Search Results

Search found 60 results on 3 pages for 'bufferedwriter'.

Page 2/3 | < Previous Page | 1 2 3  | Next Page >

  • Writing Russian in XML

    - by zavié
    Hi, I am writing a Xml Tag Renamer class with Java which reads in a XML, renames the tags and write them back into another XML file using DocumentBuilderFactory and TransformerFactory (text nodes are preserved). It worked fine before with German and English texts, until today, when I tried to rename a XML file with russian text. Instead of the source texts I got ????? in the newly created XML file. I've tried setting Encoding Any idea how to correct this? Thanks! PS. Strings were correct before entering TransformerFactory, as I checked in the debugger. I've tried setting OutputKeys.ENCODING to UTF-8 and ISO-8859-5. None of them helped. The Transformer part: // Output the XML // Set up a transformer TransformerFactory transFactory = TransformerFactory.newInstance(); Transformer transformer = transFactory.newTransformer(); transformer.setOutputProperty(OutputKeys.OMIT_XML_DECLARATION, "no"); // Fix to a bug about indent in transformer transformer.setOutputProperty ("{http://xml.apache.org/xslt}indent-amount", "4"); transformer.setOutputProperty(OutputKeys.INDENT, "yes"); // TODO encoding parameter transformer.setOutputProperty(OutputKeys.ENCODING, "UTF-8"); // Create string from xml tree StringWriter sw = new StringWriter(); StreamResult result = new StreamResult(sw); DOMSource source = new DOMSource(doc); transformer.transform(source, result); String xmlString = sw.toString(); xmlString.replaceAll("\n", System.getProperty("line.separator")); // Write to file BufferedWriter output = new BufferedWriter(new FileWriter(outputPath)); output.write(xmlString); output.close();

    Read the article

  • In Java, send commands to another command-line program

    - by bradvido
    I am using Java on Windows XP and want to be able to send commands to another program such as telnet. I do not want to simply execute another program. I want to execute it, and then send it a sequence of commands once it's running. Here's my code of what I want to do, but it does not work: (If you uncomment and change the command to "cmd" it works as expected. Please help.) try { Runtime rt = Runtime.getRuntime(); String command = "telnet"; //command = "cmd"; Process pr = rt.exec(command); BufferedReader processOutput = new BufferedReader(new InputStreamReader(pr.getInputStream())); BufferedWriter processInput = new BufferedWriter(new OutputStreamWriter(pr.getOutputStream())); String commandToSend = "open localhost\n"; //commandToSend = "dir\n" + "exit\n"; processInput.write(commandToSend); processInput.flush(); int lineCounter = 0; while(true) { String line = processOutput.readLine(); if(line == null) break; System.out.println(++lineCounter + ": " + line); } processInput.close(); processOutput.close(); pr.waitFor(); } catch(Exception x) { x.printStackTrace(); }

    Read the article

  • Writing XML in different character encodings with Java

    - by Roman Myers
    I am attempting to write an XML library file that can be read again into my program. The file writer code is as follows: XMLBuilder builder = new XMLBuilder(); Document doc = builder.build(bookList); DOMImplementation impl = doc.getImplementation(); DOMImplementationLS implLS = (DOMImplementationLS) impl.getFeature("LS", "3.0"); LSSerializer ser = implLS.createLSSerializer(); String out = ser.writeToString(doc); //System.out.println(out); try{ FileWriter fstream = new FileWriter(location); BufferedWriter outwrite = new BufferedWriter(fstream); outwrite.write(out); outwrite.close(); }catch (Exception e){ } The above code does write an xml document. However, in the XML header, it is an attribute that the file is encoded in UTF-16. when i read in the file, i get the error: "content not allowed in prolog" this error does not occur when the encoding attribute is manually changed to UTF-8. I am trying to get the above code to write an XML document encoded in UTF-8, or successfully parse a UTF-16 file. the code for parsing in is DocumentBuilderFactory factory = DocumentBuilderFactory.newInstance(); DocumentBuilder loader = factory.newDocumentBuilder(); Document document = loader.parse(filename); the last line returns the error.

    Read the article

  • how to use "tab space" while writing in text file

    - by Manu
    SimpleDateFormat formatter = new SimpleDateFormat("ddMMyyyy_HHmmSS"); String strCurrDate = formatter.format(new java.util.Date()); String strfileNm = "Cust_Advice_" + strCurrDate + ".txt"; String strFileGenLoc = strFileLocation + "/" + strfileNm; String strQuery="select name, age, data from basetable; try { stmt = conn.createStatement(); System.out.println("Query is -> " + strQuery); rs = stmt.executeQuery(strQuery); File f = new File(strFileGenLoc); OutputStream os = (OutputStream)new FileOutputStream(f); String encoding = "UTF8"; OutputStreamWriter osw = new OutputStreamWriter(os, encoding); BufferedWriter bw = new BufferedWriter(osw); while (rs.next() ) { bw.write(rs.getString(1)==null? "":rs.getString(1)); bw.write(" "); bw.write(rs.getString(2)==null? "":rs.getString(2)); bw.write(" "); } bw.flush(); bw.close(); } catch (Exception e) { System.out.println( "Exception occured while getting resultset by the query"); e.printStackTrace(); } finally { try { if (conn != null) { System.out.println("Closing the connection" + conn); conn.close(); } } catch (SQLException e) { System.out.println( "Exception occured while closing the connection"); e.printStackTrace(); } } return objArrayListValue; } i need "one tab space" in between each column(while writing to text file). like manu 25 data1 manc 35 data3 in my code i use bw.write(" ") for creating space between each column. how to use "one tab space" in that place instead of giving "space".

