Search Results

Search found 14975 results on 599 pages for 'garnet os'.

Page 208/599 | < Previous Page | 204 205 206 207 208 209 210 211 212 213 214 215  | Next Page >

• "shell not found" on start of backtrack 5

  - by Jor-el

  I am using backtrack5 in VMware on my system. I was trying to change my default shell to ksh. After executing the 'chsh' command. On restarting the OS, it shows "Cannot execute ksh: no such file or directory", which apparently because of giving a bad path while changing shell. Because of this I am not able to start the OS, as I have no terminal to interact with (cannot start the GUI). Now I need to restore the previous shell, but I don't have any access to the terminal. Thanks for the help.

  Read the article

• What do user accounts do?

  - by Fasih Khatib

  Ok, this is my first time with windows server os. I started doing this out of curiosity. I have a desktop running windows server os 2003 which is connected to a wifi router. I have a laptop that connects to this router wirelessly and THIS REPRESENTS A REMOTE USER. I want to provide access to this user to a set of files ON THE SERVER. So i create an account for this user, as Start - programs - admin tools -user manager and then the steps to create an account. When i use this laptop, i log in as administrator as its the default account that came. Now when i want this laptop to be the user i just created on the server, HOW DO I DO THAT?

  Read the article

• How can I pin point a USB file transfer bottleneck in Unix?

  - by HankHendrix

  I'm experiencing very slow data transfer speeds over USB 2.0 on my nix box and was wondering how I can pin-point the cause of the problem. I've looked into iotop and top but the cpu and mem figures look normal (compared to guides I have checked). The box which is affected is Ubuntu 12.04 32bit Server running on an Asus EEE 701 2G model and I am transferring from the OS over USB 2.0 to an external HDD (which transfers at 30MB/s+ on Windows 7 on other machine). I get rsync write speeds of 1MB/s from OS to USB HDD which seems ridiculously slow. These speeds are consistent with other USB HDDs and sticks.

  Read the article

• Starting VMs with an executable with as low overhead as possible

  - by Robert Koritnik

  Is there a solution to create a virtual machine and start it by having an executable file, that will start the machine? If possible to start as quickly as possible. Strange situation? Not at all. Read on... Real life scenario Since we can't have domain controller on a non-server OS it would be nice to have domain controller in an as thin as possible machine (possibly Samba or similar because we'd like to make it startup as quickly as possible - in a matter of a few seconds) packed in a single executable. We could then configure our non-server OS to run the executable when it starts and before user logs in. This would make it possible to login into a domain.

  Read the article

• Windows 8 blue screen error watchdog violation

  - by Pramodh

  My system is windows 8 pro rtm x64. Recently my system started hanging frequently. Nothing but the restart button works. But now just after hanging it showed me a BSOD error saying watchdog violation. I used bluscreen viewer to see the error in the memory dump and it showed me something about hal.dll, ntoskrnl.exe. This is what windows showed me. Problem signature Problem Event Name: BlueScreen OS Version: 6.2.9200.2.0.0.256.48 Locale ID: 1033 Extra information about the problem BCCode: 133 BCP1: 0000000000000000 BCP2: 0000000000000281 BCP3: 0000000000000280 BCP4: 0000000000000000 OS Version: 6_2_9200 Service Pack: 0_0 Product: 256_1 Bucket ID: 0x133_DPC_NETIO!KfdClassify Server information: c03a9f52-f2b5-483f-9b4a-cbb5be3a72c0 Can anyone please walk me through the steps to get rid of this error please? Thank you.

  Read the article

• Dual boot centOS and Win7

  - by user1855965

  I posted this on stackoverflow, but it looks like superuser would be more appropriate. I have a CentOS 5 machine that runs Windows 7 as a dual boot. CentOS is the main OS and each OS is set up in a specific hard drive. This was set up before I joined the company and I don't really have need to run Windows now. My question is: can I, from CentOS, reformat the Windows HD, change GRUB settings and get the HD to be available on CentOS? Happy to provide more info if this helps. Many thanks for your help and apologies if this is a very simple issue... I don't want to blindly test things on this machine as it is used on a daily basis by several users.

  Read the article

• How can i block remote computer local or internet traffic

  - by Armen Mkrtchyan

  How can i block remote computer local or internet traffic? my Os - windows XP, which is the best program for that purpose

  Read the article

• Is it OK to create all primary partitions.?

