting started with Durandal is to install one of the Durandal NuGet packages. I built the Movies App described in this blog entry by first creating a new ASP.NET MVC 4 Web Application with the Basic Template. Next, I executed the following command from the Package Manager Console: Install-Package Durandal.StarterKit As you can see from the screenshot of the Package Manager Console above, the Durandal Starter Kit package has several dependencies including: · jQuery · Knockout · Sammy · Twitter Bootstrap The Durandal Starter Kit package includes a sample Durandal application. You can get to the Starter Kit app by navigating to the Durandal controller. Unfortunately, when I first tried to run the Starter Kit app, I got an error because the Starter Kit is hard-coded to use a particular version of jQuery which is already out of date. You can fix this issue by modifying the App_Start\DurandalBundleConfig.cs file so it is jQuery version agnostic like this: bundles.Add( new ScriptBundle("~/scripts/vendor") .Include("~/Scripts/jquery-{version}.js") .Include("~/Scripts/knockout-{version}.js") .Include("~/Scripts/sammy-{version}.js") // .Include("~/Scripts/jquery-1.9.0.min.js") // .Include("~/Scripts/knockout-2.2.1.js") // .Include("~/Scripts/sammy-0.7.4.min.js") .Include("~/Scripts/bootstrap.min.js") ); The recommendation is that you create a Durandal app in a folder off your project root named App. The App folder in the Starter Kit contains the following subfolders and files: · durandal – This folder contains the actual durandal JavaScript library. · viewmodels – This folder contains all of your application’s view models. · views – This folder contains all of your application’s views. · main.js — This file contains all of the JavaScript startup code for your app including the client-side routing configuration. · main-built.js – This file contains an optimized version of your application. You need to build this file by using the RequireJS optimizer (unfortunately, before you can run the optimizer, you must first install NodeJS). For the purpose of this blog entry, I wanted to start from scratch when building the Movies app, so I deleted all of these files and folders except for the durandal folder which contains the durandal library. Creating the ASP.NET MVC Controller and View A Durandal app is built using a single server-side ASP.NET MVC controller and ASP.NET MVC view. A Durandal app is a Single Page App. When you navigate between pages, you are not navigating to new pages on the server. Instead, you are loading new virtual pages into the one-and-only-one server-side view. For the Movies app, I created the following ASP.NET MVC Home controller: public class HomeController : Controller { public ActionResult Index() { return View(); } } There is nothing special about the Home controller – it is as basic as it gets. Next, I created the following server-side ASP.NET view. This is the one-and-only server-side view used by the Movies app: @{ Layout = null; } <!DOCTYPE html> <html> <head> <title>Index</title> </head> <body> <div id="applicationHost"> Loading app.... </div> @Scripts.Render("~/scripts/vendor") <script type="text/javascript" src="~/App/durandal/amd/require.js" data-main="/App/main"></script> </body> </html> Notice that I set the Layout property for the view to the value null. If you neglect to do this, then the default ASP.NET MVC layout will be applied to the view and you will get the <!DOCTYPE> and opening and closing <html> tags twice. Next, notice that the view contains a DIV element with the Id applicationHost. This marks the area where virtual pages are loaded. When you navigate from page to page in a Durandal app, HTML page fragments are retrieved from the server and stuck in the applicationHost DIV element. Inside the applicationHost element, you can place any content which you want to display when a Durandal app is starting up. For example, you can create a fancy splash screen. I opted for simply displaying the text “Loading app…”: Next, notice the view above includes a call to the Scripts.Render() helper. This helper renders out all of the JavaScript files required by the Durandal library such as jQuery and Knockout. Remember to fix the App_Start\DurandalBundleConfig.cs as described above or Durandal will attempt to load an old version of jQuery and throw a JavaScript exception and stop working. Your application JavaScript code is not included in the scripts rendered by the Scripts.Render helper. Your application code is loaded dynamically by RequireJS with the help of the following SCRIPT element located at the bottom of the view: <script type="text/javascript" src="~/App/durandal/amd/require.js" data-main="/App/main"></script> The data-main attribute on the SCRIPT element causes RequireJS to load your /app/main.js JavaScript file to kick-off your Durandal app. Creating the Durandal Main.js File The Durandal Main.js JavaScript file, located in your App folder, contains all of the code required to configure the behavior of Durandal. Here’s what the Main.js file looks like in the case of the Movies app: require.config({ paths: { 'text': 'durandal/amd/text' } }); define(function (require) { var app = require('durandal/app'), viewLocator = require('durandal/viewLocator'), system = require('durandal/system'), router = require('durandal/plugins/router'); //>>excludeStart("build", true); system.debug(true); //>>excludeEnd("build"); app.start().then(function () { //Replace 'viewmodels' in the moduleId with 'views' to locate the view. //Look for partial views in a 'views' folder in the root. viewLocator.useConvention(); //configure routing router.useConvention(); router.mapNav("movies/show"); router.mapNav("movies/add"); router.mapNav("movies/details/:id"); app.adaptToDevice(); //Show the app by setting the root view model for our application with a transition. app.setRoot('viewmodels/shell', 'entrance'); }); }); There are three important things to notice about the main.js file above. First, notice that it contains a section which enables debugging which looks like this: //>>excludeStart(“build”, true); system.debug(true); //>>excludeEnd(“build”); This code enables debugging for your Durandal app which is very useful when things go wrong. When you call system.debug(true), Durandal writes out debugging information to your browser JavaScript console. For example, you can use the debugging information to diagnose issues with your client-side routes: (The funny looking //> symbols around the system.debug() call are RequireJS optimizer pragmas). The main.js file is also the place where you configure your client-side routes. In the case of the Movies app, the main.js file is used to configure routes for three page: the movies show, add, and details pages. //configure routing router.useConvention(); router.mapNav("movies/show"); router.mapNav("movies/add"); router.mapNav("movies/details/:id");   The route for movie details includes a route parameter named id. Later, we will use the id parameter to lookup and display the details for the right movie. Finally, the main.js file above contains the following line of code: //Show the app by setting the root view model for our application with a transition. app.setRoot('viewmodels/shell', 'entrance'); This line of code causes Durandal to load up a JavaScript file named shell.js and an HTML fragment named shell.html. I’ll discuss the shell in the next section. Creating the Durandal Shell You can think of the Durandal shell as the layout or master page for a Durandal app. The shell is where you put all of the content which you want to remain constant as a user navigates from virtual page to virtual page. For example, the shell is a great place to put your website logo and navigation links. The Durandal shell is composed from two parts: a JavaScript file and an HTML file. Here’s what the HTML file looks like for the Movies app: <h1>Movies App</h1> <div class="container-fluid page-host"> <!--ko compose: { model: router.activeItem, //wiring the router afterCompose: router.afterCompose, //wiring the router transition:'entrance', //use the 'entrance' transition when switching views cacheViews:true //telling composition to keep views in the dom, and reuse them (only a good idea with singleton view models) }--><!--/ko--> </div> And here is what the JavaScript file looks like: define(function (require) { var router = require('durandal/plugins/router'); return { router: router, activate: function () { return router.activate('movies/show'); } }; }); The JavaScript file contains the view model for the shell. This view model returns the Durandal router so you can access the list of configured routes from your shell. Notice that the JavaScript file includes a function named activate(). This function loads the movies/show page as the first page in the Movies app. If you want to create a different default Durandal page, then pass the name of a different age to the router.activate() method. Creating the Movies Show Page Durandal pages are created out of a view model and a view. The view model contains all of the data and view logic required for the view. The view contains all of the HTML markup for rendering the view model. Let’s start with the movies show page. The movies show page displays a list of movies. The view model for the show page looks like this: define(function (require) { var moviesRepository = require("repositories/moviesRepository"); return { movies: ko.observable(), activate: function() { this.movies(moviesRepository.listMovies()); } }; }); You create a view model by defining a new RequireJS module (see http://requirejs.org). You create a RequireJS module by placing all of your JavaScript code into an anonymous function passed to the RequireJS define() method. A RequireJS module has two parts. You retrieve all of the modules which your module requires at the top of your module. The code above depends on another RequireJS module named repositories/moviesRepository. Next, you return the implementation of your module. The code above returns a JavaScript object which contains a property named movies and a method named activate. The activate() method is a magic method which Durandal calls whenever it activates your view model. Your view model is activated whenever you navigate to a page which uses it. In the code above, the activate() method is used to get the list of movies from the movies repository and assign the list to the view model movies property. The HTML for the movies show page looks like this: <table> <thead> <tr> <th>Title</th><th>Director</th> </tr> </thead> <tbody data-bind="foreach:movies"> <tr> <td data-bind="text:title"></td> <td data-bind="text:director"></td> <td><a data-bind="attr:{href:'#/movies/details/'+id}">Details</a></td> </tr> </tbody> </table> <a href="#/movies/add">Add Movie</a> Notice that this is an HTML fragment. This fragment will be stuffed into the page-host DIV element in the shell.html file which is stuffed, in turn, into the applicationHost DIV element in the server-side MVC view. The HTML markup above contains data-bind attributes used by Knockout to display the list of movies (To learn more about Knockout, visit http://knockoutjs.com). The list of movies from the view model is displayed in an HTML table. Notice that the page includes a link to a page for adding a new movie. The link uses the following URL which starts with a hash: #/movies/add. Because the link starts with a hash, clicking the link does not cause a request back to the server. Instead, you navigate to the movies/add page virtually. Creating the Movies Add Page The movies add page also consists of a view model and view. The add page enables you to add a new movie to the movie database. Here’s the view model for the add page: define(function (require) { var app = require('durandal/app'); var router = require('durandal/plugins/router'); var moviesRepository = require("repositories/moviesRepository"); return { movieToAdd: { title: ko.observable(), director: ko.observable() }, activate: function () { this.movieToAdd.title(""); this.movieToAdd.director(""); this._movieAdded = false; }, canDeactivate: function () { if (this._movieAdded == false) { return app.showMessage('Are you sure you want to leave this page?', 'Navigate', ['Yes', 'No']); } else { return true; } }, addMovie: function () { // Add movie to db moviesRepository.addMovie(ko.toJS(this.movieToAdd)); // flag new movie this._movieAdded = true; // return to list of movies router.navigateTo("#/movies/show"); } }; }); The view model contains one property named movieToAdd which is bound to the add movie form. The view model also has the following three methods: 1. activate() – This method is called by Durandal when you navigate to the add movie page. The activate() method resets the add movie form by clearing out the movie title and director properties. 2. canDeactivate() – This method is called by Durandal when you attempt to navigate away from the add movie page. If you return false then navigation is cancelled. 3. addMovie() – This method executes when the add movie form is submitted. This code adds the new movie to the movie repository. I really like the Durandal canDeactivate() method. In the code above, I use the canDeactivate() method to show a warning to a user if they navigate away from the add movie page – either by clicking the Cancel button or by hitting the browser back button – before submitting the add movie form: The view for the add movie page looks like this: <form data-bind="submit:addMovie"> <fieldset> <legend>Add Movie</legend> <div> <label> Title: <input data-bind="value:movieToAdd.title" required /> </label> </div> <div> <label> Director: <input data-bind="value:movieToAdd.director" required /> </label> </div> <div> <input type="submit" value="Add" /> <a href="#/movies/show">Cancel</a> </div> </fieldset> </form> I am using Knockout to bind the movieToAdd property from the view model to the INPUT elements of the HTML form. Notice that the FORM element includes a data-bind attribute which invokes the addMovie() method from the view model when the HTML form is submitted. Creating the Movies Details Page You navigate to the movies details Page by clicking the Details link which appears next to each movie in the movies show page: The Details links pass the movie ids to the details page: #/movies/details/0 #/movies/details/1 #/movies/details/2 Here’s what the view model for the movies details page looks like: define(function (require) { var router = require('durandal/plugins/router'); var moviesRepository = require("repositories/moviesRepository"); return { movieToShow: { title: ko.observable(), director: ko.observable() }, activate: function (context) { // Grab movie from repository var movie = moviesRepository.getMovie(context.id); // Add to view model this.movieToShow.title(movie.title); this.movieToShow.director(movie.director); } }; }); Notice that the view model activate() method accepts a parameter named context. You can take advantage of the context parameter to retrieve route parameters such as the movie Id. In the code above, the context.id property is used to retrieve the correct movie from the movie repository and the movie is assigned to a property named movieToShow exposed by the view model. The movie details view displays the movieToShow property by taking advantage of Knockout bindings: <div> <h2 data-bind="text:movieToShow.title"></h2> directed by <span data-bind="text:movieToShow.director"></span> </div> Summary The goal of this blog entry was to walkthrough building a simple Single Page App using Durandal and to get a feel for what it is like to use this library. I really like how Durandal stitches together Knockout, Sammy, and RequireJS and establishes patterns for using these libraries to build Single Page Apps. Having a standard pattern which developers on a team can use to build new pages is super valuable. Once you get the hang of it, using Durandal to create new virtual pages is dead simple. Just define a new route, view model, and view and you are done. I also appreciate the fact that Durandal did not attempt to re-invent the wheel and that Durandal leverages existing JavaScript libraries such as Knockout, RequireJS, and Sammy. These existing libraries are powerful libraries and I have already invested a considerable amount of time in learning how to use them. Durandal makes it easier to use these libraries together without losing any of their power. Durandal has some additional interesting features which I have not had a chance to play with yet. For example, you can use the RequireJS optimizer to combine and minify all of a Durandal app’s code. Also, Durandal supports a way to create custom widgets (client-side controls) by composing widgets from a controller and view. You can download the code for the Movies app by clicking the following link (this is a Visual Studio 2012 project): Durandal Movie App