    Read the article

  • Append data to same text file using java

    - by Manu
    SimpleDateFormat formatter = new SimpleDateFormat("ddMMyyyy_HHmmSS"); String strCurrDate = formatter.format(new java.util.Date()); String strfileNm = "Customer_" + strCurrDate + ".txt"; String strFileGenLoc = strFileLocation + "/" + strfileNm; String Query1="select '0'||to_char(sysdate,'YYYYMMDD')||'123456789' class_code from dual"; String Query2="select '0'||to_char(sysdate,'YYYYMMDD')||'123456789' class_code from dual"; try { Statement stmt = null; ResultSet rs = null; Statement stmt1 = null; ResultSet rs1 = null; stmt = conn.createStatement(); stmt1 = conn.createStatement(); rs = stmt.executeQuery(Query1); rs1 = stmt1.executeQuery(Query2); File f = new File(strFileGenLoc); OutputStream os = (OutputStream)new FileOutputStream(f,true); String encoding = "UTF8"; OutputStreamWriter osw = new OutputStreamWriter(os, encoding); BufferedWriter bw = new BufferedWriter(osw); while (rs.next() ) { bw.write(rs.getString(1)==null? "":rs.getString(1)); bw.write(" "); } bw.flush(); bw.close(); } catch (Exception e) { System.out.println( "Exception occured while getting resultset by the query"); e.printStackTrace(); } finally { try { if (conn != null) { System.out.println("Closing the connection" + conn); conn.close(); } } catch (SQLException e) { System.out.println( "Exception occured while closing the connection"); e.printStackTrace(); } } return objArrayListValue; } The above code is working fine. it writes the content of "rs" resultset data in text file Now what i want is ,i need to append the the content in "rs2" resultset to the "same text file"(ie . i need to append "rs2" content with "rs" content in the same text file)..

    Read the article

  • Cannot write to SD card -- canWrite is returning false

    - by Fizz
    Sorry for the ambiguous title but I'm doing the following to write a simple string to a file: try { File root = Environment.getExternalStorageDirectory(); if (root.canWrite()){ System.out.println("Can write."); File def_file = new File(root, "default.txt"); FileWriter fw = new FileWriter(def_file); BufferedWriter out = new BufferedWriter(fw); String defbuf = "default"; out.write(defbuf); out.flush(); out.close(); } else System.out.println("Can't write."); }catch (IOException e) { e.printStackTrace(); } But root.canWrite() seems to be returning false everytime. I am not running this off of an emulator, I have my android Eris plugged into my computer via USB and running the app off of my phone via Eclipse. Is there a way of giving my app permission so this doesn't happen? Also, this code seems to be create the file default.txt but what if it already exists, will it ignore the creation and just open it to write or do I have to catch something like FileAlreadyExists(if such an exception exists) which then just opens it and writes? Thanks for any help guys.

    Read the article

  • Loading velocity template inside a jar file

    - by Rafael
    I have a project where I want to load a velocity template to complete it with parameters. The whole application is packaged as a jar file. What I initially thought of doing was this: VelocityEngine ve = new VelocityEngine(); URL url = this.getClass().getResource("/templates/"); File file = new File(url.getFile()); ve = new VelocityEngine(); ve.setProperty(RuntimeConstants.RESOURCE_LOADER, "file"); ve.setProperty(RuntimeConstants.FILE_RESOURCE_LOADER_PATH, file.getAbsolutePath()); ve.setProperty(RuntimeConstants.FILE_RESOURCE_LOADER_CACHE, "true"); ve.init(); VelocityContext context = new VelocityContext(); if (properties != null) { stringfyNulls(properties); for (Map.Entry<String, Object> property : properties.entrySet()) { context.put(property.getKey(), property.getValue()); } } final String templatePath = templateName + ".vm"; Template template = ve.getTemplate(templatePath, "UTF-8"); String outFileName = File.createTempFile("p2d_report", ".html").getAbsolutePath(); BufferedWriter writer = new BufferedWriter(new FileWriter(new File(outFileName))); template.merge(context, writer); writer.flush(); writer.close(); And this works fine when I run it in eclipse. However, once I package the program and try to run it using the command line I get an error because the file could not be found. I imagine the problem is in this line: ve.setProperty(RuntimeConstants.FILE_RESOURCE_LOADER_PATH, file.getAbsolutePath()); Because in a jar the absolute file does not exist, since it's inside a zip, but I couldn't yet find a better way to do it. Anyone has any ideas?

    Read the article

  • looping problem while appending data to existing text file

    - by Manu
    try { stmt = conn.createStatement(); stmt1 = conn.createStatement(); stmt2 = conn.createStatement(); rs = stmt.executeQuery("select cust from trip1"); rs1 = stmt1.executeQuery("select cust from trip2"); rs2 = stmt2.executeQuery("select cust from trip3"); File f = new File(strFileGenLoc); OutputStream os = (OutputStream)new FileOutputStream(f,true); String encoding = "UTF8"; OutputStreamWriter osw = new OutputStreamWriter(os, encoding); BufferedWriter bw = new BufferedWriter(osw); } while ( rs.next() ) { while(rs1.next()){ while(rs2.next()){ bw.write(rs.getString(1)==null? "":rs.getString(1)); bw.write("\t"); bw.write(rs1.getString(1)==null? "":rs1.getString(1)); bw.write("\t"); bw.write(rs2.getString(1)==null? "":rs2.getString(1)); bw.write("\t"); bw.newLine(); } } } Above code working fine. My problem is 1. "rs" resultset contains one record in the table 2. "rs1" resultset contains 5 record in the table 3. "rs2" resultset contains 5 record in the table "rs" data is getting recursive. while writing to the same text file , the output i am getting like 1 2 3 1 12 21 1 23 25 1 10 5 1 8 54 but i need output like below 1 2 3 12 21 23 25 10 5 8 54 What things i need to change in my code.. Please advice

