Search Results

Search found 12068 results on 483 pages for 'sv gets'.

Page 22/483 | < Previous Page | 18 19 20 21 22 23 24 25 26 27 28 29  | Next Page >

  • Default user profile getting filled with temp ie files

    - by Christoffer
    I have several Windows Server 2003 Terminal servers to service our domain users. Sometimes the Default User profile (C:\Documents and Settings\Default User) gets filled with tempoary internet files, so when a new user logs in, he gets a 1GB profile (instead of 20MB) that fills up the server fast. Why is it the default user profile gets filled up with files like that, by who and how do i prevent this?

    Read the article

  • Convert text to table

    - by Quattro
    I would like convert text into a table. Here is a link to the text http://www.tcdb.org/public/tcdb Short example: >gnl|TC-DB|A0CIB0|1.A.17.3.1 Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1 MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI >gnl|TC-DB|A0CS82|9.B.82.1.5 Chromosome undetermined scaffold_26, whole genome shotgun sequence - Paramecium tetraurelia. MIIEEQIEEKMIYKAIHRVKVNYQKKIDRYILYKKSRWFFNLLLMLLYAYRIQNIGGFYI VTYIYCVYQLQLLIDYFTPLGLPPVNLEDEEEDDDQFQNDFSELPTTLSNKNELNDKEFR PLLRTTSEFKVWQKSVFSVIFAYFCTYIPIWDIPVYWPFLFCYFFVIVGMSIRKYIKHMK KYGYTILDFTKKK I wanted to have columns for example delimited with pipe | or ; |>gnl|TC-DB|A0CIB0|1.A.17.3.1| Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1| MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI I am working with Windows and I don't know how to do it I just know every row starts with > I want to substitute the first whitespace in a row with a delimiter like | or ; after the first regular expression new line in a row, I want also a delimiter everything between the regular expression first new line and > should go into a new column (it's a sequence of a protein)

    Read the article

  • What IP's should the servers be assigned?

    - by user273284
    I have got 4 subnets (calculated using online calculators) The major network is: 172.16.0.0/16 The students subnet having the highest IP requirement /22 mask gets 172.16.0.1 - 172.16.3.254 as assignable IP's Staff subnet /23 mask gets 172.16.4.1 - 172.16.5.254 as assignable IP's Management subnet /27 mask gets 172.16.6.1 - 172.16.6.30 as assignable IP's Servers subnet /27 mask gets 172.16.6.33 - 172.16.6.62 as assignable IP's Should I follow this IP addressing scheme or should the servers get the first 30 IP's of the network i.e. 172.16.0.1 - 172.16.0.31 ? What is the best practice?

    Read the article

  • E: Sub-process /usr/bin/dpkg returned an error code (1)