  - by james

  I have a 320GB hard disk. I only use either ubuntu or kubuntu (12.04 for now). I don't want to use windows or any other dual boot os. And i need only 3 partitions on my hard disk. One for the OS and remaining two for data storage. I don't want to create swap also. Now can i create all primary partitions on the hard disk. Are there any disadvantages in doing so. If all the partitions are primary i think i can easily resize partitions in future. On second thought i have the idea of using seperate partition for /home. Is it good practice . If i have to do this, i will create 4 partitions all primary. In any case i don't want to create more than 4 partitions . And i know the limit will be 4. So is it safe to create all 3 or 4 primary partitions. Pls suggest me, What are the good practices . (previously i used win-xp and win-7 on dual boot with 2 primary partitions and that bugged me somehow i don't remember. Since then i felt there should be only one primary partition in a hard disk.) EDIT 1 : Now i will use four partitions in the sequence - / , /home , /for-data , /swap . I have another question. Does a partition need continuous blocks on the disk. I mean if i want to resize partitions later, can i add space from sda3 to sda1. Is it possible and is it safe to do ?

  Read the article

• windows-server-2003, windows server, download utility from command line , http or ftp or any other p

  - by Michael

  Hello , I need to know if there is anyway utility bult-in windows 2003 that I can use from the command line to download a file using only one command. Basically I know that I can download from ftp using the "ftp" utility but in order to do that I need to do first "ftp open" and then pass the other commands so it doesn't help me because I need to do perform the download only from one command. The download may be performed through http, ftp or any other protocol. OS Name: Microsoft(R) Windows(R) Server 2003 Enterprise x64 Editio OS Version: 5.2.3790 Service Pack 2 Build 379 Thank you in advance for any answer !

  Read the article

• SATA Devices not showing up when in UEFI mode

  - by Dan Barzilay

  I'm trying to install Windows and the bios should be set to UEFI mode. The problem is that all SATA devices aren't showing up (shows as if there aren't any) so I can't boot from the installation CD (it's just not there). The weird thing is that when set to LEGACY mode they all show up.. SATA mode is set to AHCI and I'm on Lenovo Y510P. I have a Linux OS installed that is accessible only when BIOS is in LEGACY mode (otherwise the hard drive it's on is not available) I also tried reseting the BIOS settings which didn't help.. Comment please if more details needed Extra details: Computer model: Lenovo IdeaPad Y510P (not overcloacked) Installed Linux OS version: Linux 3.7-trunk-amd64 x86_64 Trying to install Windows: Windows 7 Ultimate 64bit BIOS Information: Vendor: LENOVO Version: 74CN26WW(V1.07) Update: Using user1608638 answer and suggestion of using the USB flash drive as the boot device instead of the CD/DVD method I succeeded in installing Windows 7! (Thanks alot user1608638)

  Read the article

• Procedure for dual booting (2 copies of Win-7) off 2 partitions on same disk

  - by Sam Holder

  What procedure should I follow to set a dual boot (both Win-7 x64) on a machine where (ideally): Both operating systems will be installed on the same physical disk in different partitions When booting into either operating system the contents of the other OS partition disk will not be seen (this just seems safer) Other hard drives in the system will be visible by both OS's 1 copy of Win7 is already installed. Is it as simple as shrinking the existing volume and creating the partition, then sticking the CD in and booting off it and formatting the new partition and then installing another copy of windows onto the new partition? Or will that not work? Or are there gotchas?

  Read the article

• Eclipse Juno Switch Editor in Order

  - by inspectorG4dget

  In case it matters: OS: Mac OS X Lion (10.7.4) Eclipse: Juno, Build id: 20120614-1722 I have several files open in my eclipse workspace as tabs. The default shortcuts for previous and next editors are ?F6 and ?shiftF6. I know how to change these shortcuts, that's not the issue. However, what I want to do, is switch between editors in the way in which they're ordered in the tab bar. Currently, the editors change in order of last used/viewed. So, if I had three files (A, B and C in order) open and I'm currently editing A and I edited B last, when I use the shortcut for "Previous Editor", it takes me to B instead of C (and vice versa). Is there any way for me to get this functionality out of eclipse (if so, how)? Thank you