    Read the article

  • Append data to same text file

    - by Manu
    SimpleDateFormat formatter = new SimpleDateFormat("ddMMyyyy_HHmmSS"); String strCurrDate = formatter.format(new java.util.Date()); String strfileNm = "Customer_" + strCurrDate + ".txt"; String strFileGenLoc = strFileLocation + "/" + strfileNm; String Query1="select '0'||to_char(sysdate,'YYYYMMDD')||'123456789' class_code from dual"; String Query2="select '0'||to_char(sysdate,'YYYYMMDD')||'123456789' class_code from dual"; try { Statement stmt = null; ResultSet rs = null; Statement stmt1 = null; ResultSet rs1 = null; stmt = conn.createStatement(); stmt1 = conn.createStatement(); rs = stmt.executeQuery(Query1); rs1 = stmt1.executeQuery(Query2); File f = new File(strFileGenLoc); OutputStream os = (OutputStream)new FileOutputStream(f,true); String encoding = "UTF8"; OutputStreamWriter osw = new OutputStreamWriter(os, encoding); BufferedWriter bw = new BufferedWriter(osw); while (rs.next() ) { bw.write(rs.getString(1)==null? "":rs.getString(1)); bw.write(" "); } bw.flush(); bw.close(); } catch (Exception e) { System.out.println( "Exception occured while getting resultset by the query"); e.printStackTrace(); } finally { try { if (conn != null) { System.out.println("Closing the connection" + conn); conn.close(); } } catch (SQLException e) { System.out.println( "Exception occured while closing the connection"); e.printStackTrace(); } } return objArrayListValue; } The above code is working fine. it writes the content of "rs" resultset data in text file Now what i want is ,i need to append the the content in "rs2" resultset to the "same text file"(ie . i need to append "rs2" content with "rs" content in the same text file)..

    Read the article

  • Exporting to CSV/Excel in Java

    - by WIOijwww
    I'm trying to export data into a CSV file through Java and I've got some code to do it but it doesn't seem to be outputting the CSV file. Could someone tell me what's wrong? What I would like to do is rather than saving the file somewhere, I would like it to be directly exported to the user. EDIT: Just in case it's not clear, I don't want the file to be saved anywhere but would like it to be outputted automatically to the user i.e. they click export and get the "Run/Save results.csv" window and they open the file. Currently the file is getting saved so I know that the method seems to work, just in the opposite way that I want it to. public static void writeToCSV(List<Map> objectList) { String CSV_SEPARATOR = ","; try { BufferedWriter bw = new BufferedWriter(new OutputStreamWriter( new FileOutputStream("results.csv"), "UTF-8")); for (Map objectDetails : objectList) { StringBuffer oneLine = new StringBuffer(); Iterator it = objectDetails.values().iterator(); while (it.hasNext()) { Object value = it.next(); if(value !=null){ oneLine.append(value.toString()); } if (it.hasNext()) { oneLine.append(CSV_SEPARATOR); } } bw.write(oneLine.toString()); bw.newLine(); } bw.flush(); bw.close(); } catch (UnsupportedEncodingException e) { } catch (FileNotFoundException e) { } catch (IOException e) { } }

    Read the article

  • Java variables across methods

    - by NardCake
    I'm making a basic text editor, and I have 2 methods the first one is triggered when a user click 'Open' and it prompts the user to pick a file and it opens the file fine. I just want to access the same file path which is in a variable in the method that is triggered when the user clicks save. My methods are public, Iv'e tried accessing it through a class, still no. Please help! Code: public void open(){ try{ //Open file JFileChooser fc = new JFileChooser(); fc.showOpenDialog(null); File file = fc.getSelectedFile(); String haha = file.getPath(); BufferedReader br = new BufferedReader(new FileReader(file.getPath())); String line; while((line = br.readLine()) != null){ text.append(line + "\n"); } } catch (FileNotFoundException e){ e.printStackTrace(); }catch (IOException e){ } } public void save(){ try { BufferedWriter bw = new BufferedWriter(new FileWriter(file.filePath)); bw.write(text.getText()); bw.close(); } catch (IOException e) { e.printStackTrace(); } }