    - by Joel
    I cant install or uppdate anything on my system 12.04 I get the error... installArchives() failed: dpkg: error processing libqt4-xmlpatterns (--configure): libqt4-xmlpatterns:amd64 4:4.8.1-0ubuntu4.2 cannot be configured because libqt4-xmlpatterns:i386 is in a different version (4:4.8.1-0ubuntu4.3) dpkg: error processing libqt4-xmlpatterns:i386 (--configure): libqt4-xmlpatterns:i386 4:4.8.1-0ubuntu4.3 cannot be configured because libqt4-xmlpatterns:amd64 is in a different version (4:4.8.1-0ubuntu4.2) dpkg: dependency problems prevent configuration of libqt4-declarative:i386: libqt4-declarative:i386 depends on libqt4-xmlpatterns (= 4:4.8.1-0ubuntu4.3); however: Package libqt4-xmlpatterns:i386 is not configured yet. dpkg: error processing libqt4-declarative:i386 (--configure): dependency problems - leaving unconfigured dpkg: dependency problems prevent configuration of libqt4-declarative: libqt4-declarative depends on libqt4-xmlpatterns (= 4:4.8.1-0ubuntu4.3); however: Version of libqt4-xmlpatterns on system is 4:4.8.1-0ubuntu4.2. dpkg: error processing libqt4-declarative (--configure): dependency problems - leaving unconfigured dpkg: dependency problems prevent configuration of libqtgui4:i386: libqtgui4:i386 depends on libqt4-declarative (= 4:4.8.1-0ubuntu4.3); however: Package libqt4-declarative:i386 is not configured yet. dpkg: error processing libqtgui4:i386 (--configure): dependency problems - leaving unconfigured dpkg: dependency problems prevent configuration of libqtgui4: No apport report written because the error message indicates its a followup error from a previous failure. No apport report written because the error message indicates its a followup error from a previous failure. No apport report written because MaxReports is reached already No apport report written because MaxReports is reached already No apport report written because MaxReports is reached already No apport report written because MaxReports is reached already libqtgui4 depends on libqt4-declarative (= 4:4.8.1-0ubuntu4.3); however: Package libqt4-declarative is not configured yet. dpkg: error processing libqtgui4 (--configure): dependency problems - leaving unconfigured dpkg: dependency problems prevent configuration of libqt4-designer: libqt4-designer depends on libqtgui4 (= 4:4.8.1-0ubuntu4.3); however: Package libqtgui4 is not configured yet. dpkg: error processing libqt4-designer (--configure): dependency problems - leaving unconfigured dpkg: dependency problems prevent configuration of libqt4-designer:i386: libqt4-designer:i386 depends on libqtgui4 (= 4:4.8.1-0ubuntu4.3); however: Package libqtgui4:i386 is not configured yet. dpkg: error processing libqt4-designer:i386 (--configure): dependency problems - leaving unconfigured dpkg: dependency problems prevent configuration of libqt4-opengl: libqt4-opengl depends on libqtgui4 (= 4:4.8.1-0ubuntu4.3); however: Package libqtgui4 is not configured yet. dpkg: error processing libqt4-opengl (--configure): dependency problems - leaving unconfigured dpkg: dependency problems prevent configuration of libqt4-opengl:i386: libqt4-opengl:i386 depends on libqtgui4 (= 4:4.8.1-0ubuntu4.3); however: Package libqtgui4:i386 is not configured yet. dpkg: error processing libqt4-opengl:i386 (--configure): dependency problems - leaving unconfigured dpkg: dependency problems prevent configuration of libqt4-qt3support: libqt4-qt3support depends on libqt4-designer (= 4:4.8.1-0ubuntu4.3); however: Package libqt4-designer is not configured yet. libqt4-qt3support depends on libqtgui4 (= 4:4.8.1-0ubuntu4.3); however: Package libqtgui4 is not configured yet. dpkg: error processing libqt4-qt3support (--configure): dependency problems - leaving unconfigured dpkg: dependency problems prevent configuration of libqt4-qt3support:i386: libqt4-qt3support:i386 depends on libqt4-designer (= 4:4.8.1-0ubuntu4.3); however: Package libqt4-designer:i386 is not configured yet. libqt4-qt3support:i386 depends on libqtgui4 (= 4:4.8.1-0ubuntu4.3); however: Package libqtgui4:i386 is not configured yet. dpkg: error processing libqt4-qt3support:i386 (--configure): dependency problems - leaving unconfigured dpkg: dependency problems prevent configuration of libqt4-scripttools:i386: libqt4-scripttools:i386 depends on libqtgui4 (= 4:4.8.1-0ubuntu4.3); however: Package libqtgui4:i386 is not configured yet. dpkg: error processing libqt4-scripttools:i386 (--configure): dependency problems - leaving unconfigured dpkg: dependency problems prevent configuration of libqt4-svg: libqt4-svg depends on libqtgui4 (= 4:4.8.1-0ubuntu4.3); however: Package libqtgui4 is not configured yet. dpkg: error processing libqt4-svg (--configure): dependency problems - leaving unconfigured dpkg: dependency problems prevent configuration of libqt4-svg:i386: libqt4-svg:i386 depends on libqtgui4 (= 4:4.8.1-0ubuntu4.3); however: Package libqtgui4:i386 is not configured yet. dpkg: error processing libqt4-svg:i386 (--configure): dependency problems - leaving unconfigured Errors were encountered while processing: libqt4-xmlpatterns libqt4-xmlpatterns:i386 libqt4-declarative:i386 libqt4-declarative