    Read the article

  • Improving Partitioned Table Join Performance

    - by Paul White
    The query optimizer does not always choose an optimal strategy when joining partitioned tables. This post looks at an example, showing how a manual rewrite of the query can almost double performance, while reducing the memory grant to almost nothing. Test Data The two tables in this example use a common partitioning partition scheme. The partition function uses 41 equal-size partitions: CREATE PARTITION FUNCTION PFT (integer) AS RANGE RIGHT FOR VALUES ( 125000, 250000, 375000, 500000, 625000, 750000, 875000, 1000000, 1125000, 1250000, 1375000, 1500000, 1625000, 1750000, 1875000, 2000000, 2125000, 2250000, 2375000, 2500000, 2625000, 2750000, 2875000, 3000000, 3125000, 3250000, 3375000, 3500000, 3625000, 3750000, 3875000, 4000000, 4125000, 4250000, 4375000, 4500000, 4625000, 4750000, 4875000, 5000000 ); GO CREATE PARTITION SCHEME PST AS PARTITION PFT ALL TO ([PRIMARY]); There two tables are: CREATE TABLE dbo.T1 ( TID integer NOT NULL IDENTITY(0,1), Column1 integer NOT NULL, Padding binary(100) NOT NULL DEFAULT 0x,   CONSTRAINT PK_T1 PRIMARY KEY CLUSTERED (TID) ON PST (TID) );   CREATE TABLE dbo.T2 ( TID integer NOT NULL, Column1 integer NOT NULL, Padding binary(100) NOT NULL DEFAULT 0x,   CONSTRAINT PK_T2 PRIMARY KEY CLUSTERED (TID, Column1) ON PST (TID) ); The next script loads 5 million rows into T1 with a pseudo-random value between 1 and 5 for Column1. The table is partitioned on the IDENTITY column TID: INSERT dbo.T1 WITH (TABLOCKX) (Column1) SELECT (ABS(CHECKSUM(NEWID())) % 5) + 1 FROM dbo.Numbers AS N WHERE n BETWEEN 1 AND 5000000; In case you don’t already have an auxiliary table of numbers lying around, here’s a script to create one with 10 million rows: CREATE TABLE dbo.Numbers (n bigint PRIMARY KEY);   WITH L0 AS(SELECT 1 AS c UNION ALL SELECT 1), L1 AS(SELECT 1 AS c FROM L0 AS A CROSS JOIN L0 AS B), L2 AS(SELECT 1 AS c FROM L1 AS A CROSS JOIN L1 AS B), L3 AS(SELECT 1 AS c FROM L2 AS A CROSS JOIN L2 AS B), L4 AS(SELECT 1 AS c FROM L3 AS A CROSS JOIN L3 AS B), L5 AS(SELECT 1 AS c FROM L4 AS A CROSS JOIN L4 AS B), Nums AS(SELECT ROW_NUMBER() OVER (ORDER BY (SELECT NULL)) AS n FROM L5) INSERT dbo.Numbers WITH (TABLOCKX) SELECT TOP (10000000) n FROM Nums ORDER BY n OPTION (MAXDOP 1); Table T1 contains data like this: Next we load data into table T2. The relationship between the two tables is that table 2 contains ‘n’ rows for each row in table 1, where ‘n’ is determined by the value in Column1 of table T1. There is nothing particularly special about the data or distribution, by the way. INSERT dbo.T2 WITH (TABLOCKX) (TID, Column1) SELECT T.TID, N.n FROM dbo.T1 AS T JOIN dbo.Numbers AS N ON N.n >= 1 AND N.n <= T.Column1; Table T2 ends up containing about 15 million rows: The primary key for table T2 is a combination of TID and Column1. The data is partitioned according to the value in column TID alone. Partition Distribution The following query shows the number of rows in each partition of table T1: SELECT PartitionID = CA1.P, NumRows = COUNT_BIG(*) FROM dbo.T1 AS T CROSS APPLY (VALUES ($PARTITION.PFT(TID))) AS CA1 (P) GROUP BY CA1.P ORDER BY CA1.P; There are 40 partitions containing 125,000 rows (40 * 125k = 5m rows). The rightmost partition remains empty. The next query shows the distribution for table 2: SELECT PartitionID = CA1.P, NumRows = COUNT_BIG(*) FROM dbo.T2 AS T CROSS APPLY (VALUES ($PARTITION.PFT(TID))) AS CA1 (P) GROUP BY CA1.P ORDER BY CA1.P; There are roughly 375,000 rows in each partition (the rightmost partition is also empty): Ok, that’s the test data done. Test Query and Execution Plan The task is to count the rows resulting from joining tables 1 and 2 on the TID column: SET STATISTICS IO ON; DECLARE @s datetime2 = SYSUTCDATETIME();   SELECT COUNT_BIG(*) FROM dbo.T1 AS T1 JOIN dbo.T2 AS T2 ON T2.TID = T1.TID;   SELECT DATEDIFF(Millisecond, @s, SYSUTCDATETIME()); SET STATISTICS IO OFF; The optimizer chooses a plan using parallel hash join, and partial aggregation: The Plan Explorer plan tree view shows accurate cardinality estimates and an even distribution of rows across threads (click to enlarge the image): With a warm data cache, the STATISTICS IO output shows that no physical I/O was needed, and all 41 partitions were touched: Running the query without actual execution plan or STATISTICS IO information for maximum performance, the query returns in around 2600ms. Execution Plan Analysis The first step toward improving on the execution plan produced by the query optimizer is to understand how it works, at least in outline. The two parallel Clustered Index Scans use multiple threads to read rows from tables T1 and T2. Parallel scan uses a demand-based scheme where threads are given page(s) to scan from the table as needed. This arrangement has certain important advantages, but does result in an unpredictable distribution of rows amongst threads. The point is that multiple threads cooperate to scan the whole table, but it is impossible to predict which rows end up on which threads. For correct results from the parallel hash join, the execution plan has to ensure that rows from T1 and T2 that might join are processed on the same thread. For example, if a row from T1 with join key value ‘1234’ is placed in thread 5’s hash table, the execution plan must guarantee that any rows from T2 that also have join key value ‘1234’ probe thread 5’s hash table for matches. The way this guarantee is enforced in this parallel hash join plan is by repartitioning rows to threads after each parallel scan. The two repartitioning exchanges route rows to threads using a hash function over the hash join keys. The two repartitioning exchanges use the same hash function so rows from T1 and T2 with the same join key must end up on the same hash join thread. Expensive Exchanges This business of repartitioning rows between threads can be very expensive, especially if a large number of rows is involved. The execution plan selected by the optimizer moves 5 million rows through one repartitioning exchange and around 15 million across the other. As a first step toward removing these exchanges, consider the execution plan selected by the optimizer if we join just one partition from each table, disallowing parallelism: SELECT COUNT_BIG(*) FROM dbo.T1 AS T1 JOIN dbo.T2 AS T2 ON T2.TID = T1.TID WHERE $PARTITION.PFT(T1.TID) = 1 AND $PARTITION.PFT(T2.TID) = 1 OPTION (MAXDOP 1); The optimizer has chosen a (one-to-many) merge join instead of a hash join. The single-partition query completes in around 100ms. If everything scaled linearly, we would expect that extending this strategy to all 40 populated partitions would result in an execution time around 4000ms. Using parallelism could reduce that further, perhaps to be competitive with the parallel hash join chosen by the optimizer. This raises a question. If the most efficient way to join one partition from each of the tables is to use a merge join, why does the optimizer not choose a merge join for the full query? Forcing a Merge Join Let’s force the optimizer to use a merge join on the test query using a hint: SELECT COUNT_BIG(*) FROM dbo.T1 AS T1 JOIN dbo.T2 AS T2 ON T2.TID = T1.TID OPTION (MERGE JOIN); This is the execution plan selected by the optimizer: This plan results in the same number of logical reads reported previously, but instead of 2600ms the query takes 5000ms. The natural explanation for this drop in performance is that the merge join plan is only using a single thread, whereas the parallel hash join plan could use multiple threads. Parallel Merge Join We can get a parallel merge join plan using the same query hint as before, and adding trace flag 8649: SELECT COUNT_BIG(*) FROM dbo.T1 AS T1 JOIN dbo.T2 AS T2 ON T2.TID = T1.TID OPTION (MERGE JOIN, QUERYTRACEON 8649); The execution plan is: This looks promising. It uses a similar strategy to distribute work across threads as seen for the parallel hash join. In practice though, performance is disappointing. On a typical run, the parallel merge plan runs for around 8400ms; slower than the single-threaded merge join plan (5000ms) and much worse than the 2600ms for the parallel hash join. We seem to be going backwards! The logical reads for the parallel merge are still exactly the same as before, with no physical IOs. The cardinality estimates and thread distribution are also still very good (click to enlarge): A big clue to the reason for the poor performance is shown in the wait statistics (captured by Plan Explorer Pro): CXPACKET waits require careful interpretation, and are most often benign, but in this case excessive waiting occurs at the repartitioning exchanges. Unlike the parallel hash join, the repartitioning exchanges in this plan are order-preserving ‘merging’ exchanges (because merge join requires ordered inputs): Parallelism works best when threads can just grab any available unit of work and get on with processing it. Preserving order introduces inter-thread dependencies that can easily lead to significant waits occurring. In extreme cases, these dependencies can result in an intra-query deadlock, though the details of that will have to wait for another time to explore in detail. The potential for waits and deadlocks leads the query optimizer to cost parallel merge join relatively highly, especially as the degree of parallelism (DOP) increases. This high costing resulted in the optimizer choosing a serial merge join rather than parallel in this case. The test results certainly confirm its reasoning. Collocated Joins In SQL Server 2008 and later, the optimizer has another available strategy when joining tables that share a common partition scheme. This strategy is a collocated join, also known as as a per-partition join. It can be applied in both serial and parallel execution plans, though it is limited to 2-way joins in the current optimizer. Whether the optimizer chooses a collocated join or not depends on cost estimation. The primary benefits of a collocated join are that it eliminates an exchange and requires less memory, as we will see next. Costing and Plan Selection The query optimizer did consider a collocated join for our original query, but it was rejected on cost grounds. The parallel hash join with repartitioning exchanges appeared to be a cheaper option. There is no query hint to force a collocated join, so we have to mess with the costing framework to produce one for our test query. Pretending that IOs cost 50 times more than usual is enough to convince the optimizer to use collocated join with our test query: -- Pretend IOs are 50x cost temporarily DBCC SETIOWEIGHT(50);   -- Co-located hash join SELECT COUNT_BIG(*) FROM dbo.T1 AS T1 JOIN dbo.T2 AS T2 ON T2.TID = T1.TID OPTION (RECOMPILE);   -- Reset IO costing DBCC SETIOWEIGHT(1); Collocated Join Plan The estimated execution plan for the collocated join is: The Constant Scan contains one row for each partition of the shared partitioning scheme, from 1 to 41. The hash repartitioning exchanges seen previously are replaced by a single Distribute Streams exchange using Demand partitioning. Demand partitioning means that the next partition id is given to the next parallel thread that asks for one. My test machine has eight logical processors, and all are available for SQL Server to use. As a result, there are eight threads in the single parallel branch in this plan, each processing one partition from each table at a time. Once a thread finishes processing a partition, it grabs a new partition number from the Distribute Streams exchange…and so on until all partitions have been processed. It is important to understand that the parallel scans in this plan are different from the parallel hash join plan. Although the scans have the same parallelism icon, tables T1 and T2 are not being co-operatively scanned by multiple threads in the same way. Each thread reads a single partition of T1 and performs a hash match join with the same partition from table T2. The properties of the two Clustered Index Scans show a Seek Predicate (unusual for a scan!) limiting the rows to a single partition: The crucial point is that the join between T1 and T2 is on TID, and TID is the partitioning column for both tables. A thread that processes partition ‘n’ is guaranteed to see all rows that can possibly join on TID for that partition. In addition, no other thread will see rows from that partition, so this removes the need for repartitioning