    Read the article

  • Cannot run public class in one .java from another

    - by DIOS
    I have created a basic program that takes whatever is input into two textfields and exports them to a file. I would now like to encrypt that file, and alredy have the encryptor. The problem is that I cannot call it. Here is my code for the encryptor: import java.io.File; import java.io.FileInputStream; import java.io.FileOutputStream; import java.io.*; import javax.crypto.Cipher; import javax.crypto.CipherInputStream; import javax.crypto.CipherOutputStream; import javax.crypto.spec.SecretKeySpec; public class FileEncryptor { private String algo; private File file; public FileEncryptor(String algo,String path) { this.algo=algo; //setting algo this.file=new File(path); //settong file } public void encrypt() throws Exception{ //opening streams FileInputStream fis =new FileInputStream(file); file=new File(file.getAbsolutePath()); FileOutputStream fos =new FileOutputStream(file); //generating key byte k[] = "HignDlPs".getBytes(); SecretKeySpec key = new SecretKeySpec(k,algo.split("/")[0]); //creating and initialising cipher and cipher streams Cipher encrypt = Cipher.getInstance(algo); encrypt.init(Cipher.ENCRYPT_MODE, key); CipherOutputStream cout=new CipherOutputStream(fos, encrypt); byte[] buf = new byte[1024]; int read; while((read=fis.read(buf))!=-1) //reading data cout.write(buf,0,read); //writing encrypted data //closing streams fis.close(); cout.flush(); cout.close(); } public static void main (String[] args)throws Exception { new FileEncryptor("DES/ECB/PKCS5Padding","C:\\Users\\*******\\Desktop\\newtext").encrypt();//encrypts the current file. } } Here is the section of my file creator that is failing to call this: FileWriter fWriter = null; BufferedWriter writer = null; try{ fWriter = new FileWriter("C:\\Users\\*******\\Desktop\\newtext"); writer = new BufferedWriter(fWriter); writer.write(Data); writer.close(); f.dispose(); FileEncryptor encr = new FileEncryptor(); //problem lies here. encr.encrypt //public void that does the encryption. new complete(); //different .java that is working fine.

    Read the article

  • How to display specific data from a file

    - by user1067332
    My program is supposed to ask the user for firstname, lastname, and phone number till the users stops. Then when to display it asks for the first name and does a search in the text file to find all info with the same first name and display lastname and phones of the matches. import java.util.*; import java.io.*; import java.util.Scanner; public class WritePhoneList { public static void main(String[] args)throws IOException { BufferedWriter output = new BufferedWriter(new FileWriter(new File( "PhoneFile.txt"), true)); String name, lname, age; int pos,choice; try { do { Scanner input = new Scanner(System.in); System.out.print("Enter First name, last name, and phone number "); name = input.nextLine(); output.write(name); output.newLine(); System.out.print("Would you like to add another? yes(1)/no(2)"); choice = input.nextInt(); }while(choice == 1); output.close(); } catch(Exception e) { System.out.println("Message: " + e); } } } Here is the display code, when i search for a name, it finds a match but displays the last name and phone number of the same name 3 times, I want it to display all of the possible matches with the first name. import java.util.*; import java.io.*; import java.util.Scanner; public class DisplaySelectedNumbers { public static void main(String[] args)throws IOException { String name; String strLine; try { FileInputStream fstream = new FileInputStream("PhoneFile.txt"); // Get the object of DataInputStream DataInputStream in = new DataInputStream(fstream); BufferedReader br = new BufferedReader(new InputStreamReader(in)); Scanner input = new Scanner(System.in); System.out.print("Enter a first name"); name = input.nextLine(); strLine= br.readLine(); String[] line = strLine.split(" "); String part1 = line[0]; String part2 = line[1]; String part3 = line[2]; //Read File Line By Line while ((strLine= br.readLine()) != null) { if(name.equals(part1)) { // Print the content on the console System.out.print("\n" + part2 + " " + part3); } } }catch (Exception e) {//Catch exception if any System.out.println("Error: " + e.getMessage()); } } }

    Read the article

  • closing MQ connection

    - by OakvilleWork
    Good afternoon, I wrote a project to Get Park Queue Info from the IBM MQ, it has producing an error when attempting to close the connection though. It is written in java. Under application in Event Viewer on the MQ machine it displays two errors. They are: “Channel program ended abnormally. Channel program ‘system.def.surconn’ ended abnormally. Look at previous error messages for channel program ‘system.def.surconn’ in the error files to determine the cause of the failure. The other message states: “Error on receive from host rnanaj (10.10.12.34) An error occurred receiving data from rnanaj (10.10.12.34) over tcp/ip. This may be due to a communications failure. The return code from tcp/ip recv() call was 10054 (X’2746’). Record these values.” This must be something how I try to connect or close the connection, below I have my code to connect and close, any ideas?? Connect: _logger.info("Start"); File outputFile = new File(System.getProperty("PROJECT_HOME"), "run/" + this.getClass().getSimpleName() + "." + System.getProperty("qmgr") + ".txt"); FileUtils.mkdirs(outputFile.getParentFile()); Connection jmsConn = null; Session jmsSession = null; QueueBrowser queueBrowser = null; BufferedWriter commandsBw = null; try { // get queue connection MQConnectionFactory MQConn = new MQConnectionFactory(); MQConn.setHostName(System.getProperty("host")); MQConn.setPort(Integer.valueOf(System.getProperty("port"))); MQConn.setQueueManager(System.getProperty("qmgr")); MQConn.setChannel("SYSTEM.DEF.SVRCONN"); MQConn.setTransportType(JMSC.MQJMS_TP_CLIENT_MQ_TCPIP); jmsConn = (Connection) MQConn.createConnection(); jmsSession = jmsConn.createSession(false, Session.AUTO_ACKNOWLEDGE); Queue jmsQueue = jmsSession.createQueue("PARK"); // browse thru messages queueBrowser = jmsSession.createBrowser(jmsQueue); Enumeration msgEnum = queueBrowser.getEnumeration(); commandsBw = new BufferedWriter(new FileWriter(outputFile)); // String line = "DateTime\tMsgID\tOrigMsgID\tCorrelationID\tComputerName\tSubsystem\tDispatcherName\tProcessor\tJobID\tErrorMsg"; commandsBw.write(line); commandsBw.newLine(); while (msgEnum.hasMoreElements()) { Message message = (Message) msgEnum.nextElement(); line = dateFormatter.format(new Date(message.getJMSTimestamp())) + "\t" + message.getJMSMessageID() + "\t" + message.getStringProperty("pkd_orig_jms_msg_id") + "\t" + message.getJMSCorrelationID() + "\t" + message.getStringProperty("pkd_computer_name") + "\t" + message.getStringProperty("pkd_subsystem") + "\t" + message.getStringProperty("pkd_dispatcher_name") + "\t" + message.getStringProperty("pkd_processor") + "\t" + message.getStringProperty("pkd_job_id") + "\t" + message.getStringProperty("pkd_sysex_msg"); _logger.info(line); commandsBw.write(line); commandsBw.newLine(); } } Close: finally { IO.close(commandsBw); if (queueBrowser != null) { try { queueBrowser.close();} catch (Exception ignore) {}} if (jmsSession != null) { try { jmsSession.close();} catch (Exception ignore) {}} if (jmsConn != null) { try { jmsConn.stop();} catch (Exception ignore) {}} }