libqtgui4:i386 libqtgui4 libqt4-designer libqt4-designer:i386 libqt4-opengl libqt4-opengl:i386 libqt4-qt3support libqt4-qt3support:i386 libqt4-scripttools:i386 libqt4-svg libqt4-svg:i386 Error in function: dpkg: dependency problems prevent configuration of libqt4-declarative: libqt4-declarative depends on libqt4-xmlpatterns (= 4:4.8.1-0ubuntu4.3); however: Version of libqt4-xmlpatterns on system is 4:4.8.1-0ubuntu4.2. dpkg: error processing libqt4-declarative (--configure): dependency problems - leaving unconfigured dpkg: error processing libqt4-xmlpatterns (--configure): libqt4-xmlpatterns:amd64 4:4.8.1-0ubuntu4.2 cannot be configured because libqt4-xmlpatterns:i386 is in a different version (4:4.8.1-0ubuntu4.3) dpkg: error processing libqt4-xmlpatterns:i386 (--configure): libqt4-xmlpatterns:i386 4:4.8.1-0ubuntu4.3 cannot be configured because libqt4-xmlpatterns:amd64 is in a different version (4:4.8.1-0ubuntu4.2) dpkg: dependency problems prevent configuration of libqtgui4: libqtgui4 depends on libqt4-declarative (= 4:4.8.1-0ubuntu4.3); however: Package libqt4-declarative is not configured yet. dpkg: error processing libqtgui4 (--configure): dependency problems - leaving unconfigured dpkg: dependency problems prevent configuration of libqt4-declarative:i386: libqt4-declarative:i386 depends on libqt4-xmlpatterns (= 4:4.8.1-0ubuntu4.3); however: Package libqt4-xmlpatterns:i386 is not configured yet. dpkg: error processing libqt4-declarative:i386 (--configure): dependency problems - leaving unconfigured dpkg: dependency problems prevent configuration of libqt4-svg: libqt4-svg depends on libqtgui4 (= 4:4.8.1-0ubuntu4.3); however: Package libqtgui4 is not configured yet. dpkg: error processing libqt4-svg (--configure): dependency problems - leaving unconfigured dpkg: dependency problems prevent configuration of libqt4-opengl: libqt4-opengl depends on libqtgui4 (= 4:4.8.1-0ubuntu4.3); however: Package libqtgui4 is not configured yet. dpkg: error processing libqt4-opengl (--configure): dependency problems - leaving unconfigured dpkg: dependency problems prevent configuration of libqt4-designer: libqt4-designer depends on libqtgui4 (= 4:4.8.1-0ubuntu4.3); however: Package libqtgui4 is not configured yet. dpkg: error processing libqt4-designer (--configure): dependency problems - leaving unconfigured dpkg: dependency problems prevent configuration of libqt4-qt3support: libqt4-qt3support depends on libqt4-designer (= 4:4.8.1-0ubuntu4.3); however: Package libqt4-designer is not configured yet. libqt4-qt3support depends on libqtgui4 (= 4:4.8.1-0ubuntu4.3); however: Package libqtgui4 is not configured yet. dpkg: error processing libqt4-qt3support (--configure): dependency problems - leaving unconfigured dpkg: dependency problems prevent configuration of libqtgui4:i386: libqtgui4:i386 depends on libqt4-declarative (= 4:4.8.1-0ubuntu4.3); however: Package libqt4-declarative:i386 is not configured yet. dpkg: error processing libqtgui4:i386 (--configure): dependency problems - leaving unconfigured dpkg: dependency problems prevent configuration of libqt4-svg:i386: libqt4-svg:i386 depends on libqtgui4 (= 4:4.8.1-0ubuntu4.3); however: Package libqtgui4:i386 is not configured yet. dpkg: error processing libqt4-svg:i386 (--configure): dependency problems - leaving unconfigured dpkg: dependency problems prevent configuration of libqt4-opengl:i386: libqt4-opengl:i386 depends on libqtgui4 (= 4:4.8.1-0ubuntu4.3); however: Package libqtgui4:i386 is not configured yet. dpkg: error processing libqt4-opengl:i386 (--configure): dependency problems - leaving unconfigured dpkg: dependency problems prevent configuration of libqt4-designer:i386: joel@Joel-PC:~$ sudo apt-get install -f [sudo] password for joel: Läser paketlistor... Färdig Bygger beroendeträd Läser tillståndsinformation... Färdig Korrigerar beroenden.... Färdig Följande paket har installerats automatiskt och är inte längre nödvändiga: kde-l10n-sv language-pack-kde-sv-base language-pack-kde-zh-hans-base calligra-l10n-engb calligra-l10n-sv calligra-l10n-zhcn language-pack-kde-en kde-l10n-engb language-pack-kde-sv language-pack-zh-hans-base kde-l10n-zhcn language-pack-zh-hans language-pack-kde-zh-hans language-pack-kde-en-base Använd "apt-get autoremove" för att ta bort dem. Följande ytterligare paket kommer att installeras: libqt4-xmlpatterns Följande paket kommer att uppgraderas: libqt4-xmlpatterns 1 att uppgradera, 0 att nyinstallera, 0 att ta bort och 22 att inte uppgradera. 