  Read the article

• Convert text to table

  - by Quattro

  I would like convert text into a table. Here is a link to the text http://www.tcdb.org/public/tcdb Short example: >gnl|TC-DB|A0CIB0|1.A.17.3.1 Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1 MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI >gnl|TC-DB|A0CS82|9.B.82.1.5 Chromosome undetermined scaffold_26, whole genome shotgun sequence - Paramecium tetraurelia. MIIEEQIEEKMIYKAIHRVKVNYQKKIDRYILYKKSRWFFNLLLMLLYAYRIQNIGGFYI VTYIYCVYQLQLLIDYFTPLGLPPVNLEDEEEDDDQFQNDFSELPTTLSNKNELNDKEFR PLLRTTSEFKVWQKSVFSVIFAYFCTYIPIWDIPVYWPFLFCYFFVIVGMSIRKYIKHMK KYGYTILDFTKKK I wanted to have columns for example delimited with pipe | or ; |>gnl|TC-DB|A0CIB0|1.A.17.3.1| Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1| MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI I am working with Windows and I don't know how to do it I just know every row starts with > I want to substitute the first whitespace in a row with a delimiter like | or ; after the first regular expression new line in a row, I want also a delimiter everything between the regular expression first new line and > should go into a new column (it's a sequence of a protein)

  Read the article

• Can't access the Internet in VMware Workstation

  - by asunnysunday

  I'm using VMware 7.1.2 in Windows 7 with Ubuntu 11.04 as a guest OS. In the host OS (Windows 7), I can access the Internet without any problems but in the virtual machine I can't access the Internet. I've tried the following but with no success: Use all methods of connecting to the Internet in "Virtual Machine Settings": Bridged, NAT, Custom; none work. Used cabled and wireless connections on the PC - neither of them work. I've used Ubuntu in VMware for several months - previously the Internet was always accessible. Could the cause of this be because I upgraded to Ubuntu 11.04?

  Read the article

• Can I delete the OEM partition on the new Dell XPS 15?

  - by timepilot

  My new Dell XPS 15 L521X just arrived. I need to set this up to dual boot Linux. Sadly, the system comes with four primary partitions. I can't do a clean install at the moment, so one of the partitions will have to be deleted before I can install Linux. The layout is as follows: OEM: 39mb Hibernation: 8gb OS: 457gb Recovery: 12gb Obviously, I can't delete the Hibernation and OS partitions (will shrink to make space for Linux) and I'd like to keep the recovery partition if possible. So my question is what is on the small OEM partition? What functionality will I lose if I delete it?

  Read the article

• Documents stored on separate internal drive, Ubuntu doesn't notice on startup

  - by PlanoAlto

  My machine has Windows 7 Ultimate x64 and Ubuntu 12.04 LTS running side-by-side on a single hard drive with GRUB bootloader, each with 500 GB storage. I keep my personal documents on a separate 1TB hard drive so they remain isolated from any changes I make to the OS drive, but when Ubuntu starts it does not seem to notice my documents drive. While I've installed and worked with Ubuntu 12.04 Server x32 before, using it as a desktop OS is new to me. I use my documents drive for all of my personal data, including wallpapers and music, so it is imperative that Ubuntu recognize it on startup. Concerning the two specific examples: Ubuntu loads with the default blue-colored desktop instead of my desired picture of the spectacular Carina galaxy. When I right-click the desktop and select "Change Desktop Background", it wakes up from its amnesia and loads the proper background. As for my music, Rhythmbox defaults to an empty library upon reboot, forcing me to reload the settings manually each time. This gets quite tedious because I certainly can't work to my full potential without my music. The second thing I would like to address is making Ubuntu point the documents directories in ~ to their appropriate counterparts on the 1TB documents drive. I realize that this question is not new, but when I create the symbolical links, they established themselves inside the directories and did not convert the directories themselves into symbolical links. I also prefer not to move the files themselves from their current location on the 1TB drive. I believe this would also help the Rhythmbox library problem as well considering it's a default directory for the music player. Excerpt from fstab: proc /proc proc nodev,noexec,nosuid 0 0 # / was on /dev/sdb6 during installation UUID=057ac83e-76ad-460d-86e5-b6d46e9b1d80 / ext4 errors=remount-ro 0 1 # swap was on /dev/sdb7 during installation #UUID=1183df90-23fc-44e4-aa17-4e7c9865d5cb none swap sw 0 0 /dev/mapper/cryptswap1 none swap sw 0 0 That's enough content for one question. I really like the Ubuntu experience so far since it doesn't treat me like an idiot out of the box (can't say the same for Windows) so I can't wait to hear from the community! Thanks for your help in advance.