    Read the article

  • Converting text into numeric in xls using Java

    - by Work World
    When I create excel sheet through java ,the column which has number datatype in the oracle table, get converted to text format in excel.I want it to remain in the number format.Below is my code snippet for excel creation. FileWriter fw = new FileWriter(tempFile.getAbsoluteFile(),true); // BufferedWriter bw = new BufferedWriter(fw); HSSFWorkbook wb = new HSSFWorkbook(); HSSFSheet sheet = wb.createSheet("Excel Sheet"); //Column Size of excel for(int i=0;i<10;i++) { sheet.setColumnWidth((short) i, (short)8000); } String userSelectedValues=result; HSSFCellStyle style = wb.createCellStyle(); ///HSSFDataFormat df = wb.createDataFormat(); style.setFillForegroundColor(HSSFColor.GREY_25_PERCENT.index); style.setFillPattern(HSSFCellStyle.SOLID_FOREGROUND); //style.setDataFormat(df.getFormat("0")); HSSFFont font = wb.createFont(); font.setColor(HSSFColor.BLACK.index); font.setBoldweight((short) 700); style.setFont(font); int selecteditems=userSelectedValues.split(",").length; // HSSFRow rowhead = sheet.createRow((short)0); //System.out.println("**************selecteditems************" +selecteditems); for(int k=0; k<selecteditems;k++) { HSSFRow rowhead = sheet.createRow((short)k); if(userSelectedValues.contains("O_UID")) { HSSFCell cell0 = rowhead.createCell((short) k); cell0.setCellValue("O UID"); cell0.setCellStyle(style); k=k+1; } ///some columns here.. } int index=1; for (int i = 0; i<dataBeanList.size(); i++) { odb=(OppDataBean)dataBeanList.get(i); HSSFRow row = sheet.createRow((short)index); for(int j=0;j<selecteditems;j++) { if(userSelectedValues.contains("O_UID")) { row.createCell((short)j).setCellValue(odb.getUID()); j=j+1; } } index++; } FileOutputStream fileOut = null; try { fileOut = new FileOutputStream(path.toString()+"/temp.xls"); } catch (FileNotFoundException e1) { // TODO Auto-generated catch block e1.printStackTrace(); } try { wb.write(fileOut); } catch (IOException e) { // TODO Auto-generated catch block e.printStackTrace(); } try { fileOut.close(); } catch (IOException e) { // TODO Auto-generated catch block e.printStackTrace(); }

    Read the article

  • How do I use Java to sort surnames in alphabetical order from file to file?

    - by user577939
    I have written this code and don't know how to sort surnames in alphabetical order from my file to another file. import java.io.*; import java.util.*; class Asmuo { String pavarde; String vardas; long buvLaikas; int atv1; int atv2; int atv3; } class Irasas { Asmuo duom; Irasas kitas; } class Sarasas { private Irasas p; Sarasas() { p = null; } Irasas itrauktiElementa(String pv, String v, long laikas, int d0, int d1, int d2) { String pvrd, vrd; int data0; int data1; int data2; long lks; lks = laikas; pvrd = pv; vrd = v; data0 = d0; data1 = d1; data2 = d2; Irasas r = new Irasas(); r.duom = new Asmuo(); uzpildymasDuomenimis(r, pvrd, vrd, lks, d0, d1, d2); r.kitas = p; p = r; return r; } void uzpildymasDuomenimis(Irasas r, String pv, String v, long laik, int d0, int d1, int d2) { r.duom.pavarde = pv; r.duom.vardas = v; r.duom.atv1 = d0; r.duom.buvLaikas = laik; r.duom.atv2 = d1; r.duom.atv3 = d2; } void spausdinti() { Irasas d = p; int i = 0; try { FileWriter fstream = new FileWriter("rez.txt"); BufferedWriter rez = new BufferedWriter(fstream); while (d != null) { System.out.println(d.duom.pavarde + " " + d.duom.vardas + " " + d.duom.buvLaikas + " " + d.duom.atv1 + " " + d.duom.atv2 + " " + d.duom.atv3); rez.write(d.duom.pavarde + " " + d.duom.vardas + " " + d.duom.buvLaikas + " " + d.duom.atv1 + " " + d.duom.atv2 + " " + d.duom.atv3 + "\n"); d = d.kitas; i++; } rez.close(); } catch (Exception e) { System.err.println("Error: " + e.getMessage()); } } } public class Gyventojai { public static void main(String args[]) { Sarasas sar = new Sarasas(); Calendar atv = Calendar.getInstance(); Calendar isv = Calendar.getInstance(); try { FileInputStream fstream = new FileInputStream("duom.txt"); DataInputStream in = new DataInputStream(fstream); BufferedReader br = new BufferedReader(new InputStreamReader(in)); String eil; while ((eil = br.readLine()) != null) { String[] cells = eil.split(" "); String pvrd = cells[0]; String vrd = cells[1]; atv.set(Integer.parseInt(cells[2]), Integer.parseInt(cells[3]), Integer.parseInt(cells[4])); isv.set(Integer.parseInt(cells[5]), Integer.parseInt(cells[6]), Integer.parseInt(cells[7])); long laik = (isv.getTimeInMillis() - atv.getTimeInMillis()) / (24 * 60 * 60 * 1000); int d0 = Integer.parseInt(cells[2]); int d1 = Integer.parseInt(cells[3]); int d2 = Integer.parseInt(cells[4]); sar.itrauktiElementa(pvrd, vrd, laik, d0, d1, d2); } in.close(); } catch (Exception e) { System.err.println("Error: " + e.getMessage()); } sar.spausdinti(); } }