15 är inte helt installerade eller borttagna. Behöver hämta 0 B/1 033 kB arkiv. Efter denna åtgärd kommer ytterligare 0 B utrymme användas på disken. Vill du fortsätta [J/n]? J dpkg: fel vid hantering av libqt4-xmlpatterns (--configure): libqt4-xmlpatterns:amd64 4:4.8.1-0ubuntu4.2 cannot be configured because libqt4-xmlpatterns:i386 is in a different version (4:4.8.1-0ubuntu4.3) dpkg: fel vid hantering av libqt4-xmlpatterns:i386 (--configure): libqt4-xmlpatterns:i386 4:4.8.1-0ubuntu4.3 cannot be configured because libqt4-xmlpatterns:amd64 is in a different version (4:4.8.1-0ubuntu4.2) dpkg: beroendeproblem förhindrar konfigurering av libqt4-declarative:i386: libqt4-declarative:i386 är beroende av libqt4-xmlpatterns (= 4:4.8.1-0ubuntu4.3), men: Paketet libqt4-xmlpatterns:i386 har inte konfigurerats ännu. dpkg: fel vid hantering av libqt4-declarative:i386 (--configure): beroendeproblem - lämnar okonfigurerad dpkg: beroendeproblem förhindrar konfigurering av libqt4-declarative: libqt4-declarative är beroende av libqt4-xmlpatterns (= 4:4.8.1-0ubuntu4.3), men: Versionen av libqt4-xmlpatterns på systemet är 4:4.8.1-0ubuntu4.2. dpkg: fel vid hantering av libqt4-declarative (--configure): beroendeproblem - lämnar okonfigurerad dpkg: beroendeproblem förhindrar konfigurering av libqtgui4:i386: libqtgui4:i386 är beroende av libqt4-declarative (= 4:4.8.1-0ubuntu4.3), men: Paketet libqt4-declarative:i386 har inte konfigurerats ännu. dpkg: fel vid hantering av libqtgui4:i386 (--configure): beroendeproblem - lämnar okonfigurerad dpkg: beroendeproblem förhindrar koIngen apport-rapport skrevs därför att felmeddelandet indikerar att det är ett efterföljande fel från ett tidigare problem. Ingen apport-rapport skrevs därför att felmeddelandet indikerar att det är ett efterföljande fel från ett tidigare problem. Ingen apport-rapport skrevs därför att felmeddelandet indikerar att det är ett efterföljande fel från ett tidigare problem. Ingen apport-rapport skrevs därför att felmeddelandet indikerar att det är ett efterföljande fel från ett tidigare problem. Ingen apport-rapport skrevs därför att felmeddelandet indikerar att det är ett efterföljande fel från ett tidigare problem. Ingen apport-rapport skrevs därför att felmeddelandet indikerar att det är ett efterföljande fel från ett tidigare problem. nfigurering av libqtgui4: libqtgui4 är beroende av libqt4-declarative (= 4:4.8.1-0ubuntu4.3), men: Paketet libqt4-declarative har inte konfigurerats ännu. dpkg: fel vid hantering av libqtgui4 (--configure): beroendeproblem - lämnar okonfigurerad dpkg: beroendeproblem förhindrar konfigurering av libqt4-designer: libqt4-designer är beroende av libqtgui4 (= 4:4.8.1-0ubuntu4.3), men: Paketet libqtgui4 har inte konfigurerats ännu. dpkg: fel vid hantering av libqt4-designer (--configure): beroendeproblem - lämnar okonfigurerad dpkg: beroendeproblem förhindrar konfigurering av libqt4-designer:i386: libqt4-designer:i386 är beroende av libqtgui4 (= 4:4.8.1-0ubuntu4.3), men: Paketet libqtgui4:i386 har inte konfigurerats ännu. dpkg: fel vid hantering av libqt4-designer:i386 (--configure): beroendeproblem - lämnar okonfigurerad dpkg: beroendeproblem förhindrar konfigurering av libqt4-opengl: libqt4-opengl är beroende av libqtgui4 (= 4:4.8.1-0ubuntu4.3), men: Paketet libqtgui4 har inte konfigurerats ännu. dpkg: fel vid hantering av libqt4-opengl (--configure): beroendeproblem - lämnar okonfigurerad dpkg: beroendeproblem förhindrar konfigurering av libqt4-opengl:i386: libqt4-opengl:i386 är beroende av libqtgui4 (= 4:4.8.1-0ubuntu4.3), men: Paketet libqtgui4:i386 har inte konfigurerats ännu. dpkg: fel vid hantering av libqt4-opengl:i386 (--configure): beroendeproblem - lämnar okonfigurerad dpkg: beroendeproblem förhindrar konfigurering av libqt4-qt3support: libqt4-qt3support är beroende av libqt4-designer (= 4:4.8.1-0ubuntu4.3), men: Paketet libqt4-designer har inte konfigurerats ännu. libqt4-qt3support är beroende av libqtgui4 (= 4:4.8.1-0ubuntu4.3), men: Paketet libqtgui4 har inte konfigurerats ännu. dpkg: fel vid hantering av libqt4-qt3support (--configure): beroendeproblem - lämnar okonfigurerad dpkg: beroendeproblem förhindrar konfigurering av libqt4-qt3support:i386: libqt4-qt3support:i386 är beroende av libqt4-designer (= 4:4.8.1-0ubuntu4.3), men: Paketet libqt4-designer:i386 har inte konfigurerats ännu. libqt4-qt3support:i386 är beroende av libqtgui4 (= 4:4.8.1-0ubuntu4.3), men: Paketet libqtgui4:i386 har inte konfigurerats ännu. dpkg: fel vid hantering av libqt4-qt3support:i386 (--configure): beroendeproblem - lämnar okonfigurerad dpkg: beroendeproblem förhindrar konfigurering av libqt4-scripttools:i386: libqt4-scripttools:i386 är beroende av libqtgui4 (= 4:4.8.1-0ubuntu4.3), men: Paketet libqtgui4:i386 har inte konfigurerats ännu. dpkg: fel vid hantering av libqt4-scripttools:i386 (--configure): beroendeproblem - lämnar okonfigurerad dpkg: beroendeproblem förhindrar konfigurering av libqt4-svg: libqt4-svg är beroende av libqtgui4 (= 4:4.8.1-0ubuntu4.3), men: Paketet libqtgui4 har inte konfigurerats ännu. dpkg: fel vid hantering av libqt4-svg (--configure): beroendeproblem - lämnar okonfigurerad dpkg: beroendeproblem förhindrar konfigurering av libqt4-svg:i386: libqt4-svg:i386 är beroende av libqtgui4 (= 4:4.8.1-0ubuntu4.3), men: Paketet libqtgui4:i386 har inte konfigurerats ännu. dpkg: fel vid hantering av libqt4-svg:i386 (--configure): beroendeproblem - lämnar okonfigurerad Fel uppstod vid hantering: libqt4-xmlpatterns libqt4-xmlpatterns:i386 libqt4-declarative:i386 libqt4-declarative libqtgui4:i386 libqtgui4 libqt4-designer libqt4-designer:i386 libqt4-opengl libqt4-opengl:i386 libqt4-qt3support libqt4-qt3support:i386 libqt4-scripttools:i386 libqt4-svg libqt4-svg:i386 E: Sub-process /usr/bin/dpkg returned an error code (1)