exchanges. CPU and Memory Efficiency Improvements The collocated join has removed two expensive repartitioning exchanges and added a single exchange processing 41 rows (one for each partition id). Remember, the parallel hash join plan exchanges had to process 5 million and 15 million rows. The amount of processor time spent on exchanges will be much lower in the collocated join plan. In addition, the collocated join plan has a maximum of 8 threads processing single partitions at any one time. The 41 partitions will all be processed eventually, but a new partition is not started until a thread asks for it. Threads can reuse hash table memory for the new partition. The parallel hash join plan also had 8 hash tables, but with all 5,000,000 build rows loaded at the same time. The collocated plan needs memory for only 8 * 125,000 = 1,000,000 rows at any one time. Collocated Hash Join Performance The collated join plan has disappointing performance in this case. The query runs for around 25,300ms despite the same IO statistics as usual. This is much the worst result so far, so what went wrong? It turns out that cardinality estimation for the single partition scans of table T1 is slightly low. The properties of the Clustered Index Scan of T1 (graphic immediately above) show the estimation was for 121,951 rows. This is a small shortfall compared with the 125,000 rows actually encountered, but it was enough to cause the hash join to spill to physical tempdb: A level 1 spill doesn’t sound too bad, until you realize that the spill to tempdb probably occurs for each of the 41 partitions. As a side note, the cardinality estimation error is a little surprising because the system tables accurately show there are 125,000 rows in every partition of T1. Unfortunately, the optimizer uses regular column and index statistics to derive cardinality estimates here rather than system table information (e.g. sys.partitions). Collocated Merge Join We will never know how well the collocated parallel hash join plan might have worked without the cardinality estimation error (and the resulting 41 spills to tempdb) but we do know: Merge join does not require a memory grant; and Merge join was the optimizer’s preferred join option for a single partition join Putting this all together, what we would really like to see is the same collocated join strategy, but using merge join instead of hash join. Unfortunately, the current query optimizer cannot produce a collocated merge join; it only knows how to do collocated hash join. So where does this leave us? CROSS APPLY sys.partitions We can try to write our own collocated join query. We can use sys.partitions to find the partition numbers, and CROSS APPLY to get a count per partition, with a final step to sum the partial counts. The following query implements this idea: SELECT row_count = SUM(Subtotals.cnt) FROM ( -- Partition numbers SELECT p.partition_number FROM sys.partitions AS p WHERE p.[object_id] = OBJECT_ID(N'T1', N'U') AND p.index_id = 1 ) AS P CROSS APPLY ( -- Count per collocated join SELECT cnt = COUNT_BIG(*) FROM dbo.T1 AS T1 JOIN dbo.T2 AS T2 ON T2.TID = T1.TID WHERE $PARTITION.PFT(T1.TID) = p.partition_number AND $PARTITION.PFT(T2.TID) = p.partition_number ) AS SubTotals; The estimated plan is: The cardinality estimates aren’t all that good here, especially the estimate for the scan of the system table underlying the sys.partitions view. Nevertheless, the plan shape is heading toward where we would like to be. Each partition number from the system table results in a per-partition scan of T1 and T2, a one-to-many Merge Join, and a Stream Aggregate to compute the partial counts. The final Stream Aggregate just sums the partial counts. Execution time for this query is around 3,500ms, with the same IO statistics as always. This compares favourably with 5,000ms for the serial plan produced by the optimizer with the OPTION (MERGE JOIN) hint. This is another case of the sum of the parts being less than the whole – summing 41 partial counts from 41 single-partition merge joins is faster than a single merge join and count over all partitions. Even so, this single-threaded collocated merge join is not as quick as the original parallel hash join plan, which executed in 2,600ms. On the positive side, our collocated merge join uses only one logical processor and requires no memory grant. The parallel hash join plan used 16 threads and reserved 569 MB of memory:   Using a Temporary Table Our collocated merge join plan should benefit from parallelism. The reason parallelism is not being used is that the query references a system table. We can work around that by writing the partition numbers to a temporary table (or table variable): SET STATISTICS IO ON; DECLARE @s datetime2 = SYSUTCDATETIME();   CREATE TABLE #P ( partition_number integer PRIMARY KEY);   INSERT #P (partition_number) SELECT p.partition_number FROM sys.partitions AS p WHERE p.[object_id] = OBJECT_ID(N'T1', N'U') AND p.index_id = 1;   SELECT row_count = SUM(Subtotals.cnt) FROM #P AS p CROSS APPLY ( SELECT cnt = COUNT_BIG(*) FROM dbo.T1 AS T1 JOIN dbo.T2 AS T2 ON T2.TID = T1.TID WHERE $PARTITION.PFT(T1.TID) = p.partition_number AND $PARTITION.PFT(T2.TID) = p.partition_number ) AS SubTotals;   DROP TABLE #P;   SELECT DATEDIFF(Millisecond, @s, SYSUTCDATETIME()); SET STATISTICS IO OFF; Using the temporary table adds a few logical reads, but the overall execution time is still around 3500ms, indistinguishable from the same query without the temporary table. The problem is that the query optimizer still doesn’t choose a parallel plan for this query, though the removal of the system table reference means that it could if it chose to: In fact the optimizer did enter the parallel plan phase of query optimization (running search 1 for a second time): Unfortunately, the parallel plan found seemed to be more expensive than the serial plan. This is a crazy result, caused by the optimizer’s cost model not reducing operator CPU costs on the inner side of a nested loops join. Don’t get me started on that, we’ll be here all night. In this plan, everything expensive happens on the inner side of a nested loops join. Without a CPU cost reduction to compensate for the added cost of exchange operators, candidate parallel plans always look more expensive to the optimizer than the equivalent serial plan. Parallel Collocated Merge Join We can produce the desired parallel plan using trace flag 8649 again: SELECT row_count = SUM(Subtotals.cnt) FROM #P AS p CROSS APPLY ( SELECT cnt = COUNT_BIG(*) FROM dbo.T1 AS T1 JOIN dbo.T2 AS T2 ON T2.TID = T1.TID WHERE $PARTITION.PFT(T1.TID) = p.partition_number AND $PARTITION.PFT(T2.TID) = p.partition_number ) AS SubTotals OPTION (QUERYTRACEON 8649); The actual execution plan is: One difference between this plan and the collocated hash join plan is that a Repartition Streams exchange operator is used instead of Distribute Streams. The effect is similar, though not quite identical. The Repartition uses round-robin partitioning, meaning the next partition id is pushed to the next thread in sequence. The Distribute Streams exchange seen earlier used Demand partitioning, meaning the next partition id is pulled across the exchange by the next thread that is ready for more work. There are subtle performance implications for each partitioning option, but going into that would again take us too far off the main point of this post. Performance The important thing is the performance of this parallel collocated merge join – just 1350ms on a typical run. The list below shows all the alternatives from this post (all timings include creation, population, and deletion of the temporary table where appropriate) from quickest to slowest: Collocated parallel merge join: 1350ms Parallel hash join: 2600ms Collocated serial merge join: 3500ms Serial merge join: 5000ms Parallel merge join: 8400ms Collated parallel hash join: 25,300ms (hash spill per partition) The parallel collocated merge join requires no memory grant (aside from a paltry 1.2MB used for exchange buffers). This plan uses 16 threads at DOP 8; but 8 of those are (rather pointlessly) allocated to the parallel scan of the temporary table. These are minor concerns, but it turns out there is a way to address them if it bothers you. Parallel Collocated Merge Join with Demand Partitioning This final tweak replaces the temporary table with a hard-coded list of partition ids (dynamic SQL could be used to generate this query from sys.partitions): SELECT row_count = SUM(Subtotals.cnt) FROM ( VALUES (1),(2),(3),(4),(5),(6),(7),(8),(9),(10), (11),(12),(13),(14),(15),(16),(17),(18),(19),(20), (21),(22),(23),(24),(25),(26),(27),(28),(29),(30), (31),(32),(33),(34),(35),(36),(37),(38),(39),(40),(41) ) AS P (partition_number) CROSS APPLY ( SELECT cnt = COUNT_BIG(*) FROM dbo.T1 AS T1 JOIN dbo.T2 AS T2 ON T2.TID = T1.TID WHERE $PARTITION.PFT(T1.TID) = p.partition_number AND $PARTITION.PFT(T2.TID) = p.partition_number ) AS SubTotals OPTION (QUERYTRACEON 8649); The actual execution plan is: The parallel collocated hash join plan is reproduced below for comparison: The manual rewrite has another advantage that has not been mentioned so far: the partial counts (per partition) can be computed earlier than the partial counts (per thread) in the optimizer’s collocated join plan. The earlier aggregation is performed by the extra Stream Aggregate under the nested loops join. The performance of the parallel collocated merge join is unchanged at around 1350ms. Final Words It is a shame that the current query optimizer does not consider a collocated merge join (Connect item closed as Won’t Fix). The example used in this post showed an improvement in execution time from 2600ms to 1350ms using a modestly-sized data set and limited parallelism. In addition, the memory requirement for the query was almost completely eliminated  – down from 569MB to 1.2MB. The problem with the parallel hash join selected by the optimizer is that it attempts to process the full data set all at once (albeit using eight threads). It requires a large memory grant to hold all 5 million rows from table T1 across the eight hash tables, and does not take advantage of the divide-and-conquer opportunity offered by the common partitioning. The great thing about the collocated join strategies is that each parallel thread works on a single partition from both tables, reading rows, performing the join, and computing a per-partition subtotal, before moving on to a new partition. From a thread’s point of view… If you have trouble visualizing what is happening from just looking at the parallel collocated merge join execution plan, let’s look at it again, but from the point of view of just one thread operating between the two Parallelism (exchange) operators. Our thread picks up a single partition id from the Distribute Streams exchange, and starts a merge join using ordered rows from partition 1 of table T1 and partition 1 of table T2. By definition, this is all happening on a single thread. As rows join, they are added to a (per-partition) count in the Stream Aggregate immediately above the Merge Join. Eventually, either T1 (partition 1) or T2 (partition 1) runs out of rows and the merge join stops. The per-partition count from the aggregate passes on through the Nested Loops join to another Stream Aggregate, which is maintaining a per-thread subtotal. Our same thread now picks up a new partition id from the exchange (say it gets id 9 this time). The count in the per-partition aggregate is reset to zero, and the processing of partition 9 of both tables proceeds just as it did for partition 1, and on the same thread. Each thread picks up a single partition id and processes all the data for that partition, completely independently from other threads working on other partitions. One thread might eventually process partitions (1, 9, 17, 25, 33, 41) while another is concurrently processing partitions (2, 10, 18, 26, 34) and so on for the other six threads at DOP 8. The point is that all 8 threads can execute independently and concurrently, continuing to process new partitions until the wider job (of which the thread has no knowledge!) is done. This divide-and-conquer technique can be much more efficient than simply splitting the entire workload across eight threads all at once. Related Reading Understanding and Using Parallelism in SQL Server Parallel Execution Plans Suck © 2013 Paul White – All Rights Reserved Twitter: @SQL_Kiwi