    Read the article

  • Servlet Filter: Socket need to be referenced in doFilter()

    - by Craig m
    Right now I have a filter that has the sockets opened in the init and for some reason when I open them in doFilter() it doesn't work with the server app right so I have no choice but to put it in the init I need to be able to reference the outSide.println("test"); in doFilter() so I can send that to my server app every time the if statement it in is is tripped. Heres my code: import java.net.*; import java.io.*; import java.util.*; import javax.servlet.*; import javax.servlet.http.*; public final class IEFilter implements Filter { public void doFilter(ServletRequest request, ServletResponse response, FilterChain chain) throws IOException, ServletException { String browser = ""; String blockInfo; String address = request.getRemoteAddr(); if(((HttpServletRequest)request).getHeader ("User-Agent").indexOf("MSIE") >= 0) { browser = "Internet Explorer"; } if(browser.equals("Internet Explorer")) { BufferedWriter fW = new BufferedWriter(new FileWriter("C://logs//IElog.rtf")); blockInfo = "Blocked IE user from:" + address; response.setContentType("text/html"); PrintWriter out = response.getWriter(); out.println("<HTML>"); out.println("<HEAD>"); out.println("<TITLE>"); out.println("This page is not available - JNetProtect"); out.println("</TITLE>"); out.println("</HEAD>"); out.println("<BODY>"); out.println("<center><H1>Error 403</H1>"); out.println("<br>"); out.println("<br>"); out.println("<H1>Access Denied</H1>"); out.println("<br>"); out.println("Sorry, that resource may not be accessed now."); out.println("<br>"); out.println("<br>"); out.println("<hr />"); out.println("<i>Page Filtered By JNetProtect</i>"); out.println("</BODY>"); out.println("</HTML>"); //init.outSide.println("Blocked and Internet Explorer user"); fW.write(blockInfo); fW.newLine(); fW.close(); } else { chain.doFilter(request, response); } } public void destroy() { outsocket.close(); outSide.close(); } public void init(FilterConfig filterConfig) { try { ServerSocket fs; Socket outsocket; PrintWriter outSide ; outsocket = new Socket("Localhost", 1337); outSide = new PrintWriter(outsocket.getOutputStream(), true); }catch (Exception e){ System.out.println("error with this connection"); e.printStackTrace();} } }

    Read the article

  • RSA encryption/ Decryption in a client server application

    - by user308806
    Hi guys, probably missing something very straight forward on this, but please forgive me, I'm very naive! Have a client server application where the client identifies its self with an RSA encrypted username & password. Unfortunately I'm getting a "bad padding exception: data must start with zero" when i try to decrypt with the public key on the client side. I'm fairly sure the key is correct as I have tested encrypting with public key then decrypting with private key on the client side with no problems at all. Just seems when I transfer it over the connection it messses it up somehow?! Using PrintWriter & BufferedReader on the sockets if thats of importance. EncodeBASE64 & DecodeBASE64 encode byte[] to 64base and vice versa respectively. Any ideas guys?? Client side: Socket connectionToServer = new Socket("127.0.0.1", 7050); InputStream in = connectionToServer.getInputStream(); DataInputStream dis = new DataInputStream(in); int length = dis.readInt(); byte[] data = new byte[length]; // dis.readFully(data); dis.read(data); System.out.println("The received Data*****************************************"); System.out.println("The length of bits "+ length); System.out.println(data); System.out.println("***********************************************************"); Decryption d = new Decryption(); byte [] ttt = d.decrypt(data); System.out.print(data); String ss = new String(ttt); System.out.println("***********************"); System.out.println(ss); System.out.println("************************"); Server Side: in = connectionFromClient.getInputStream(); OutputStream out = connectionFromClient.getOutputStream(); DataOutputStream dataOut = new DataOutputStream(out); LicenseList licenses = new LicenseList(); String ValidIDs = licenses.getAllIDs(); System.out.println(ValidIDs); Encryption enc = new Encryption(); byte[] encrypted = enc.encrypt(ValidIDs); byte[] dd = enc.encrypt(ValidIDs); String tobesent = new String(dd); //byte[] rsult = enc.decrypt(dd); //String tt = String(rsult); System.out.println("The sent data**********************************************"); System.out.println(dd); String temp = new String(dd); System.out.println(temp); System.out.println("*************************************************************"); //BufferedWriter bf = new BufferedWriter(OutputStreamWriter(out)); //dataOut.write(ValidIDs.getBytes().length); dataOut.writeInt(ValidIDs.getBytes().length); dataOut.flush(); dataOut.write(encrypted); dataOut.flush(); System.out.println("********Testing**************"); System.out.println("Here are the ids:::"); System.out.println(licenses.getAllIDs()); System.out.println("**********************"); //bw.write("it is working well\n");