    Read the article

  • What are the risks of installing a "bad quality" package?

    - by ændrük
    When I try to install sonic-visualiser_1.9cc-1_amd64.deb via the Software Center the following warning message is displayed: The package is of bad quality The installation of a package which violates the quality standards isn't allowed. This could cause serious problems on your computer. Please contact the person or organisation who provided this package file and include the details beneath. Lintian check results for /home/ak/Downloads/sonic-visualiser_1.9cc-1_amd64.deb: Use of uninitialized value $ENV{"HOME"} in concatenation (.) or string at /usr/bin/lintian line 108. E: sonic-visualiser: wrong-file-owner-uid-or-gid usr/ 1000/1000 E: sonic-visualiser: wrong-file-owner-uid-or-gid usr/bin/ 1000/1000 E: sonic-visualiser: wrong-file-owner-uid-or-gid usr/bin/sonic-visualiser 1000/1000 E: sonic-visualiser: wrong-file-owner-uid-or-gid usr/share/ 1000/1000 E: sonic-visualiser: wrong-file-owner-uid-or-gid usr/share/applications/ 1000/1000 E: sonic-visualiser: wrong-file-owner-uid-or-gid usr/share/applications/sonic-visualiser.desktop 1000/1000 E: sonic-visualiser: wrong-file-owner-uid-or-gid usr/share/doc/ 1000/1000 E: sonic-visualiser: wrong-file-owner-uid-or-gid usr/share/doc/sonic-visualiser/ 1000/1000 E: sonic-visualiser: wrong-file-owner-uid-or-gid usr/share/doc/sonic-visualiser/CHANGELOG 1000/1000 E: sonic-visualiser: wrong-file-owner-uid-or-gid usr/share/doc/sonic-visualiser/COPYING 1000/1000 E: sonic-visualiser: wrong-file-owner-uid-or-gid usr/share/doc/sonic-visualiser/README 1000/1000 E: sonic-visualiser: wrong-file-owner-uid-or-gid usr/share/mimelnk/ 1000/1000 E: sonic-visualiser: wrong-file-owner-uid-or-gid usr/share/mimelnk/application/ 1000/1000 E: sonic-visualiser: wrong-file-owner-uid-or-gid usr/share/mimelnk/application/x-sonicvisualiser-layer.desktop 1000/1000 E: sonic-visualiser: wrong-file-owner-uid-or-gid usr/share/mimelnk/application/x-sonicvisualiser.desktop 1000/1000 E: sonic-visualiser: wrong-file-owner-uid-or-gid usr/share/pixmaps/ 1000/1000 E: sonic-visualiser: wrong-file-owner-uid-or-gid usr/share/pixmaps/sv-icon-light.svg 1000/1000 E: sonic-visualiser: wrong-file-owner-uid-or-gid usr/share/pixmaps/sv-icon.svg 1000/1000 I understand that this means the package doesn't meet Debian policy and I know how to override the warning and install the package anyway. What are the risks of doing so?

    Read the article

  • How do I implement SkyBox in xna 4.0 Reach Profile (for Windows Phone 7)?