    Read the article

  • A Taxonomy of Numerical Methods v1

    - by JoshReuben
    Numerical Analysis – When, What, (but not how) Once you understand the Math & know C++, Numerical Methods are basically blocks of iterative & conditional math code. I found the real trick was seeing the forest for the trees – knowing which method to use for which situation. Its pretty easy to get lost in the details – so I’ve tried to organize these methods in a way that I can quickly look this up. I’ve included links to detailed explanations and to C++ code examples. I’ve tried to classify Numerical methods in the following broad categories: Solving Systems of Linear Equations Solving Non-Linear Equations Iteratively Interpolation Curve Fitting Optimization Numerical Differentiation & Integration Solving ODEs Boundary Problems Solving EigenValue problems Enjoy – I did ! Solving Systems of Linear Equations Overview Solve sets of algebraic equations with x unknowns The set is commonly in matrix form Gauss-Jordan Elimination http://en.wikipedia.org/wiki/Gauss%E2%80%93Jordan_elimination C++: http://www.codekeep.net/snippets/623f1923-e03c-4636-8c92-c9dc7aa0d3c0.aspx Produces solution of the equations & the coefficient matrix Efficient, stable 2 steps: · Forward Elimination – matrix decomposition: reduce set to triangular form (0s below the diagonal) or row echelon form. If degenerate, then there is no solution · Backward Elimination –write the original matrix as the product of ints inverse matrix & its reduced row-echelon matrix à reduce set to row canonical form & use back-substitution to find the solution to the set Elementary ops for matrix decomposition: · Row multiplication · Row switching · Add multiples of rows to other rows Use pivoting to ensure rows are ordered for achieving triangular form LU Decomposition http://en.wikipedia.org/wiki/LU_decomposition C++: http://ganeshtiwaridotcomdotnp.blogspot.co.il/2009/12/c-c-code-lu-decomposition-for-solving.html Represent the matrix as a product of lower & upper triangular matrices A modified version of GJ Elimination Advantage – can easily apply forward & backward elimination to solve triangular matrices Techniques: · Doolittle Method – sets the L matrix diagonal to unity · Crout Method - sets the U matrix diagonal to unity Note: both the L & U matrices share the same unity diagonal & can be stored compactly in the same matrix Gauss-Seidel Iteration http://en.wikipedia.org/wiki/Gauss%E2%80%93Seidel_method C++: http://www.nr.com/forum/showthread.php?t=722 Transform the linear set of equations into a single equation & then use numerical integration (as integration formulas have Sums, it is implemented iteratively). an optimization of Gauss-Jacobi: 1.5 times faster, requires 0.25 iterations to achieve the same tolerance Solving Non-Linear Equations Iteratively find roots of polynomials – there may be 0, 1 or n solutions for an n order polynomial use iterative techniques Iterative methods · used when there are no known analytical techniques · Requires set functions to be continuous & differentiable · Requires an initial seed value – choice is critical to convergence à conduct multiple runs with different starting points & then select best result · Systematic - iterate until diminishing returns, tolerance or max iteration conditions are met · bracketing techniques will always yield convergent solutions, non-bracketing methods may fail to converge Incremental method if a nonlinear function has opposite signs at 2 ends of a small interval x1 & x2, then there is likely to be a solution in their interval – solutions are detected by evaluating a function over interval steps, for a change in sign, adjusting the step size dynamically. Limitations – can miss closely spaced solutions in large intervals, cannot detect degenerate (coinciding) solutions, limited to functions that cross the x-axis, gives false positives for singularities Fixed point method http://en.wikipedia.org/wiki/Fixed-point_iteration C++: http://books.google.co.il/books?id=weYj75E_t6MC&pg=PA79&lpg=PA79&dq=fixed+point+method++c%2B%2B&source=bl&ots=LQ-5P_taoC&sig=lENUUIYBK53tZtTwNfHLy5PEWDk&hl=en&sa=X&ei=wezDUPW1J5DptQaMsIHQCw&redir_esc=y#v=onepage&q=fixed%20point%20method%20%20c%2B%2B&f=false Algebraically rearrange a solution to isolate a variable then apply incremental method Bisection method http://en.wikipedia.org/wiki/Bisection_method C++: http://numericalcomputing.wordpress.com/category/algorithms/ Bracketed - Select an initial interval, keep bisecting it ad midpoint into sub-intervals and then apply incremental method on smaller & smaller intervals – zoom in Adv: unaffected by function gradient à reliable Disadv: slow convergence False Position Method http://en.wikipedia.org/wiki/False_position_method C++: http://www.dreamincode.net/forums/topic/126100-bisection-and-false-position-methods/ Bracketed - Select an initial interval , & use the relative value of function at interval end points to select next sub-intervals (estimate how far between the end points the solution might be & subdivide based on this) Newton-Raphson method http://en.wikipedia.org/wiki/Newton's_method C++: http://www-users.cselabs.umn.edu/classes/Summer-2012/csci1113/index.php?page=./newt3 Also known as Newton's method Convenient, efficient Not bracketed – only a single initial guess is required to start iteration – requires an analytical expression for the first derivative of the function as input. Evaluates the function & its derivative at each step. Can be extended to the Newton MutiRoot method for solving multiple roots Can be easily applied to an of n-coupled set of non-linear equations – conduct a Taylor Series expansion of a function, dropping terms of order n, rewrite as a Jacobian matrix of PDs & convert to simultaneous linear equations !!! Secant Method http://en.wikipedia.org/wiki/Secant_method C++: http://forum.vcoderz.com/showthread.php?p=205230 Unlike N-R, can estimate first derivative from an initial interval (does not require root to be bracketed) instead of inputting it Since derivative is approximated, may converge slower. Is fast in practice as it does not have to evaluate the derivative at each step. Similar implementation to False Positive method Birge-Vieta Method http://mat.iitm.ac.in/home/sryedida/public_html/caimna/transcendental/polynomial%20methods/bv%20method.html C++: http://books.google.co.il/books?id=cL1boM2uyQwC&pg=SA3-PA51&lpg=SA3-PA51&dq=Birge-Vieta+Method+c%2B%2B&source=bl&ots=QZmnDTK3rC&sig=BPNcHHbpR_DKVoZXrLi4nVXD-gg&hl=en&sa=X&ei=R-_DUK2iNIjzsgbE5ID4Dg&redir_esc=y#v=onepage&q=Birge-Vieta%20Method%20c%2B%2B&f=false combines Horner's method of polynomial evaluation (transforming into lesser degree polynomials that are more computationally efficient to process) with Newton-Raphson to provide a computational speed-up Interpolation Overview Construct new data points for as close as possible fit within range of a discrete set of known points (that were obtained via sampling, experimentation) Use Taylor Series Expansion of a function f(x) around a specific value for x Linear Interpolation http://en.wikipedia.org/wiki/Linear_interpolation C++: http://www.hamaluik.com/?p=289 Straight line between 2 points à concatenate interpolants between each pair of data points Bilinear Interpolation http://en.wikipedia.org/wiki/Bilinear_interpolation C++: http://supercomputingblog.com/graphics/coding-bilinear-interpolation/2/ Extension of the linear function for interpolating functions of 2 variables – perform linear interpolation first in 1 direction, then in another. Used in image processing – e.g. texture mapping filter. Uses 4 vertices to interpolate a value within a unit cell. Lagrange Interpolation http://en.wikipedia.org/wiki/Lagrange_polynomial C++: http://www.codecogs.com/code/maths/approximation/interpolation/lagrange.php For polynomials Requires recomputation for all terms for each distinct x value – can only be applied for small number of nodes Numerically unstable Barycentric Interpolation http://epubs.siam.org/doi/pdf/10.1137/S0036144502417715 C++: http://www.gamedev.net/topic/621445-barycentric-coordinates-c-code-check/ Rearrange the terms in the equation of the Legrange interpolation by defining weight functions that are independent of the interpolated value of x Newton Divided Difference Interpolation http://en.wikipedia.org/wiki/Newton_polynomial C++: http://jee-appy.blogspot.co.il/2011/12/newton-divided-difference-interpolation.html Hermite Divided Differences: Interpolation polynomial approximation for a given set of data points in the NR form - divided differences are used to approximately calculate the various differences. For a given set of 3 data points , fit a quadratic interpolant through the data Bracketed functions allow Newton divided differences to be calculated recursively Difference table Cubic Spline Interpolation http://en.wikipedia.org/wiki/Spline_interpolation C++: https://www.marcusbannerman.co.uk/index.php/home/latestarticles/42-articles/96-cubic-spline-class.html Spline is a piecewise polynomial Provides smoothness – for interpolations with significantly varying data Use weighted coefficients to bend the function to be smooth & its 1st & 2nd derivatives are continuous through the edge points in the interval Curve Fitting A generalization of interpolating whereby given data points may contain noise à the curve does not necessarily pass through all the points Least Squares Fit http://en.wikipedia.org/wiki/Least_squares C++: http://www.ccas.ru/mmes/educat/lab04k/02/least-squares.c Residual – difference between observed value & expected value Model function is often chosen as a linear combination of the specified functions Determines: A) The model instance in which the sum of squared residuals has the least value B) param values for which model best fits data Straight Line Fit Linear correlation between independent variable and dependent variable Linear Regression http://en.wikipedia.org/wiki/Linear_regression C++: http://www.oocities.org/david_swaim/cpp/linregc.htm Special case of statistically exact extrapolation Leverage least squares Given a basis function, the sum of the residuals is determined and the corresponding gradient equation is expressed as a set of normal linear equations in matrix form that can be solved (e.g. using LU Decomposition) Can be weighted - Drop the assumption that all errors have the same significance –-> confidence of accuracy is different for each data point. Fit the function closer to points with higher weights Polynomial Fit - use a polynomial basis function Moving Average http://en.wikipedia.org/wiki/Moving_average C++: http://www.codeproject.com/Articles/17860/A-Simple-Moving-Average-Algorithm Used for smoothing (cancel fluctuations to highlight longer-term trends & cycles), time series data analysis, signal processing filters Replace each data point with average of neighbors. Can be simple (SMA), weighted (WMA), exponential (EMA). Lags behind latest data points – extra weight can be given to more recent data points. Weights can decrease arithmetically or exponentially according to distance from point. Parameters: smoothing factor, period, weight basis Optimization Overview Given function with multiple variables, find Min (or max by minimizing –f(x)) Iterative approach Efficient, but not necessarily reliable Conditions: noisy data, constraints, non-linear models Detection via