    Read the article

  • Write to file depending on minSdkVersion - android

    - by Simon Rosenqvist
    Hi, I have written a filewriter for my android application. It is to function on a Galaxy Tab, so my minSdkVersion has to be at least 4, so it will fill the screen. I originally started out with SdkVersion = 2 and at that point my filewriter worked perfectly. Changing the SdkVersion to 4 introduced the problem. My filewriter doesn't work anymore! The application runs fine, but a file doesn't get created. My .java file looks like this: public class HelloAndroid extends Activity { /** Called when the activity is first created. */ @Override public void onCreate(Bundle savedInstanceState) { super.onCreate(savedInstanceState); TextView tv = new TextView(this); tv.setText("Hello, Android"); setContentView(R.layout.main); //definerer en knap kaldet button1 og sætter en listener på denne. Button button1 = (Button)findViewById(R.id.btnClickMe); button1.setOnClickListener(btnListener); //definerer en knap kaldet button2 og sætter en listener på denne. Button button2 = (Button)findViewById(R.id.btnClickMe2); button2.setOnClickListener(btnListener2); } //en variabel af typen 'long' deklæres og kaldes tid1. public long time1; private OnClickListener btnListener = new OnClickListener() { public void onClick(View v) { //Når der klikkes på button1 gemmes et tal i variablen tid1. time1 = System.currentTimeMillis(); } }; //en variabel af typen 'long' deklæres og kaldes tid2. public long time2; // en variabel af typen 'string' deklæres og kaldes tid: public String string1 = "time:"; private OnClickListener btnListener2 = new OnClickListener() { public void onClick(View v) { //Når der klikkes på button2 gemmes et tal i variablen tid2. time2 = System.currentTimeMillis(); // Herefter oprettes en fil kaldet "file.txt". try{ File file = new File(Environment.getExternalStorageDirectory(), "file.txt"); file.createNewFile(); BufferedWriter writer = new BufferedWriter(new FileWriter(file,true)); //string1 og tid2-tid1 skrives til filen. tid2-tid1 giver den tid der går fra der er trykket på den ene knap til den anden i millisekunder. writer.write(string1 + "\t" + (time2-time1)); writer.newLine(); writer.flush(); writer.close(); } catch (IOException e) { e.printStackTrace(); } } }; } And my manifest.xml looks like this: <?xml version="1.0" encoding="utf-8"?> <application android:icon="@drawable/icon" android:label="@string/app_name"> <activity android:name=".HelloAndroid" android:label="@string/app_name"> <intent-filter> <action android:name="android.intent.action.MAIN" /> <category android:name="android.intent.category.LAUNCHER" /> </intent-filter> </activity> </application> Why does my filewriter not work with minSdkVersion 2? Do i have to make a new filewriter? or what to do? Sorry for the messy code, i'm quite new to programming :)

    Read the article

  • ScrollPanel in java does not appear JTextarea resizes instead

    - by Casper Marcussen
    Hello everyone My program is finished, but testing it out, i found out that the scrollpanel does not appear, it just resizes the JTextarea instead. The code is provided below: package javaapplication15; import java.awt.Container; import java.awt.FlowLayout; import java.awt.event.ActionEvent; import java.awt.event.ActionListener; import java.io.*; import java.io.IOException; import javax.swing.*; public class Tekstprogram extends JFrame { public Tekstprogram() { setSize(400, 600); setDefaultCloseOperation(EXIT_ON_CLOSE); setResizable(false); Container Indhold = getContentPane(); Indhold.setLayout(new FlowLayout()); JButton openButton = new JButton("Open"); JButton saveButton = new JButton("Save"); final JLabel statusbar = new JLabel("Output of your selection will go here"); final JTextArea TekstOmråde = new JTextArea(29, 30); JScrollPane scrollText = new JScrollPane(TekstOmråde); openButton.addActionListener(new ActionListener() { public void actionPerformed(ActionEvent ae) { JFileChooser chooser = new JFileChooser(); chooser.setMultiSelectionEnabled(true); int option = chooser.showOpenDialog(Tekstprogram.this); if (option == JFileChooser.APPROVE_OPTION) { File[] sf = chooser.getSelectedFiles(); String filelist = "nothing"; if (sf.length > 0) { filelist = sf[0].getName(); } for (int i = 1; i < sf.length; i++) { filelist = filelist + ", " + sf[i].getName(); } try { String strLine; File selectedFile = chooser.getSelectedFile(); FileInputStream in = new FileInputStream(selectedFile); BufferedReader br = new BufferedReader(new InputStreamReader(in)); while ((strLine = br.readLine()) != null) { TekstOmråde.append(strLine + "\n"); } } catch (Exception e) { System.out.println("En fejl opstod ved" + e); } } } }); saveButton.addActionListener(new ActionListener() { public void actionPerformed(ActionEvent ae) { JFileChooser chooser = new JFileChooser(); int option = chooser.showSaveDialog(Tekstprogram.this); if (option == JFileChooser.APPROVE_OPTION) { File file = chooser.getSelectedFile(); try { BufferedWriter out = new BufferedWriter(new FileWriter(file)); out.write(TekstOmråde.getText()); out.close(); } catch (IOException e) { System.out.println("IOException fejl opstod :"); e.printStackTrace(); } } } }); Indhold.add(openButton); Indhold.add(saveButton); Indhold.add(TekstOmråde); Indhold.add(scrollText); Indhold.add(statusbar); } public static void main(String args[]) { Tekstprogram sfc = new Tekstprogram(); sfc.setVisible(true); } } Is there anyway to make the JTexarea static?