    - by Biny
    I'm trying to Implement SkyBox in my phone game. Most of the samples in the web are for HiDef profile, and they are using custom effects (that not supported on Windows Phone). I've tried to follow this guide. But for some reason my SkyBox is not rendered. This is my SkyBox class: using System; using System.Collections.Generic; using Microsoft.Xna.Framework; using Microsoft.Xna.Framework.Graphics; using Rocuna.Core; using Rocuna.GameEngine.Graphics; using Rocuna.GameEngine.Graphics.Components; namespace Rocuna.GameEngine.Extension.WP7.Graphics { /// <summary> /// Sky box element for phone games. /// </summary> public class SkyBox : SkyBoxBase { /// <summary> /// Initializes a new instance of the <see cref="SkyBoxBase"/> class. /// </summary> /// <param name="game">The Game that the game component should be attached to.</param> public SkyBox(TextureCube cube, Game game) : base(game) { Cube = cube; CubeFaces = new Texture2D[6]; PositionOffset = new Vector3(20, 20, 20); CreateGraphic(512); StripTexturesFromCube(); InitializeData(Game.GraphicsDevice); } #region Properties /// <summary> /// Gets or sets the position offset. /// </summary> /// <value> /// The position offset. /// </value> public Vector3 PositionOffset { get; set; } /// <summary> /// Gets or sets the position. /// </summary> /// <value> /// The position. /// </value> public Vector3 Position { get; set; } /// <summary> /// Gets or sets the cube. /// </summary> /// <value> /// The cube. /// </value> public TextureCube Cube { get; set; } /// <summary> /// Gets or sets the pixel array. /// </summary> /// <value> /// The pixel array. /// </value> public Color[] PixelArray { get; set; } /// <summary> /// Gets or sets the cube faces. /// </summary> /// <value> /// The cube faces. /// </value> public Texture2D[] CubeFaces { get; set; } /// <summary> /// Gets or sets the vertex buffer. /// </summary> /// <value> /// The vertex buffer. /// </value> public VertexBuffer VertexBuffer { get; set; } /// <summary> /// Gets or sets the index buffer. /// </summary> /// <value> /// The index buffer. /// </value> public IndexBuffer IndexBuffer { get; set; } /// <summary> /// Gets or sets the effect. /// </summary> /// <value> /// The effect. /// </value> public BasicEffect Effect { get; set; } #endregion protected override void LoadContent() { } public override void Update(GameTime gameTime) { var camera = Game.GetService<GraphicManager>().CurrentCamera; this.Position = camera.Position + PositionOffset; base.Update(gameTime); } public override void Draw(GameTime gameTime) { DrawOrder = int.MaxValue; var graphics = Effect.GraphicsDevice; graphics.DepthStencilState = new DepthStencilState() { DepthBufferEnable = false }; graphics.RasterizerState = new RasterizerState() { CullMode = CullMode.None }; graphics.BlendState = new BlendState(); graphics.SamplerStates[0] = SamplerState.AnisotropicClamp; graphics.SetVertexBuffer(VertexBuffer); graphics.Indices = IndexBuffer; Effect.Texture = CubeFaces[0]; Effect.CurrentTechnique.Passes[0].Apply(); graphics.DrawIndexedPrimitives(PrimitiveType.TriangleList, 0, 0, _vertices.Count, 0, 2); Effect.Texture = CubeFaces[1]; Effect.CurrentTechnique.Passes[0].Apply(); graphics.DrawIndexedPrimitives(PrimitiveType.TriangleList, 0, 0, _vertices.Count, 6, 2); Effect.Texture = CubeFaces[2]; Effect.CurrentTechnique.Passes[0].Apply(); graphics.DrawIndexedPrimitives(PrimitiveType.TriangleList, 0, 0, _vertices.Count, 12, 2); Effect.Texture = CubeFaces[3]; Effect.CurrentTechnique.Passes[0].Apply(); graphics.DrawIndexedPrimitives(PrimitiveType.TriangleList, 0, 0, _vertices.Count, 18, 2); Effect.Texture = CubeFaces[4]; Effect.CurrentTechnique.Passes[0].Apply(); graphics.DrawIndexedPrimitives(PrimitiveType.TriangleList, 0, 0, _vertices.Count, 24, 2); Effect.Texture = CubeFaces[5]; Effect.CurrentTechnique.Passes[0].Apply(); graphics.DrawIndexedPrimitives(PrimitiveType.TriangleList, 0, 0, _vertices.Count, 30, 2); base.Draw(gameTime); } #region Fields private List<VertexPositionNormalTexture> _vertices = new List<VertexPositionNormalTexture>(); private List<ushort> _indices = new List<ushort>(); #endregion #region Private methods private void InitializeData(GraphicsDevice graphicsDevice) { VertexBuffer = new VertexBuffer(graphicsDevice, typeof(VertexPositionNormalTexture), _vertices.Count, BufferUsage.None); VertexBuffer.SetData<VertexPositionNormalTexture>(_vertices.ToArray()); // Create an index buffer, and copy our index data into it. IndexBuffer = new IndexBuffer(graphicsDevice, typeof(ushort), _indices.Count, BufferUsage.None); IndexBuffer.SetData<ushort>(_indices.ToArray()); // Create a BasicEffect, which will be used to render the primitive. Effect = new BasicEffect(graphicsDevice); Effect.TextureEnabled = true; Effect.EnableDefaultLighting(); } private void CreateGraphic(float size) { Vector3[] normals = { Vector3.Right, Vector3.Left, Vector3.Up, Vector3.Down, Vector3.Backward, Vector3.Forward, }; Vector2[] textureCoordinates = { Vector2.One, Vector2.UnitY, Vector2.Zero, Vector2.UnitX, Vector2.Zero, Vector2.UnitX, Vector2.One, Vector2.UnitY, Vector2.Zero, Vector2.UnitX, Vector2.One, Vector2.UnitY, Vector2.Zero, Vector2.UnitX, Vector2.One, Vector2.UnitY, Vector2.UnitY, Vector2.Zero, Vector2.UnitX, Vector2.One, Vector2.UnitY, Vector2.Zero, Vector2.UnitX, Vector2.One, }; var index = 0; foreach (var normal in normals) { var side1 = new Vector3(normal.Z, normal.X, normal.Y); var side2 = Vector3.Cross(normal, side1); AddIndex(CurrentVertex + 0); AddIndex(CurrentVertex + 1); AddIndex(CurrentVertex + 2); AddIndex(CurrentVertex + 0); AddIndex(CurrentVertex + 2); AddIndex(CurrentVertex + 3); AddVertex((normal - side1 - side2) * size / 2, normal, textureCoordinates[index++]); AddVertex((normal - side1 + side2) * size / 2, normal, textureCoordinates[index++]); AddVertex((normal + side1 + side2) * size / 2, normal, textureCoordinates[index++]); AddVertex((normal + side1 - side2) * size / 2, normal, textureCoordinates[index++]); } } protected void StripTexturesFromCube() { PixelArray = new Color[Cube.Size * Cube.Size]; for (int s = 0; s < CubeFaces.Length; s++) { CubeFaces[s] = new Texture2D(Game.GraphicsDevice, Cube.Size, Cube.Size, false, SurfaceFormat.Color); switch (s) { case 0: Cube.GetData<Color>(CubeMapFace.PositiveX, PixelArray); CubeFaces[s].SetData<Color>(PixelArray); break; case 1: Cube.GetData(CubeMapFace.NegativeX, PixelArray); CubeFaces[s].SetData(PixelArray); break; case 2: Cube.GetData(CubeMapFace.PositiveY, PixelArray); CubeFaces[s].SetData(PixelArray); break; case 3: Cube.GetData(CubeMapFace.NegativeY, PixelArray); CubeFaces[s].SetData(PixelArray); break; case 4: Cube.GetData(CubeMapFace.PositiveZ, PixelArray); CubeFaces[s].SetData(PixelArray); break; case 5: Cube.GetData(CubeMapFace.NegativeZ, PixelArray); CubeFaces[s].SetData(PixelArray); break; } } } protected void AddVertex(Vector3 position, Vector3 normal, Vector2 textureCoordinates) { _vertices.Add(new VertexPositionNormalTexture(position, normal, textureCoordinates)); } protected void AddIndex(int index) { if (index > ushort.MaxValue) throw new ArgumentOutOfRangeException("index"); _indices.Add((ushort)index); } protected int CurrentVertex { get { return _vertices.Count; } } #endregion } }