sign of first derivative - Derivative of saddle points will be 0 Local minima Bisection method Similar method for finding a root for a non-linear equation Start with an interval that contains a minimum Golden Search method http://en.wikipedia.org/wiki/Golden_section_search C++: http://www.codecogs.com/code/maths/optimization/golden.php Bisect intervals according to golden ratio 0.618.. Achieves reduction by evaluating a single function instead of 2 Newton-Raphson Method Brent method http://en.wikipedia.org/wiki/Brent's_method C++: http://people.sc.fsu.edu/~jburkardt/cpp_src/brent/brent.cpp Based on quadratic or parabolic interpolation – if the function is smooth & parabolic near to the minimum, then a parabola fitted through any 3 points should approximate the minima – fails when the 3 points are collinear , in which case the denominator is 0 Simplex Method http://en.wikipedia.org/wiki/Simplex_algorithm C++: http://www.codeguru.com/cpp/article.php/c17505/Simplex-Optimization-Algorithm-and-Implemetation-in-C-Programming.htm Find the global minima of any multi-variable function Direct search – no derivatives required At each step it maintains a non-degenerative simplex – a convex hull of n+1 vertices. Obtains the minimum for a function with n variables by evaluating the function at n-1 points, iteratively replacing the point of worst result with the point of best result, shrinking the multidimensional simplex around the best point. Point replacement involves expanding & contracting the simplex near the worst value point to determine a better replacement point Oscillation can be avoided by choosing the 2nd worst result Restart if it gets stuck Parameters: contraction & expansion factors Simulated Annealing http://en.wikipedia.org/wiki/Simulated_annealing C++: http://code.google.com/p/cppsimulatedannealing/ Analogy to heating & cooling metal to strengthen its structure Stochastic method – apply random permutation search for global minima - Avoid entrapment in local minima via hill climbing Heating schedule - Annealing schedule params: temperature, iterations at each temp, temperature delta Cooling schedule – can be linear, step-wise or exponential Differential Evolution http://en.wikipedia.org/wiki/Differential_evolution C++: http://www.amichel.com/de/doc/html/ More advanced stochastic methods analogous to biological processes: Genetic algorithms, evolution strategies Parallel direct search method against multiple discrete or continuous variables Initial population of variable vectors chosen randomly – if weighted difference vector of 2 vectors yields a lower objective function value then it replaces the comparison vector Many params: #parents, #variables, step size, crossover constant etc Convergence is slow – many more function evaluations than simulated annealing Numerical Differentiation Overview 2 approaches to finite difference methods: · A) approximate function via polynomial interpolation then differentiate · B) Taylor series approximation – additionally provides error estimate Finite Difference methods http://en.wikipedia.org/wiki/Finite_difference_method C++: http://www.wpi.edu/Pubs/ETD/Available/etd-051807-164436/unrestricted/EAMPADU.pdf Find differences between high order derivative values - Approximate differential equations by finite differences at evenly spaced data points Based on forward & backward Taylor series expansion of f(x) about x plus or minus multiples of delta h. Forward / backward difference - the sums of the series contains even derivatives and the difference of the series contains odd derivatives – coupled equations that can be solved. Provide an approximation of the derivative within a O(h^2) accuracy There is also central difference & extended central difference which has a O(h^4) accuracy Richardson Extrapolation http://en.wikipedia.org/wiki/Richardson_extrapolation C++: http://mathscoding.blogspot.co.il/2012/02/introduction-richardson-extrapolation.html A sequence acceleration method applied to finite differences Fast convergence, high accuracy O(h^4) Derivatives via Interpolation Cannot apply Finite Difference method to discrete data points at uneven intervals – so need to approximate the derivative of f(x) using the derivative of the interpolant via 3 point Lagrange Interpolation Note: the higher the order of the derivative, the lower the approximation precision Numerical Integration Estimate finite & infinite integrals of functions More accurate procedure than numerical differentiation Use when it is not possible to obtain an integral of a function analytically or when the function is not given, only the data points are Newton Cotes Methods http://en.wikipedia.org/wiki/Newton%E2%80%93Cotes_formulas C++: http://www.siafoo.net/snippet/324 For equally spaced data points Computationally easy – based on local interpolation of n rectangular strip areas that is piecewise fitted to a polynomial to get the sum total area Evaluate the integrand at n+1 evenly spaced points – approximate definite integral by Sum Weights are derived from Lagrange Basis polynomials Leverage Trapezoidal Rule for default 2nd formulas, Simpson 1/3 Rule for substituting 3 point formulas, Simpson 3/8 Rule for 4 point formulas. For 4 point formulas use Bodes Rule. Higher orders obtain more accurate results Trapezoidal Rule uses simple area, Simpsons Rule replaces the integrand f(x) with a quadratic polynomial p(x) that uses the same values as f(x) for its end points, but adds a midpoint Romberg Integration http://en.wikipedia.org/wiki/Romberg's_method C++: http://code.google.com/p/romberg-integration/downloads/detail?name=romberg.cpp&can=2&q= Combines trapezoidal rule with Richardson Extrapolation Evaluates the integrand at equally spaced points The integrand must have continuous derivatives Each R(n,m) extrapolation uses a higher order integrand polynomial replacement rule (zeroth starts with trapezoidal) à a lower triangular matrix set of equation coefficients where the bottom right term has the most accurate approximation. The process continues until the difference between 2 successive diagonal terms becomes sufficiently small. Gaussian Quadrature http://en.wikipedia.org/wiki/Gaussian_quadrature C++: http://www.alglib.net/integration/gaussianquadratures.php Data points are chosen to yield best possible accuracy – requires fewer evaluations Ability to handle singularities, functions that are difficult to evaluate The integrand can include a weighting function determined by a set of orthogonal polynomials. Points & weights are selected so that the integrand yields the exact integral if f(x) is a polynomial of degree <= 2n+1 Techniques (basically different weighting functions): · Gauss-Legendre Integration w(x)=1 · Gauss-Laguerre Integration w(x)=e^-x · Gauss-Hermite Integration w(x)=e^-x^2 · Gauss-Chebyshev Integration w(x)= 1 / Sqrt(1-x^2) Solving ODEs Use when high order differential equations cannot be solved analytically Evaluated under boundary conditions RK for systems – a high order differential equation can always be transformed into a coupled first order system of equations Euler method http://en.wikipedia.org/wiki/Euler_method C++: http://rosettacode.org/wiki/Euler_method First order Runge–Kutta method. Simple recursive method – given an initial value, calculate derivative deltas. Unstable & not very accurate (O(h) error) – not used in practice A first-order method - the local error (truncation error per step) is proportional to the square of the step size, and the global error (error at a given time) is proportional to the step size In evolving solution between data points xn & xn+1, only evaluates derivatives at beginning of interval xn à asymmetric at boundaries Higher order Runge Kutta http://en.wikipedia.org/wiki/Runge%E2%80%93Kutta_methods C++: http://www.dreamincode.net/code/snippet1441.htm 2nd & 4th order RK - Introduces parameterized midpoints for more symmetric solutions à accuracy at higher computational cost Adaptive RK – RK-Fehlberg – estimate the truncation at each integration step & automatically adjust the step size to keep error within prescribed limits. At each step 2 approximations are compared – if in disagreement to a specific accuracy, the step size is reduced Boundary Value Problems Where solution of differential equations are located at 2 different values of the independent variable x à more difficult, because cannot just start at point of initial value – there may not be enough starting conditions available at the end points to produce a unique solution An n-order equation will require n boundary conditions – need to determine the missing n-1 conditions which cause the given conditions at the other boundary to be satisfied Shooting Method http://en.wikipedia.org/wiki/Shooting_method C++: http://ganeshtiwaridotcomdotnp.blogspot.co.il/2009/12/c-c-code-shooting-method-for-solving.html Iteratively guess the missing values for one end & integrate, then inspect the discrepancy with the boundary values of the other end to adjust the estimate Given the starting boundary values u1 & u2 which contain the root u, solve u given the false position method (solving the differential equation as an initial value problem via 4th order RK), then use u to solve the differential equations. Finite Difference Method For linear & non-linear systems Higher order derivatives require more computational steps – some combinations for boundary conditions may not work though Improve the accuracy by increasing the number of mesh points Solving EigenValue Problems An eigenvalue can substitute a matrix when doing matrix multiplication à convert matrix multiplication into a polynomial EigenValue For a given set of equations in matrix form, determine what are the solution eigenvalue & eigenvectors Similar Matrices - have same eigenvalues. Use orthogonal similarity transforms to reduce a matrix to diagonal form from which eigenvalue(s) & eigenvectors can be computed iteratively Jacobi method http://en.wikipedia.org/wiki/Jacobi_method C++: http://people.sc.fsu.edu/~jburkardt/classes/acs2_2008/openmp/jacobi/jacobi.html Robust but Computationally intense – use for small matrices < 10x10 Power Iteration http://en.wikipedia.org/wiki/Power_iteration For any given real symmetric matrix, generate the largest single eigenvalue & its eigenvectors Simplest method – does not compute matrix decomposition à suitable for large, sparse matrices Inverse Iteration Variation of power iteration method – generates the smallest eigenvalue from the inverse matrix Rayleigh Method http://en.wikipedia.org/wiki/Rayleigh's_method_of_dimensional_analysis Variation of power iteration method Rayleigh Quotient Method Variation of inverse iteration method Matrix Tri-diagonalization Method Use householder algorithm to reduce an NxN symmetric matrix to a tridiagonal real symmetric matrix vua N-2 orthogonal transforms     Whats Next Outside of Numerical Methods there are lots of different types of algorithms that I’ve learned over the decades: Data Mining – (I covered this briefly in a previous post: http://geekswithblogs.net/JoshReuben/archive/2007/12/31/ssas-dm-algorithms.aspx ) Search & Sort Routing Problem Solving Logical Theorem Proving Planning Probabilistic Reasoning Machine Learning Solvers (eg MIP) Bioinformatics (Sequence Alignment, Protein Folding) Quant Finance (I read Wilmott’s books – interesting) Sooner or later, I’ll cover the above topics as well.