    Read the article

  • sort surname in alphabet from file to file JAVA

    - by user577939
    hello all. I need some help. I have wrote this code and dont now how to sort surnames in alphabet from my file to other file. import java.io.; import java.util.; class Asmuo { String pavarde; String vardas; long buvLaikas; int atv1; int atv2; int atv3; } class Irasas { Asmuo duom; Irasas kitas; } class Sarasas { private Irasas p; Sarasas() { p = null; } Irasas itrauktiElementa(String pv, String v, long laikas, int d0, int d1, int d2) { String pvrd, vrd; int data0; int data1; int data2; long lks; lks = laikas; pvrd = pv; vrd = v; data0 = d0; data1 = d1; data2 = d2; Irasas r = new Irasas(); r.duom = new Asmuo(); uzpildymasDuomenimis(r, pvrd, vrd, lks, d0, d1, d2); r.kitas = p; p = r; return r; } void uzpildymasDuomenimis(Irasas r, String pv, String v, long laik, int d0, int d1, int d2) { r.duom.pavarde = pv; r.duom.vardas = v; r.duom.atv1 = d0; r.duom.buvLaikas = laik; r.duom.atv2 = d1; r.duom.atv3 = d2; } void spausdinti() { Irasas d = p; int i = 0; try { FileWriter fstream = new FileWriter("rez.txt"); BufferedWriter rez = new BufferedWriter(fstream); while (d != null) { System.out.println(d.duom.pavarde + " " + d.duom.vardas + " " + d.duom.buvLaikas + " " + d.duom.atv1 + " " + d.duom.atv2 + " " + d.duom.atv3); rez.write(d.duom.pavarde + " " + d.duom.vardas + " " + d.duom.buvLaikas + " " + d.duom.atv1 + " " + d.duom.atv2 + " " + d.duom.atv3 + "\n"); d = d.kitas; i++; } rez.close(); } catch (Exception e) { System.err.println("Error: " + e.getMessage()); } } } public class Gyventojai { public static void main(String args[]) { Sarasas sar = new Sarasas(); Calendar atv = Calendar.getInstance(); Calendar isv = Calendar.getInstance(); try { FileInputStream fstream = new FileInputStream("duom.txt"); DataInputStream in = new DataInputStream(fstream); BufferedReader br = new BufferedReader(new InputStreamReader(in)); String eil; while ((eil = br.readLine()) != null) { String[] cells = eil.split(" "); String pvrd = cells[0]; String vrd = cells[1]; atv.set(Integer.parseInt(cells[2]), Integer.parseInt(cells[3]), Integer.parseInt(cells[4])); isv.set(Integer.parseInt(cells[5]), Integer.parseInt(cells[6]), Integer.parseInt(cells[7])); long laik = (isv.getTimeInMillis() - atv.getTimeInMillis()) / (24 * 60 * 60 * 1000); int d0 = Integer.parseInt(cells[2]); int d1 = Integer.parseInt(cells[3]); int d2 = Integer.parseInt(cells[4]); sar.itrauktiElementa(pvrd, vrd, laik, d0, d1, d2); } in.close(); } catch (Exception e) { System.err.println("Error: " + e.getMessage()); } sar.spausdinti(); } }

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • Is it okay to use try catch inside finally?

    - by Hiral Lakdavala
    Hi, I am using a buffered writer and my code, closes the writer in the finally block. My code is like this. ........... BufferedWriter theBufferedWriter = null; try{ theBufferedWriter =..... .... ...... ..... } catch (IOException anException) { .... } finally { try { theBufferedWriter.close(); } catch (IOException anException) { anException.printStackTrace(); } } I have to use the try catch inside the clean up code in finally as theBufferedWriter might also throw an IOException. I do not want to throw this exception to the calling methos. Is it a good practice to use a try catch in finally? If not what is the alternative? Please suggest. Regards, Hiral

    Read the article

  • Lackadaisical One-to-One between Char and Byte Streams

    - by Vaibhav Bajpai
    I expected to have a one-to-one correspondence between the character streams and byte streams in terms of how the classes are organized in their hierarchy. FilterReader and FilterWriter (character streams) correspond back to FilterInputStream and FilterOutputStream (byte stream) classes. However I noticed few changes as - BufferedInputStream extends FilterInputStream, but BufferedReader does NOT extend FilterReader. BufferedOutputStream and PrintStream both extend FilterOutputStream, but BufferedWriter and PrintWriter does NOT extend FilterWriter. FilterInputStream and FilterOutputStream are not abstract classes, but FilterReader and FilterWriter are. I am not sure if I am being too paranoid to point out such differences, but was just curious to know if there was design reasoning behind such decision.

    Read the article

  • Write a file in UTF-8 using FileWriter (Java)?

    - by user1280970
    I have the following code however, I want it to write as a UTF-8 file to handle foreign characters. Is there a way of doing this, is there some need to have a parameter? I would really appreciate your help with this. Thanks. try { BufferedReader reader = new BufferedReader(new FileReader("C:/Users/Jess/My Documents/actresses.list")); writer = new BufferedWriter(new FileWriter("C:/Users/Jess/My Documents/actressesFormatted.csv")); while( (line = reader.readLine()) != null) { //If the line starts with a tab then we just want to add a movie //using the current actor's name. if(line.length() == 0) continue; else if(line.charAt(0) == '\t') { readMovieLine2(0, line, surname.toString(), forename.toString()); } //Else we've reached a new actor else { readActorName(line); } } } catch (IOException e) { e.printStackTrace(); } }

    Read the article

< Previous Page | 1 2 3  | Next Page >