    Read the article

  • Preventing item duplication?

    - by PuppyKevin
    For my game, there's two types of items - stackable, and nonstackable. Nonstackable items get assigned a unique ID that stays with it forever. A character ID is assosicated with the item, as is a state (CHANGED, UNCHANGED, NEW, REMOVED). The character ID and state is used for item saving purposes. Stackable items have one unique ID, as in the entire stack has one unique ID. For example: 5 Potions (stacked ontop of each other) has one unique ID. When dropping a nonstackable item, the state gets set to REMOVED, and the unique ID and state don't change. If picked up by another player, the state gets set to NEW, and the character ID gets changed to the new character's ID. When dropping all items in a stack of stackable items (for example, 5 potions out of 5) - it behaves just like a nonstackable item. When dropping some of a stack of stackable items (for example, 3 potions out of 5)... I really have no clue what to do. The 3 dropped potions have the state of REMOVED, but the same unique ID and character ID. If another player picks it up, it has no choice but to obtain a new unique ID, and its state gets changed to NEW and its character ID to the new one. If the dropping player picks it back up, they'd just be readded to the stack. There's two issues with that though. 1. If the player who dropped the 3 potions picks it back up, there's no way to tell if they legitimately dropped the items, or if they're duped items. 2. If another player picks up the 3 potions (assuming they're duped), there's no way to know if they're duped or not. My question is: How can I create a system that detects duplicated items for both nonstackable and stackable items?

    Read the article

  • How do I drag my widgets without dragging other widgets?

    - by Cypher
    I have a bunch of drag-able widgets on screen. When I am dragging one of the widgets around, if I drag the mouse over another widget, that widget then gets "snagged" and is also dragged around. While this is kind of a neat thing and I can think of a few game ideas based on that alone, that was not intended. :-P Background Info I have a Widget class that is the basis for my user interface controls. It has a bunch of properties that define it's size, position, image information, etc. It also defines some events, OnMouseOver, OnMouseOut, OnMouseClick, etc. All of the event handler functions are virtual, so that child objects can override them and make use of their implementation without duplicating code. Widgets are not aware of each other. They cannot tell each other, "Hey, I'm dragging so bugger off!" Source Code Here's where the widget gets updated (every frame): public virtual void Update( MouseComponent mouse, KeyboardComponent keyboard ) { // update position if the widget is being dragged if ( this.IsDragging ) { this.Left -= (int)( mouse.LastPosition.X - mouse.Position.X ); this.Top -= (int)( mouse.LastPosition.Y - mouse.Position.Y ); } ... // define and throw other events if ( !this.WasMouseOver && this.IsMouseOver && mouse.IsButtonDown( MouseButton.Left ) ) { this.IsMouseDown = true; this.MouseDown( mouse, new EventArgs() ); } ... // define and throw other events } And here's the OnMouseDown event where the IsDraggable property gets set: public virtual void OnMouseDown( object sender, EventArgs args ) { if ( this.IsDraggable ) { this.IsDragging = true; } } Problem Looking at the source code, it's obvious why this is happening. The OnMouseDown event gets fired whenever the mouse is hovered over the Widget and when the left mouse button is "down" (but not necessarily in that order!). That means that even if I hold the mouse down somewhere else on screen, and simply move it over anything that IsDraggable, it will "hook" onto the mouse and go for a ride. So, now that it's obvious that I'm Doing It Wrong™, how do I do this correctly?

    Read the article

  • How is an HTML5 game sold?

    - by Bane
    (I know this site doesn't give legal advice, but what I'm dealing here with isn't anything serious at all. Also, I apologize to JP for being annoying over this.) Someone found a game I made on the Internet, and expressed interest in buying it. We agreed upon a price, and, in the meantime, I removed the game's source from the Internet, just to be sure. Now, I'm wondering what to do next. These are the terms: He gets the game's source code, and only that, without the graphics (which weren't made by me). He gets the right to develop and sell the game. I get to keep the ownership of the original game, meaning that I can use it in my portfolio when applying for jobs, for example. The game gets to stay on its original site. But I am not sure how can I legally realize this. Which license can I use?