    Read the article

  • An Introduction to Meteor

    - by Stephen.Walther
    The goal of this blog post is to give you a brief introduction to Meteor which is a framework for building Single Page Apps. In this blog entry, I provide a walkthrough of building a simple Movie database app. What is special about Meteor? Meteor has two jaw-dropping features: Live HTML – If you make any changes to the HTML, CSS, JavaScript, or data on the server then every client shows the changes automatically without a browser refresh. For example, if you change the background color of a page to yellow then every open browser will show the new yellow background color without a refresh. Or, if you add a new movie to a collection of movies, then every open browser will display the new movie automatically. With Live HTML, users no longer need a refresh button. Changes to an application happen everywhere automatically without any effort. The Meteor framework handles all of the messy details of keeping all of the clients in sync with the server for you. Latency Compensation – When you modify data on the client, these modifications appear as if they happened on the server without any delay. For example, if you create a new movie then the movie appears instantly. However, that is all an illusion. In the background, Meteor updates the database with the new movie. If, for whatever reason, the movie cannot be added to the database then Meteor removes the movie from the client automatically. Latency compensation is extremely important for creating a responsive web application. You want the user to be able to make instant modifications in the browser and the framework to handle the details of updating the database without slowing down the user. Installing Meteor Meteor is licensed under the open-source MIT license and you can start building production apps with the framework right now. Be warned that Meteor is still in the “early preview” stage. It has not reached a 1.0 release. According to the Meteor FAQ, Meteor will reach version 1.0 in “More than a month, less than a year.” Don’t be scared away by that. You should be aware that, unlike most open source projects, Meteor has financial backing. The Meteor project received an $11.2 million round of financing from Andreessen Horowitz. So, it would be a good bet that this project will reach the 1.0 mark. And, if it doesn’t, the framework as it exists right now is still very powerful. Meteor runs on top of Node.js. You write Meteor apps by writing JavaScript which runs both on the client and on the server. You can build Meteor apps on Windows, Mac, or Linux (Although the support for Windows is still officially unofficial). If you want to install Meteor on Windows then download the MSI from the following URL: http://win.meteor.com/ If you want to install Meteor on Mac/Linux then run the following CURL command from your terminal: curl https://install.meteor.com | /bin/sh Meteor will install all of its dependencies automatically including Node.js. However, I recommend that you install Node.js before installing Meteor by installing Node.js from the following address: http://nodejs.org/ If you let Meteor install Node.js then Meteor won’t install NPM which is the standard package manager for Node.js. If you install Node.js and then you install Meteor then you get NPM automatically. Creating a New Meteor App To get a sense of how Meteor works, I am going to walk through the steps required to create a simple Movie database app. Our app will display a list of movies and contain a form for creating a new movie. The first thing that we need to do is create our new Meteor app. Open a command prompt/terminal window and execute the following command: Meteor create MovieApp After you execute this command, you should see something like the following: Follow the instructions: execute cd MovieApp to change to your MovieApp directory, and run the meteor command. Executing the meteor command starts Meteor on port 3000. Open up your favorite web browser and navigate to http://localhost:3000 and you should see the default Meteor Hello World page: Open up your favorite development environment to see what the Meteor app looks like. Open the MovieApp folder which we just created. Here’s what the MovieApp looks like in Visual Studio 2012: Notice that our MovieApp contains three files named MovieApp.css, MovieApp.html, and MovieApp.js. In other words, it contains a Cascading Style Sheet file, an HTML file, and a JavaScript file. Just for fun, let’s see how the Live HTML feature works. Open up multiple browsers and point each browser at http://localhost:3000. Now, open the MovieApp.html page and modify the text “Hello World!” to “Hello Cruel World!” and save the change. The text in all of the browsers should update automatically without a browser refresh. Pretty amazing, right? Controlling Where JavaScript Executes You write a Meteor app using JavaScript. Some of the JavaScript executes on the client (the browser) and some of the JavaScript executes on the server and some of the JavaScript executes in both places. For a super simple app, you can use the Meteor.isServer and Meteor.isClient properties to control where your JavaScript code executes. For example, the following JavaScript contains a section of code which executes on the server and a section of code which executes in the browser: if (Meteor.isClient) { console.log("Hello Browser!"); } if (Meteor.isServer) { console.log("Hello Server!"); } console.log("Hello Browser and Server!"); When you run the app, the message “Hello Browser!” is written to the browser JavaScript console. The message “Hello Server!” is written to the command/terminal window where you ran Meteor. Finally, the message “Hello Browser and Server!” is execute on both the browser and server and the message appears in both places. For simple apps, using Meteor.isClient and Meteor.isServer to control where JavaScript executes is fine. For more complex apps, you should create separate folders for your server and client code. Here are the folders which you can use in a Meteor app: · client – This folder contains any JavaScript which executes only on the client. · server – This folder contains any JavaScript which executes only on the server. · common – This folder contains any JavaScript code which executes on both the client and server. · lib – This folder contains any JavaScript files which you want to execute before any other JavaScript files. · public – This folder contains static application assets such as images. For the Movie App, we need the client, server, and common folders. Delete the existing MovieApp.js, MovieApp.html, and MovieApp.css files. We will create new files in the right locations later in this walkthrough. Combining HTML, CSS, and JavaScript Files Meteor combines all of your JavaScript files, and all of your Cascading Style Sheet files, and all of your HTML files automatically. If you want to create one humongous JavaScript file which contains all of the code for your app then that is your business. However, if you want to build a more maintainable application, then you should break your JavaScript files into many separate JavaScript files and let Meteor combine them for you. Meteor also combines all of your HTML files into a single file. HTML files are allowed to have the following top-level elements: <head> — All <head> files are combined into a single <head> and served with the initial page load. <body> — All <body> files are combined into a single <body> and served with the initial page load. <template> — All <template> files are compiled into JavaScript templates. Because you are creating a single page app, a Meteor app typically will contain a single HTML file for the <head> and <body> content. However, a Meteor app typically will contain several template files. In other words, all of the interesting stuff happens within the <template> files. Displaying a List of Movies Let me start building the Movie App by displaying a list of movies. In order to display a list of movies, we need to create the following four files: · client\movies.html – Contains the HTML for the <head> and <body> of the page for the Movie app. · client\moviesTemplate.html – Contains the HTML template for displaying the list of movies. · client\movies.js – Contains the JavaScript for supplying data to the moviesTemplate. · server\movies.js – Contains the JavaScript for seeding the database with movies. After you create these files, your folder structure should looks like this: Here’s what the client\movies.html file looks like: <head> <title>My Movie App</title> </head> <body> <h1>Movies</h1> {{> moviesTemplate }} </body>   Notice that it contains <head> and <body> top-level elements. The <body> element includes the moviesTemplate with the syntax {{> moviesTemplate }}. The moviesTemplate is defined in the client/moviesTemplate.html file: <template name="moviesTemplate"> <ul> {{#each movies}} <li> {{title}} </li> {{/each}} </ul> </template> By default, Meteor uses the Handlebars templating library. In the moviesTemplate above, Handlebars is used to loop through each of the movies using {{#each}}…{{/each}} and display the title for each movie using {{title}}. The client\movies.js JavaScript file is used to bind the moviesTemplate to the Movies collection on the client. Here’s what this JavaScript file looks like: // Declare client Movies collection Movies = new Meteor.Collection("movies"); // Bind moviesTemplate to Movies collection Template.moviesTemplate.movies = function () { return Movies.find(); }; The Movies collection is a client-side proxy for the server-side Movies database collection. Whenever you want to interact with the collection of Movies stored in the database, you use the Movies collection instead of communicating back to the server. The moviesTemplate is bound to the Movies collection by assigning a function to the Template.moviesTemplate.movies property. The function simply returns all of the movies from the Movies collection. The final file which we need is the server-side server\movies.js file: // Declare server Movies collection Movies = new Meteor.Collection("movies"); // Seed the movie database with a few movies Meteor.startup(function () { if (Movies.find().count() == 0) { Movies.insert({ title: "Star Wars", director: "Lucas" }); Movies.insert({ title: "Memento", director: "Nolan" }); Movies.insert({ title: "King Kong", director: "Jackson" }); } }); The server\movies.js file does two things. First, it declares the server-side Meteor Movies collection. When you declare a server-side Meteor collection, a collection is created in the MongoDB database associated with your Meteor app automatically (Meteor uses MongoDB as its database automatically). Second, the server\movies.js file seeds the Movies collection (MongoDB collection) with three movies. Seeding the database gives us some movies to look at when we open the Movies app in a browser. Creating New Movies Let me modify the Movies Database App so that we can add new movies to the database of movies. First, I need to create a new template file – named client\movieForm.html – which contains an HTML form for creating a new movie: <template name="movieForm"> <fieldset> <legend>Add New Movie</legend> <form> <div> <label> Title: <input id="title" /> </label> </div> <div> <label> Director: <input id="director" /> </label> </div> <div> <input type="submit" value="Add Movie" /> </div> </form> </fieldset> </template> In order for the new form to show up, I need to modify the client\movies.html file to include the movieForm.html template. Notice that I added {{> movieForm }} to the client\movies.html file: <head> <title>My Movie App</title> </head> <body> <h1>Movies</h1> {{> moviesTemplate }} {{> movieForm }} </body> After I make these modifications, our Movie app will display the form: The next step is to handle the submit event for the movie form. Below, I’ve modified the client\movies.js file so that it contains a handler for the submit event raised when you submit the form contained in the movieForm.html template: // Declare client Movies collection Movies = new Meteor.Collection("movies"); // Bind moviesTemplate to Movies collection Template.moviesTemplate.movies = function () { return Movies.find(); }; // Handle movieForm events Template.movieForm.events = { 'submit': function (e, tmpl) { // Don't postback e.preventDefault(); // create the new movie var newMovie = { title: tmpl.find("#title").value, director: tmpl.find("#director").value }; // add the movie to the db Movies.insert(newMovie); } }; The Template.movieForm.events property contains an event map which maps event names to handlers. In this case, I am mapping the form submit event to an anonymous function which handles the event. In the event handler, I am first preventing a postback by calling e.preventDefault(). This is a single page app, no postbacks are allowed! Next, I am grabbing the new movie from the HTML form. I’m taking advantage of the template find() method to retrieve the form field values. Finally, I am calling Movies.insert() to insert the new movie into the Movies collection. Here, I am explicitly inserting the new movie into the client-side Movies collection. Meteor inserts the new movie into the server-side Movies collection behind the scenes. When Meteor inserts the movie into the server-side collection, the new movie is added to the MongoDB database associated with the Movies app automatically. If server-side insertion fails for whatever reasons – for example, your internet connection is lost – then Meteor will remove the movie from the client-side Movies collection automatically. In other words, Meteor takes care of keeping the client Movies collection and the server Movies collection in sync. If you open multiple browsers, and add movies, then you should notice that all of the movies appear on all of the open browser automatically. You don’t need to refresh individual browsers to update the client-side Movies collection. Meteor keeps everything synchronized between the browsers and server for you. Removing the Insecure Module To make it easier to develop and debug a new Meteor app, by default, you can modify the database directly from the client. For example, you can delete all of the data in the database by opening up your browser console window and executing multiple Movies.remove() commands. Obviously, enabling anyone to modify your database from the browser is not a good idea in a production application. Before you make a Meteor app public, you should first run the meteor remove insecure command from a command/terminal window: Running meteor remove insecure removes the insecure package from the Movie app. Unfortunately, it also breaks our Movie app. We’ll get an “Access denied” error in our browser console whenever we try to insert a new movie. No worries. I’ll fix this issue in the next section. Creating Meteor Methods By taking advantage of Meteor Methods, you can create methods which can be invoked on both the client and the server. By taking advantage of Meteor Methods you can: 1. Perform form validation on both the client and the server. For example, even if an evil hacker bypasses your client code, you can still prevent the hacker from submitting an invalid value for a form field by enforcing validation on the server. 2. Simulate database operations on the client but actually perform the operations on the server. Let me show you how we can modify our Movie app so it uses Meteor Methods to insert a new movie. First, we need to create a new file named common\methods.js which contains the definition of our Meteor Methods: Meteor.methods({ addMovie: function (newMovie) { // Perform form validation if (newMovie.title == "") { throw new Meteor.Error(413, "Missing title!"); } if (newMovie.director == "") { throw new Meteor.Error(413, "Missing director!"); } // Insert movie (simulate on client, do it on server) return Movies.insert(newMovie); } }); The addMovie() method is called from both the client and the server. This method does two things. First, it performs some basic validation. If you don’t enter a title or you don’t enter a director then an error is thrown. Second, the addMovie() method inserts the new movie into the Movies collection. When called on the client, inserting the new movie into the Movies collection just updates the collection. When called on the server, inserting the new movie into the Movies collection causes the database (MongoDB) to be updated with the new movie. You must add the common\methods.js file to the common folder so it will get executed on both the client and the server. Our folder structure now looks like this: We actually call the addMovie() method within our client code in the client\movies.js file. Here’s what the updated file looks like: // Declare client Movies collection Movies = new Meteor.Collection("movies"); // Bind moviesTemplate to Movies collection Template.moviesTemplate.movies = function () { return Movies.find(); }; // Handle movieForm events Template.movieForm.events = { 'submit': function (e, tmpl) { // Don't postback e.preventDefault(); // create the new movie var newMovie = { title: tmpl.find("#title").value, director: tmpl.find("#director").value }; // add the movie to the db Meteor.call( "addMovie", newMovie, function (err, result) { if (err) { alert("Could not add movie " + err.reason); } } ); } }; The addMovie() method is called – on both the client and the server – by calling the Meteor.call() method. This method accepts the following parameters: · The string name of the method to call. · The data to pass to the method (You can actually pass multiple params for the data if you like). · A callback function to invoke after the method completes. In the JavaScript code above, the addMovie() method is called with the new movie retrieved from the HTML form. The callback checks for an error. If there is an error then the error reason is displayed in an alert (please don’t use alerts for validation errors in a production app because they are ugly!). Summary The goal of this blog post was to provide you with a brief walk through of a simple Meteor app. I showed you how you can create a simple Movie Database app which enables you to display a list of movies and create new movies. I also explained why it is important to remove the Meteor insecure package from a production app. I showed you how to use Meteor Methods to insert data into the database instead of doing it directly from the client. I’m very impressed with the Meteor framework. The support for Live HTML and Latency Compensation are required features for many real world Single Page Apps but implementing these features by hand is not easy. Meteor makes it easy.