  Read the article

• VPS showing low disk space despite there is nothing major on it

  - by SheoNarayyan

  Hello experts, On my VPS server I was trying to see the used disk space and when I open My Computer it shows 17.9 GB free out of 39.8 GB it means that 21.9 GB space is used. However, when I select all files and folders from C: and try to see the total size, it just count approximately 11 GB. The difference is around 10 GB. Where is this 10 GB going if I have not stored anything else here? I asked above question from my VPS provider and he responded below Check hidden files/system files/etc. This is default windows OS and its utilization and not specific to setup. If you want specifics of usage, you can go ahead and get in touch with Microsoft support team and they'll provide you with exact specification of the same. I am sure that Windows OS must not be taking up 10 GB space for hidden files and folders. My VPS has Windows Server 2008 R2 installed. Can anyone help me in this on who is right?

  Read the article

• Migrating users and IIS settings from a workgroup win2k3 machine to a new win2k8r2

  - by amber

  I am retiring my old Windows Server 2003 Standard 32bit machine to a new machine with Windows Server 2008 R2 Standard. The two sticking points are migrating user accounts (and there are a lot of them) and IIS settings/websites (again, there are a lot). The new machine has not been provisioned yet. I'm at that point where I'm about install the OS on it. The old machibe is configured with a mirrored set for its OS and data partitions. I have broken the mirror set, replicated all of the data to an external drive, and then rebuilt the mirror set. In short, I have an image of the old machine to play with while safely leaving it up and running. Thanks!

  Read the article

• How to install windows on a server with no CD or DVD drive

  - by user29266

  I've found a few posts on this site, however my situation is different. I have a new Dell server with no OS installed. I would like to install Windows 2008 Web Edition. I have a few USB ports and Ethernet. No CD or DVD drives. Is this article the best & only way to proceed? Installing Windows 2008 via USB thumbdrive or should I just get a external hardrive and hook it up to a usb. Once the OS is installed I'll never need a DVD drive again - so that's idea is a waste of money.

  Read the article

• Top causes of slow ssh logins

  - by Peter Lyons

  I'd love for one of you smart and helpful folks to post a list of common causes of delays during an ssh login. Specifically, there are 2 spots where I see a range from instantaneous to multi-second delays. Between issuing the ssh command and getting a login prompt and between entering the passphrase and having the shell load Now, specifically I'm looking at ssh details only here. Obviously network latency, speed of the hardware and OSes involved, complex login scripts, etc can cause delays. For context I ssh to a vast multitude of linux distributions and some Solaris hosts using mostly Ubuntu, CentOS, and MacOS X as my client systems. Almost all of the time, the ssh server configuration is unchanged from the OS's default settings. What ssh server configurations should I be interested in? Are there OS/kernel parameters that can be tuned? Login shell tricks? Etc?

  Read the article

• Win7 Professional x64 16GB (4.99GB usable)

  - by Killrawr

  I've installed Corsair Vengeance CMZ16GX3M2A1600C10, 2x8GB, DDR3-1600, PC3-12800, CL10, DIMM and my BIOS picks up that there is 16GB, Windows says there is 16GB, CPU-z says there is 16GB. But it only says I can use 4.99GB out of 16GB. Motherboard is P55-GD65 (MS-7583) Supports four unbuffered DIMM of 1.5 Volt DDR3 1066/1333/1600*/2000*/2133* (OC) DRAM, 16GB Max Windows (Above screenshot specifies that I am on a System type: 64-bit OS) CPU-z Microsoft says that the physical memory limit on a 64 bit win7 professional operating system is 192GB. Dxdiag Run Command BIOS Screenshot #1 BIOS Screenshot #2 Why is my OS limiting me to just over a quarter of the available memory? is there anyway to increase it?