    Read the article

  • Quick guide to Oracle IRM 11g: Classification design

    - by Simon Thorpe
    Quick guide to Oracle IRM 11g indexThis is the final article in the quick guide to Oracle IRM. If you've followed everything prior you will now have a fully functional and tested Information Rights Management service. It doesn't matter if you've been following the 10g or 11g guide as this next article is common to both. ContentsWhy this is the most important part... Understanding the classification and standard rights model Identifying business use cases Creating an effective IRM classification modelOne single classification across the entire businessA context for each and every possible granular use caseWhat makes a good context? Deciding on the use of roles in the context Reviewing the features and security for context roles Summary Why this is the most important part...Now the real work begins, installing and getting an IRM system running is as simple as following instructions. However to actually have an IRM technology easily protecting your most sensitive information without interfering with your users existing daily work flows and be able to scale IRM across the entire business, requires thought into how confidential documents are created, used and distributed. This article is going to give you the information you need to ask the business the right questions so that you can deploy your IRM service successfully. The IRM team here at Oracle have over 10 years of experience in helping customers and it is important you understand the following to be successful in securing access to your most confidential information. Whatever you are trying to secure, be it mergers and acquisitions information, engineering intellectual property, health care documentation or financial reports. No matter what type of user is going to access the information, be they employees, contractors or customers, there are common goals you are always trying to achieve.Securing the content at the earliest point possible and do it automatically. Removing the dependency on the user to decide to secure the content reduces the risk of mistakes significantly and therefore results a more secure deployment. K.I.S.S. (Keep It Simple Stupid) Reduce complexity in the rights/classification model. Oracle IRM lets you make changes to access to documents even after they are secured which allows you to start with a simple model and then introduce complexity once you've understood how the technology is going to be used in the business. After an initial learning period you can review your implementation and start to make informed decisions based on user feedback and administration experience. Clearly communicate to the user, when appropriate, any changes to their existing work practice. You must make every effort to make the transition to sealed content as simple as possible. For external users you must help them understand why you are securing the documents and inform them the value of the technology to both your business and them. Before getting into the detail, I must pay homage to Martin White, Vice President of client services in SealedMedia, the company Oracle acquired and who created Oracle IRM. In the SealedMedia years Martin was involved with every single customer and was key to the design of certain aspects of the IRM technology, specifically the context model we will be discussing here. Listening carefully to customers and understanding the flexibility of the IRM technology, Martin taught me all the skills of helping customers build scalable, effective and simple to use IRM deployments. No matter how well the engineering department designed the software, badly designed and poorly executed projects can result in difficult to use and manage, and ultimately insecure solutions. The advice and information that follows was born with Martin and he's still delivering IRM consulting with customers and can be found at www.thinkers.co.uk. It is from Martin and others that Oracle not only has the most advanced, scalable and usable document security solution on the market, but Oracle and their partners have the most experience in delivering successful document security solutions. Understanding the classification and standard rights model The goal of any successful IRM deployment is to balance the increase in security the technology brings without over complicating the way people use secured content and avoid a significant increase in administration and maintenance. With Oracle it is possible to automate the protection of content, deploy the desktop software transparently and use authentication methods such that users can open newly secured content initially unaware the document is any different to an insecure one. That is until of course they attempt to do something for which they don't have any rights, such as copy and paste to an insecure application or try and print. Central to achieving this objective is creating a classification model that is simple to understand and use but also provides the right level of complexity to meet the business needs. In Oracle IRM the term used for each classification is a "context". A context defines the relationship between.A group of related documents The people that use the documents The roles that these people perform The rights that these people need to perform their role The context is the key to the success of Oracle IRM. It provides the separation of the role and rights of a user from the content itself. Documents are sealed to contexts but none of the rights, user or group information is stored within the content itself. Sealing only places information about the location of the IRM server that sealed it, the context applied to the document and a few other pieces of metadata that pertain only to the document. This important separation of rights from content means that millions of documents can be secured against a single classification and a user needs only one right assigned to be able to access all documents. If you have followed all the previous articles in this guide, you will be ready to start defining contexts to which your sensitive information will be protected. But before you even start with IRM, you need to understand how your own business uses and creates sensitive documents and emails. Identifying business use cases Oracle is able to support multiple classification systems, but usually there is one single initial need for the technology which drives a deployment. This need might be to protect sensitive mergers and acquisitions information, engineering intellectual property, financial documents. For this and every subsequent use case you must understand how users create and work with documents, to who they are distributed and how the recipients should interact with them. A successful IRM deployment should start with one well identified use case (we go through some examples towards the end of this article) and then after letting this use case play out in the business, you learn how your users work with content, how well your communication to the business worked and if the classification system you deployed delivered the right balance. It is at this point you can start rolling the technology out further. Creating an effective IRM classification model Once you have selected the initial use case you will address with IRM, you need to design a classification model that defines the access to secured documents within the use case. In Oracle IRM there is an inbuilt classification system called the "context" model. In Oracle IRM 11g it is possible to extend the server to support any rights classification model, but the majority of users who are not using an application integration (such as Oracle IRM within Oracle Beehive) are likely to be starting out with the built in context model. Before looking at creating a classification system with IRM, it is worth reviewing some recognized standards and methods for creating and implementing security policy. A very useful set of documents are the ISO 17799 guidelines and the SANS security policy templates. First task is to create a context against which documents are to be secured. A context consists of a group of related documents (all top secret engineering research), a list of roles (contributors and readers) which define how users can access documents and a list of users (research engineers) who have been given a role allowing them to interact with sealed content. Before even creating the first context it is wise to decide on a philosophy which will dictate the level of granularity, the question is, where do you start? At a department level? By project? By technology? First consider the two ends of the spectrum... One single classification across the entire business Imagine that instead of having separate contexts, one for engineering intellectual property, one for your financial data, one for human resources personally identifiable information, you create one context for all documents across the entire business. Whilst you may have immediate objections, there are some significant benefits in thinking about considering this. Document security classification decisions are simple. You only have one context to chose from! User provisioning is simple, just make sure everyone has a role in the only context in the business. Administration is very low, if you assign rights to groups from the business user repository you probably never have to touch IRM administration again. There are however some obvious downsides to this model.All users in have access to all IRM secured content. So potentially a sales person could access sensitive mergers and acquisition documents, if they can get their hands on a copy that is. You cannot delegate control of different documents to different parts of the business, this may not satisfy your regulatory requirements for the separation and delegation of duties. Changing a users role affects every single document ever secured. Even though it is very unlikely a business would ever use one single context to secure all their sensitive information, thinking about this scenario raises one very important point. Just having one single context and securing all confidential documents to it, whilst incurring some of the problems detailed above, has one huge value. Once secured, IRM protected content can ONLY be accessed by authorized users. Just think of all the sensitive documents in your business today, imagine if you could ensure that only everyone you trust could open them. Even if an employee lost a laptop or someone accidentally sent an email to the wrong recipient, only the right people could open that file. A context for each and every possible granular use case Now let's think about the total opposite of a single context design. What if you created a context for each and every single defined business need and created multiple contexts within this for each level of granularity? Let's take a use case where we need to protect engineering intellectual property. Imagine we have 6 different engineering groups, and in each we have a research department, a design department and manufacturing. The company information security policy defines 3 levels of information sensitivity... restricted, confidential and top secret. Then let's say that each group and department needs to define access to information from both internal and external users. Finally add into the mix that they want to review the rights model for each context every financial quarter. This would result in a huge amount of contexts. For example, lets just look at the resulting contexts for one engineering group. Q1FY2010 Restricted Internal - Engineering Group 1 - Research Q1FY2010 Restricted Internal - Engineering Group 1 - Design Q1FY2010 Restricted Internal - Engineering Group 1 - Manufacturing Q1FY2010 Restricted External- Engineering Group 1 - Research Q1FY2010 Restricted External - Engineering Group 1 - Design Q1FY2010 Restricted External - Engineering Group 1 - Manufacturing Q1FY2010 Confidential Internal - Engineering Group 1 - Research Q1FY2010 Confidential Internal - Engineering Group 1 - Design Q1FY2010 Confidential Internal - Engineering Group 1 - Manufacturing Q1FY2010 Confidential External - Engineering Group 1 - Research Q1FY2010 Confidential External - Engineering Group 1 - Design Q1FY2010 Confidential External - Engineering Group 1 - Manufacturing Q1FY2010 Top Secret Internal - Engineering Group 1 - Research Q1FY2010 Top Secret Internal - Engineering Group 1 - Design Q1FY2010 Top Secret Internal - Engineering Group 1 - Manufacturing Q1FY2010 Top Secret External - Engineering Group 1 - Research Q1FY2010 Top Secret External - Engineering Group 1 - Design Q1FY2010 Top Secret External - Engineering Group 1 - Manufacturing Now multiply the above by 6 for each engineering group, 18 contexts. You are then creating/reviewing another 18 every 3 months. After a year you've got 72 contexts. What would be the advantages of such a complex classification model? You can satisfy very granular rights requirements, for example only an authorized engineering group 1 researcher can create a top secret report for access internally, and his role will be reviewed on a very frequent basis. Your business may have very complex rights requirements and mapping this directly to IRM may be an obvious exercise. The disadvantages of such a classification model are significant...Huge administrative overhead. Someone in the business must manage, review and administrate each of these contexts. If the engineering group had a single administrator, they would have 72 classifications to reside over each year. From an end users perspective life will be very confusing. Imagine if a user has rights in just 6 of these contexts. They may be able to print content from one but not another, be able to edit content in 2 contexts but not the other 4. Such confusion at the end user level causes frustration and resistance to the use of the technology. Increased synchronization complexity. Imagine a user who after 3 years in the company ends up with over 300 rights in many different contexts across the business. This would result in long synchronization times as the client software updates all your offline rights. Hard to understand who can do what with what. Imagine being the VP of engineering and as part of an internal security audit you are asked the question, "What rights to researchers have to our top secret information?". In this complex model the answer is not simple, it would depend on many roles in many contexts. Of course this example is extreme, but it highlights that trying to build many barriers in your business can result in a nightmare of administration and confusion amongst users. In the real world what we need is a balance of the two. We need to seek an optimum number of contexts. Too many contexts are unmanageable and too few contexts does not give fine enough granularity. What makes a good context? Good context design derives mainly from how well you understand your business requirements to secure access to confidential information. Some customers I have worked with can tell me exactly the documents they wish to secure and know exactly who should be opening them. However there are some customers who know only of the government regulation that requires them to control access to certain types of information, they don't actually know where the documents are, how they are created or understand exactly who should have access. Therefore you need to know how to ask the business the right questions that lead to information which help you define a context. First ask these questions about a set of documentsWhat is the topic? Who are legitimate contributors on this topic? Who are the authorized readership? If the answer to any one of these is significantly different, then it probably merits a separate context. Remember that sealed documents are inherently secure and as such they cannot leak to your competitors, therefore it is better sealed to a broad context than not sealed at all. Simplicity is key here. Always revert to the first extreme example of a single classification, then work towards essential complexity. If there is any doubt, always prefer fewer contexts. Remember, Oracle IRM allows you to change your mind later on. You can implement a design now and continue to change and refine as you learn how the technology is used. It is easy to go from a simple model to a more complex one, it is much harder to take a complex model that is already embedded in the work practice of users and try to simplify it. It is also wise to take a single use case and address this first with the business. Don't try and tackle many different problems from the outset. Do one, learn from the process, refine it and then take what you have learned into the next use case, refine and continue. Once you have a good grasp of the technology and understand how your business will use it, you can then start rolling out the technology wider across the business. Deciding on the use of roles in the context Once you have decided on that first initial use case and a context to create let's look at the details you need to decide upon. For each context, identify; Administrative rolesBusiness owner, the person who makes decisions about who may or may not see content in this context. This is often the person who wanted to use IRM and drove the business purchase. They are the usually the person with the most at risk when sensitive information is lost. Point of contact, the person who will handle requests for access to content. Sometimes the same as the business owner, sometimes a trusted secretary or administrator. Context administrator, the person who will enact the decisions of the Business Owner. Sometimes the point of contact, sometimes a trusted IT person. Document related rolesContributors, the people who create and edit documents in this context. Reviewers, the people who are involved in reviewing documents but are not trusted to secure information to this classification. This role is not always necessary. (See later discussion on Published-work and Work-in-Progress) Readers, the people who read documents from this context. Some people may have several of the roles above, which is fine. What you are trying to do is understand and define how the business interacts with your sensitive information. These roles obviously map directly to roles available in Oracle IRM. Reviewing the features and security for context roles At this point we have decided on a classification of information, understand what roles people in the business will play when administrating this classification and how they will interact with content. The final piece of the puzzle in getting the information for our first context is to look at the permissions people will have to sealed documents. First think why are you protecting the documents in the first place? It is to prevent the loss of leaking of information to the wrong people. To control the information, making sure that people only access the latest versions of documents. You are not using Oracle IRM to prevent unauthorized people from doing legitimate work. This is an important point, with IRM you can erect many barriers to prevent access to content yet too many restrictions and authorized users will often find ways to circumvent using the technology and end up distributing unprotected originals. Because IRM is a security technology, it is easy to get carried away restricting different groups. However I would highly recommend starting with a simple solution with few restrictions. Ensure that everyone who reasonably needs to read documents can do so from the outset. Remember that with Oracle IRM you can change rights to content whenever you wish and tighten security. Always return to the fact that the greatest value IRM brings is that ONLY authorized users can access secured content, remember that simple "one context for the entire business" model. At the start of the deployment you really need to aim for user acceptance and therefore a simple model is more likely to succeed. As time passes and users understand how IRM works you can start to introduce more restrictions and complexity. Another key aspect to focus on is handling exceptions. If you decide on a context model where engineering can only access engineering information, and sales can only access sales data. Act quickly when a sales manager needs legitimate access to a set of engineering documents. Having a quick and effective process for permitting other people with legitimate needs to obtain appropriate access will be rewarded with acceptance from the user community. These use cases can often be satisfied by integrating IRM with a good Identity & Access Management technology which simplifies the process of assigning users the correct business roles. The big print issue... Printing is often an issue of contention, users love to print but the business wants to ensure sensitive information remains in the controlled digital world. There are many cases of physical document loss causing a business pain, it is often overlooked that IRM can help with this issue by limiting the ability to generate physical copies of digital content. However it can be hard to maintain a balance between security and usability when it comes to printing. Consider the following points when deciding about whether to give print rights. Oracle IRM sealed documents can contain watermarks that expose information about the user, time and location of access and the classification of the document. This information would reside in the printed copy making it easier to trace who printed it. Printed documents are slower to distribute in comparison to their digital counterparts, so time sensitive information in printed format may present a lower risk. Print activity is audited, therefore you can monitor and react to users abusing print rights. Summary In summary it is important to think carefully about the way you create your context model. As you ask the business these questions you may get a variety of different requirements. There may be special projects that require a context just for sensitive information created during the lifetime of the project. There may be a department that requires all information in the group is secured and you might have a few senior executives who wish to use IRM to exchange a small number of highly sensitive documents with a very small number of people. Oracle IRM, with its very flexible context classification system, can support all of these use cases. The trick is to introducing the complexity to deliver them at the right level. In another article i'm working on I will go through some examples of how Oracle IRM might map to existing business use cases. But for now, this article covers all the important questions you need to get your IRM service deployed and successfully protecting your most sensitive information.