  Read the article

• How to automatically mount a folder and change ownership from root in virtualbox

  - by Fiztban

  It is my first time using virtualbox and ubuntu (14.04), I am on a host Windows 7 OS. I am trying to mount a shared folder that has files I need to access both in the virtualbox and on the windows OS. I have successfully mounted them using the vboxsf from the Guest Additions installed. To mount I used the command sudo mount -t vboxsf <dir name in vbox> <directory in linux for example I used sudo mount -t vboxsf Test /home/user/Test I found several ways of mounting the directories automatically upon startup using for example the /etc/rc.local method (here) where you modify said file appending the command to it (without sudo). Or by using the fstab method (here). I prefer the rc.local method personally. Once mounted it has permissions dr-xr-xr-x however once mounted the directory is of root ownership and chown user /home/user/Test has no effect. This means I cannot make or change files in it as a normal user. In the VirtualBox the directory to be shared is not set as read-only. Is there a way to automatically mount the shared folder and assign ownership to my non root user?

  Read the article

• Installation on SSD with Windows preinstalled

  - by ebbot

  I bought a laptop with this fancy SSD drive, fancy new UEFI aso. I figured at first Windows out Ubuntu in but after doing 3 DoA on 3 laptops in one day I realized that maybe keeping Windows could come in handy. So dual boot it is. And this is what I've got: Disk 1 - 500 Gb HD 300 Mb Windoze only says "Healthy" don't know what it's for. 600 Mb "Healthy (EFI partition)" 186.30 Gb NTFS "OS (C:)" "Healthy (Boot, Page File, Crash Dump, Primary Partition)" 258.45 Gb NTFS "Data (D:)" "Healthy" 20.00 Gb "Healthy (Recovery Partition)" Disk 2 - 24 Gb SSD 4.00 Gb "Healthy (OEM Partition)" 18.36 Gb "Healthy (Primary Partition)" So I'm not sure what the first partition on each drive does (the 300 Gb on the HD and the OEM Partition on the SSD. Nor do I know what Data (D:). I think the 2nd partition on the SSD is for some speedup of Windoze. I'm debating if I should shrink the OS (C:) drive to around 120 GB or so. Clear the Data (D:) and also use the whole SSD for Ubuntu. That would leave me 24 Gb for e.g. / on the SSD and some 320 Gb on the HD for /home and swap. Is this a reasonable setup? Do I need to configure fstab for the SSD differently to a HD?

  Read the article

• How do I add a boot from cd option to yaboot?

  - by Sergiu

  So I'm dual-booting Ubuntu 12.04.1 on my iMac G5 powepc alongside Mac OS X and I want to add a boot cd option to yaboot because I'm trying to boot a scratched Mac OS X installation DVD that takes a while to read and the frst bootstrap moves on too fast. How do I edit the timeout for the first bootstrap anyways? So, my main question is, how do I add a cd booting option to yaboot and then, how doI boot it? The devalias from OpenFrmware tells me that 1 have 2 cd-rom instaled, on is /ht/pci@3/ata-6/disk@0 and the other on ends with a 1 instead of a zero. These are the contents of my yaboot.conf file: yaboot.conf generated by the Ubuntu installer run: "man yaboot.conf" for details. Do not make changes until you have!! see also: /usr/share/doc/yaboot/examples for example configurations. For a dual-boot menu, add one or more of: bsd=/dev/hdaX, macos=/dev/hdaY, macosx=/dev/hdaZ boot="/dev/disk/by-id/scsi-SATA_ST3160023AS_5MT1GCWA-part2" device=/ht@0,f2000000/pci@3/k2-sata-root@c/@0/@0 partition=4 root="UUID=798a048f-ee48-49e0-bba3-111aed8dee04" timeout=12000 install=/usr/lib/yaboot/yaboot magicboot=/usr/lib/yaboot/ofboot enablecdboot macosx="/dev/disk/by-id/scsi-SATA_ST3160023AS_5MT1GCWA-part3" image=/boot/vmlinux label=Linux read-only initrd=/boot/initrd.img append="quiet splash" What do I add here so that yaboot will boot from my cd in like 3 minutes after startup? Thanks!

  Read the article

• Blacklist a single access point of a wireless network

  - by Zr40

  At my university, one of the wireless access points is failing. When something tries to associate to the network using that access point, it deassociates the client, claiming 802.1X authentication failure. Other access points do work normally using the same credentials. The issue has been reported, but after a month it still has still not been fixed. Now, I'm looking for a way to blacklist the access point's BSSID, so the OS prefers other access points on the same SSID. How can I blacklist specific BSSIDs in either Mac OS X Snow Leopard or Windows 7?

  Read the article

< Previous Page | 204 205 206 207 208 209 210 211 212 213 214 215  | Next Page >