    Read the article

  • NTFS Corruption: Files created in Linux corrupted when Windows Boots

    - by Logan Mayfield
    I'm getting some file loss and corruption on my Win7/Ubuntu 12.04 dual boot setup. I have a large shared NTFS partition. I have my Windows Docs/Music/etc. directories on that file and have the comparable directors in Linux setup as a sym. link. I'm using ntfs-3g on the linux side of things to manage the ntfs partition. The shared partition is on a logical partition along with my Linux /home / and /swap partitions. The ntfs partition is mounted at boot time via fstab with the following options: ntfs-3g users,nls=utf8,locale=en_US.UTF-8,exec,rw The problem seems to be confined to newly created and recently edited files. I have not see data loss or corruption when creating/editing files in Windows and then moving over to Ubuntu. I've been using the sync command aggressively in Ubuntu to try to ensure everything is getting written to the HDD. I do not use hibernate in Windows so I know it's not the usual missing files due to Hibernation problem. I'm not seeing any mount related issues on dmesg. Most recently I had a set of files related to a LaTeX document go bad. Some of them show up in Ubuntu but I am unable to delete them. In the GUI file browser they are given thumbnails associated with files I created on my last boot of Windows. To be more specific: I created a few png files in Windows. The files corrupted by that Windows boot are associated with running PdfLatex on a file and are not image files. However, two of the corrupted files show up with the thumbnail image of one of the previously mentioned png files. The png files are not in the same directory as the latex files but they are both win the Document Folder tree. I've had sucess with using NTFS for shared data in the past and am hoping there's some quirk here I'm missing and it's not just bad luck. On one hand this appears to be some kind of Windows problem as data loss occurs when I boot to Windows after having worked in Ubuntu for a while. However, I'm assuming it's more on the Ubuntu end as it requires the special NTFS drivers. Edit for more info: This is a Lenovo Thinkpad L430. Purchased new in the last month. So it's a fairly fresh install. Many of the files on the shared partition were copied over from a previous NTFS formatted shared partition on another HDD. As requested: here's a sample chkdsk log. Some of the files its mentioning were files that got deleted off the partition while in Ubuntu. Others were created/edited but not deleted. Checking file system on D: Volume dismounted. All opened handles to this volume are now invalid. Volume label is Files. CHKDSK is verifying files (stage 1 of 3)... Attribute record of type 0x80 and instance tag 0x2 is cross linked starting at 0x789f47 for possibly 0x21 clusters. Some clusters occupied by attribute of type 0x80 and instance tag 0x2 in file 0x42 is already in use. Deleting corrupt attribute record (128, "") from file record segment 66. 86496 file records processed. File verification completed. 385 large file records processed. 0 bad file records processed. 0 EA records processed. 0 reparse records processed. CHKDSK is verifying indexes (stage 2 of 3)... Deleted invalid filename Screenshot from 2012-09-09 09:51:27.png (72) in directory 46. The NTFS file name attribute in file 0x48 is incorrect. 53 00 63 00 72 00 65 00 65 00 6e 00 73 00 68 00 S.c.r.e.e.n.s.h. 6f 00 74 00 20 00 66 00 72 00 6f 00 6d 00 20 00 o.t. .f.r.o.m. . 32 00 30 00 31 00 32 00 2d 00 30 00 39 00 2d 00 2.0.1.2.-.0.9.-. 30 00 39 00 20 00 30 00 39 00 3a 00 35 00 31 00 0.9. .0.9.:.5.1. 3a 00 32 00 37 00 2e 00 70 00 6e 00 67 00 0d 00 :.2.7...p.n.g... 00 00 00 00 00 00 90 94 49 1f 5e 00 00 80 d4 00 ......I.^.... File 72 has been orphaned since all its filenames were invalid Windows will recover the file in the orphan recovery phase. Correcting minor file name errors in file 72. Index entry found.000 of index $I30 in file 0x5 points to unused file 0x11. Deleting index entry found.000 in index $I30 of file 5. Index entry found.001 of index $I30 in file 0x5 points to unused file 0x16. Deleting index entry found.001 in index $I30 of file 5. Index entry found.002 of index $I30 in file 0x5 points to unused file 0x15. Deleting index entry found.002 in index $I30 of file 5. Index entry DOWNLO~1 of index $I30 in file 0x28 points to unused file 0x2b6. Deleting index entry DOWNLO~1 in index $I30 of file 40. Unable to locate the file name attribute of index entry Screenshot from 2012-09-09 09:51:27.png of index $I30 with parent 0x2e in file 0x48. Deleting index entry Screenshot from 2012-09-09 09:51:27.png in index $I30 of file 46. An index entry of index $I30 in file 0x32 points to file 0x151e8 which is beyond the MFT. Deleting index entry latexsheet.tex in index $I30 of file 50. An index entry of index $I30 in file 0x58bc points to file 0x151eb which is beyond the MFT. Deleting index entry D8CZ82PK in index $I30 of file 22716. An index entry of index $I30 in file 0x58bc points to file 0x151f7 which is beyond the MFT. Deleting index entry EGA4QEAX in index $I30 of file 22716. An index entry of index $I30 in file 0x58bc points to file 0x151e9 which is beyond the MFT. Deleting index entry NGTB469M in index $I30 of file 22716. An index entry of index $I30 in file 0x58bc points to file 0x151fb which is beyond the MFT. Deleting index entry WU5RKXAB in index $I30 of file 22716. Index entry comp220-lab3.synctex.gz of index $I30 in file 0xda69 points to unused file 0xd098. Deleting index entry comp220-lab3.synctex.gz in index $I30 of file 55913. Unable to locate the file name attribute of index entry comp220-numberGrammars.aux of index $I30 with parent 0xda69 in file 0xa276. Deleting index entry comp220-numberGrammars.aux in index $I30 of file 55913. The file reference 0x500000000cd43 of index entry comp220-numberGrammars.out of index $I30 with parent 0xda69 is not the same as 0x600000000cd43. Deleting index entry comp220-numberGrammars.out in index $I30 of file 55913. The file reference 0x500000000cd45 of index entry comp220-numberGrammars.pdf of index $I30 with parent 0xda69 is not the same as 0xc00000000cd45. Deleting index entry comp220-numberGrammars.pdf in index $I30 of file 55913. An index entry of index $I30 in file 0xda69 points to file 0x15290 which is beyond the MFT. Deleting index entry gram.aux in index $I30 of file 55913. An index entry of index $I30 in file 0xda69 points to file 0x15291 which is beyond the MFT. Deleting index entry gram.out in index $I30 of file 55913. An index entry of index $I30 in file 0xda69 points to file 0x15292 which is beyond the MFT. Deleting index entry gram.pdf in index $I30 of file 55913. Unable to locate the file name attribute of index entry comp230-quiz1.synctex.gz of index $I30 with parent 0xda6f in file 0xd183. Deleting index entry comp230-quiz1.synctex.gz in index $I30 of file 55919. An index entry of index $I30 in file 0xf3cc points to file 0x15283 which is beyond the MFT. Deleting index entry require-transform.rkt in index $I30 of file 62412. An index entry of index $I30 in file 0xf3cc points to file 0x15284 which is beyond the MFT. Deleting index entry set.rkt in index $I30 of file 62412. An index entry of index $I30 in file 0xf497 points to file 0x15280 which is beyond the MFT. Deleting index entry logger.rkt in index $I30 of file 62615. An index entry of index $I30 in file 0xf497 points to file 0x15281 which is beyond the MFT. Deleting index entry misc.rkt in index $I30 of file 62615. An index entry of index $I30 in file 0xf497 points to file 0x15282 which is beyond the MFT. Deleting index entry more-scheme.rkt in index $I30 of file 62615. An index entry of index $I30 in file 0xf5bf points to file 0x15285 which is beyond the MFT. Deleting index entry core-layout.rkt in index $I30 of file 62911. An index entry of index $I30 in file 0xf5e0 points to file 0x15286 which is beyond the MFT. Deleting index entry ref.scrbl in index $I30 of file 62944. An index entry of index $I30 in file 0xf6f0 points to file 0x15287 which is beyond the MFT. Deleting index entry base-render.rkt in index $I30 of file 63216. An index entry of index $I30 in file 0xf6f0 points to file 0x15288 which is beyond the MFT. Deleting index entry html-properties.rkt in index $I30 of file 63216. An index entry of index $I30 in file 0xf6f0 points to file 0x15289 which is beyond the MFT. Deleting index entry html-render.rkt in index $I30 of file 63216. An index entry of index $I30 in file 0xf6f0 points to file 0x1528b which is beyond the MFT. Deleting index entry latex-prefix.rkt in index $I30 of file 63216. An index entry of index $I30 in file 0xf6f0 points to file 0x1528c which is beyond the MFT. Deleting index entry latex-render.rkt in index $I30 of file 63216. An index entry of index $I30 in file 0xf6f0 points to file 0x1528e which is beyond the MFT. Deleting index entry scribble.tex in index $I30 of file 63216. An index entry of index $I30 in file 0xf717 points to file 0x1528a which is beyond the MFT. Deleting index entry lang.rkt in index $I30 of file 63255. An index entry of index $I30 in file 0xf721 points to file 0x1528d which is beyond the MFT. Deleting index entry lang.rkt in index $I30 of file 63265. An index entry of index $I30 in file 0xf764 points to file 0x1528f which is beyond the MFT. Deleting index entry lang.rkt in index $I30 of file 63332. An index entry of index $I30 in file 0x14261 points to file 0x15270 which is beyond the MFT. Deleting index entry fddff3ae9ae2221207f144821d475c08ec3d05 in index $I30 of file 82529. An index entry of index $I30 in file 0x14621 points to file 0x15268 which is beyond the MFT. Deleting index entry FETCH_HEAD in index $I30 of file 83489. An index entry of index $I30 in file 0x14650 points to file 0x15272 which is beyond the MFT. Deleting index entry 86 in index $I30 of file 83536. An index entry of index $I30 in file 0x14651 points to file 0x15266 which is beyond the MFT. Deleting index entry pack-7f54ce9f8218d2cd8d6815b8c07461b50584027f.idx in index $I30 of file 83537. An index entry of index $I30 in file 0x14651 points to file 0x15265 which is beyond the MFT. Deleting index entry pack-7f54ce9f8218d2cd8d6815b8c07461b50584027f.pack in index $I30 of file 83537. An index entry of index $I30 in file 0x146f1 points to file 0x15275 which is beyond the MFT. Deleting index entry master in index $I30 of file 83697. An index entry of index $I30 in file 0x146f6 points to file 0x15276 which is beyond the MFT. Deleting index entry remotes in index $I30 of file 83702. An index entry of index $I30 in file 0x1477d points to file 0x15278 which is beyond the MFT. Deleting index entry pad.rkt in index $I30 of file 83837. An index entry of index $I30 in file 0x14797 points to file 0x1527c which is beyond the MFT. Deleting index entry pad1.rkt in index $I30 of file 83863. An index entry of index $I30 in file 0x14810 points to file 0x1527d which is beyond the MFT. Deleting index entry cm.rkt in index $I30 of file 83984. An index entry of index $I30 in file 0x14926 points to file 0x1527e which is beyond the MFT. Deleting index entry multi-file-search.rkt in index $I30 of file 84262. An index entry of index $I30 in file 0x149ef points to file 0x1527f which is beyond the MFT. Deleting index entry com.rkt in index $I30 of file 84463. An index entry of index $I30 in file 0x14b47 points to file 0x15202 which is beyond the MFT. Deleting index entry COMMIT_EDITMSG in index $I30 of file 84807. An index entry of index $I30 in file 0x14b47 points to file 0x15279 which is beyond the MFT. Deleting index entry index in index $I30 of file 84807. An index entry of index $I30 in file 0x14b4c points to file 0x15274 which is beyond the MFT. Deleting index entry master in index $I30 of file 84812. An index entry of index $I30 in file 0x14b61 points to file 0x1520b which is beyond the MFT. Deleting index entry 02 in index $I30 of file 84833. An index entry of index $I30 in file 0x14b61 points to file 0x1525a which is beyond the MFT. Deleting index entry 28 in index $I30 of file 84833. An index entry of index $I30 in file 0x14b61 points to file 0x15208 which is beyond the MFT. Deleting index entry 29 in index $I30 of file 84833. An index entry of index $I30 in file 0x14b61 points to file 0x1521f which is beyond the MFT. Deleting index entry 2c in index $I30 of file 84833. An index entry of index $I30 in file 0x14b61 points to file 0x15261 which is beyond the MFT. Deleting index entry 2e in index $I30 of file 84833. An index entry of index $I30 in file 0x14b61 points to file 0x151f0 which is beyond the MFT. Deleting index entry 45 in index $I30 of file 84833. An index entry of index $I30 in file 0x14b61 points to file 0x1523e which is beyond the MFT. Deleting index entry 47 in index $I30 of file 84833. An index entry of index $I30 in file 0x14b61 points to file 0x151e5 which is beyond the MFT. Deleting index entry 49 in index $I30 of file 84833. An index entry of index $I30 in file 0x14b61 points to file 0x15214 which is beyond the MFT. Deleting index entry 58 in index $I30 of file 84833. Index entry 6e of index $I30 in file 0x14b61 points to unused file 0xd182. Deleting index entry 6e in index $I30 of file 84833. Unable to locate the file name attribute of index entry a0 of index $I30 with parent 0x14b61 in file 0xd29c. Deleting index entry a0 in index $I30 of file 84833. An index entry of index $I30 in file 0x14b61 points to file 0x1521b which is beyond the MFT. Deleting index entry cd in index $I30 of file 84833. An index entry of index $I30 in file 0x14b61 points to file 0x15249 which is beyond the MFT. Deleting index entry d6 in index $I30 of file 84833. An index entry of index $I30 in file 0x14b61 points to file 0x15242 which is beyond the MFT. Deleting index entry df in index $I30 of file 84833. An index entry of index $I30 in file 0x14b61 points to file 0x15227 which is beyond the MFT. Deleting index entry ea in index $I30 of file 84833. An index entry of index $I30 in file 0x14b61 points to file 0x1522e which is beyond the MFT. Deleting index entry f3 in index $I30 of file 84833. An index entry of index $I30 in file 0x14b61 points to file 0x151f2 which is beyond the MFT. Deleting index entry ff in index $I30 of file 84833. An index entry of index $I30 in file 0x14b62 points to file 0x15254 which is beyond the MFT. Deleting index entry 1ed39b36ad4bd48c91d22cbafd7390f1ea38da in index $I30 of file 84834. An index entry of index $I30 in file 0x14b75 points to file 0x15224 which is beyond the MFT. Deleting index entry 96260247010fe9811fea773c08c5f3a314df3f in index $I30 of file 84853. An index entry of index $I30 in file 0x14b79 points to file 0x15219 which is beyond the MFT. Deleting index entry 8f689724ca23528dd4f4ab8b475ace6edcb8f5 in index $I30 of file 84857. An index entry of index $I30 in file 0x14b7c points to file 0x15223 which is beyond the MFT. Deleting index entry 1df17cf850656be42c947cba6295d29c248d94 in index $I30 of file 84860. An index entry of index $I30 in file 0x14b7c points to file 0x15217 which is beyond the MFT. Deleting index entry 31db8a3c72a3e44769bbd8db58d36f8298242c in index $I30 of file 84860. An index entry of index $I30 in file 0x14b7c points to file 0x15267 which is beyond the MFT. Deleting index entry 8e1254d755ff1882d61c07011272bac3612f57 in index $I30 of file 84860. An index entry of index $I30 in file 0x14b82 points to file 0x15246 which is beyond the MFT. Deleting index entry f959bfaf9643c1b9e78d5ecf8f669133efdbf3 in index $I30 of file 84866. An index entry of index $I30 in file 0x14b88 points to file 0x151fe which is beyond the MFT. Deleting index entry 7e9aa15b1196b2c60116afa4ffa613397f2185 in index $I30 of file 84872. An index entry of index $I30 in file 0x14b8a points to file 0x151ea which is beyond the MFT. Deleting index entry 73cb0cd248e494bb508f41b55d862e84cdd6e0 in index $I30 of file 84874. An index entry of index $I30 in file 0x14b8e points to file 0x15264 which is beyond the MFT. Deleting index entry bd555d9f0383cc14c317120149e9376a8094c4 in index $I30 of file 84878. An index entry of index $I30 in file 0x14b96 points to file 0x15212 which is beyond the MFT. Deleting index entry 630dba40562d991bc6cbb6fed4ba638542e9c5 in index $I30 of file 84886. An index entry of index $I30 in file 0x14b99 points to file 0x151ec which is beyond the MFT. Deleting index entry 478be31ca8e538769246e22bba3330d81dc3c8 in index $I30 of file 84889. An index entry of index $I30 in file 0x14b99 points to file 0x15258 which is beyond the MFT. Deleting index entry 66c60c0a0f3253bc9a5112697e4cbb0dfc0c78 in index $I30 of file 84889. An index entry of index $I30 in file 0x14b9c points to file 0x15238 which is beyond the MFT. Deleting index entry 1c7ceeddc2953496f9ffbfc0b6fb28846e3fe3 in index $I30 of file 84892. An index entry of index $I30 in file 0x14b9c points to file 0x15247 which is beyond the MFT. Deleting index entry ae6e32ffc49d897d8f8aeced970a90d3653533 in index $I30 of file 84892. An index entry of index $I30 in file 0x14ba0 points to file 0x15233 which is beyond the MFT. Deleting index entry f71c7d874e45179a32e138b49bf007e5bbf514 in index $I30 of file 84896. Index entry 2e04fefbd794f050d45e7a717d009e39204431 of index $I30 in file 0x14ba7 points to unused file 0xd097. Deleting index entry 2e04fefbd794f050d45e7a717d009e39204431 in index $I30 of file 84903. An index entry of index $I30 in file 0x14baa points to file 0x15241 which is beyond the MFT. Deleting index entry 0dda7dec1c635cd646dfef308e403c2843d5dc in index $I30 of file 84906. An index entry of index $I30 in file 0x14baa points to file 0x151fc which is beyond the MFT. Deleting index entry 98151e654dd546edcfdec630bc82d90619ac8e in index $I30 of file 84906. An index entry of index $I30 in file 0x14bb1 points to file 0x151e9 which is beyond the MFT. Deleting index entry 1997c5be62ffeebc99253cced7608415e38e4e in index $I30 of file 84913. An index entry of index $I30 in file 0x14bb1 points to file 0x1521d which is beyond the MFT. Deleting index entry 6bf3aedefd3ac62d9c49cad72d05e8c0ad242c in index $I30 of file 84913. An index entry of index $I30 in file 0x14bb1 points to file 0x151f4 which is beyond the MFT. Deleting index entry 907b755afdca14c00be0010962d0861af29264 in index $I30 of file 84913. An index entry of index $I30 in file 0x14bb3 points to file 0x15218 which is beyond the MFT. Deleting index entry

    Read the article

< Previous Page | 188 189 190 191 192 193 194 195  | Next Page >