    Read the article

  • Mixing Forms and Token Authentication in a single ASP.NET Application (the Details)

    - by Your DisplayName here!
    The scenario described in my last post works because of the design around HTTP modules in ASP.NET. Authentication related modules (like Forms authentication and WIF WS-Fed/Sessions) typically subscribe to three events in the pipeline – AuthenticateRequest/PostAuthenticateRequest for pre-processing and EndRequest for post-processing (like making redirects to a login page). In the pre-processing stage it is the modules’ job to determine the identity of the client based on incoming HTTP details (like a header, cookie, form post) and set HttpContext.User and Thread.CurrentPrincipal. The actual page (in the ExecuteHandler event) “sees” the identity that the last module has set. So in our case there are three modules in effect: FormsAuthenticationModule (AuthenticateRequest, EndRequest) WSFederationAuthenticationModule (AuthenticateRequest, PostAuthenticateRequest, EndRequest) SessionAuthenticationModule (AuthenticateRequest, PostAuthenticateRequest) So let’s have a look at the different scenario we have when mixing Forms auth and WS-Federation. Anoymous request to unprotected resource This is the easiest case. Since there is no WIF session cookie or a FormsAuth cookie, these modules do nothing. The WSFed module creates an anonymous ClaimsPrincipal and calls the registered ClaimsAuthenticationManager (if any) to transform it. The result (by default an anonymous ClaimsPrincipal) gets set. Anonymous request to FormsAuth protected resource This is the scenario where an anonymous user tries to access a FormsAuth protected resource for the first time. The principal is anonymous and before the page gets rendered, the Authorize attribute kicks in. The attribute determines that the user needs authentication and therefor sets a 401 status code and ends the request. Now execution jumps to the EndRequest event, where the FormsAuth module takes over. The module then converts the 401 to a redirect (302) to the forms login page. If authentication is successful, the login page sets the FormsAuth cookie.   FormsAuth authenticated request to a FormsAuth protected resource Now a FormsAuth cookie is present, which gets validated by the FormsAuth module. This cookie gets turned into a GenericPrincipal/FormsIdentity combination. The WS-Fed module turns the principal into a ClaimsPrincipal and calls the registered ClaimsAuthenticationManager. The outcome of that gets set on the context. Anonymous request to STS protected resource This time the anonymous user tries to access an STS protected resource (a controller decorated with the RequireTokenAuthentication attribute). The attribute determines that the user needs STS authentication by checking the authentication type on the current principal. If this is not Federation, the redirect to the STS will be made. After successful authentication at the STS, the STS posts the token back to the application (using WS-Federation syntax). Postback from STS authentication After the postback, the WS-Fed module finds the token response and validates the contained token. If successful, the token gets transformed by the ClaimsAuthenticationManager, and the outcome is a) stored in a session cookie, and b) set on the context. STS authenticated request to an STS protected resource This time the WIF Session authentication module kicks in because it can find the previously issued session cookie. The module re-hydrates the ClaimsPrincipal from the cookie and sets it.     FormsAuth and STS authenticated request to a protected resource This is kind of an odd case – e.g. the user first authenticated using Forms and after that using the STS. This time the FormsAuth module does its work, and then afterwards the session module stomps over the context with the session principal. In other words, the STS identity wins.   What about roles? A common way to set roles in ASP.NET is to use the role manager feature. There is a corresponding HTTP module for that (RoleManagerModule) that handles PostAuthenticateRequest. Does this collide with the above combinations? No it doesn’t! When the WS-Fed module turns existing principals into a ClaimsPrincipal (like it did with the FormsIdentity), it also checks for RolePrincipal (which is the principal type created by role manager), and turns the roles in role claims. Nice! But as you can see in the last scenario above, this might result in unnecessary work, so I would rather recommend consolidating all role work (and other claims transformations) into the ClaimsAuthenticationManager. In there you can check for the authentication type of the incoming principal and act accordingly. HTH

    Read the article

  • Bouncing ball slowing down over time

    - by user46610
    I use the unreal engine 4 to bounce a ball off of walls in a 2D space, but over time the ball gets slower and slower. Movement happens in the tick function of the ball FVector location = GetActorLocation(); location.X += this->Velocity.X * DeltaSeconds; location.Y += this->Velocity.Y * DeltaSeconds; SetActorLocation(location, true); When a wall gets hit I get a Hit Event with the normal of the collision. This is how I calculate the new velocity of the ball: FVector2D V = this->Velocity; FVector2D N = FVector2D(HitNormal.X, HitNormal.Y); FVector2D newVelocity = -2 * (V.X * N.X + V.Y * N.Y) * N + V; this->Velocity = newVelocity; Over time, the more the ball bounced around, the velocity gets smaller and smaller. How do I prevent speed loss when bouncing off walls like that? It's supposed to be a perfect bounce without friction or anything.

    Read the article

  • Tab navigation and double content

    - by Guisasso
    I have a website in which i use tabs to navigate between pages. For example, page a displays A as an active tab and B and C background tabs. If the visitor gets to the website via page B, i also would like to display to page d, but not a and c. Question: I know i can just create index2 for b for example, so when the visitor gets to b from a, i display a,b,c and index1 when visitor gets to b from d for example. Is that a bad practice? I know double content isn't good, but in which other way can i or should i approach this problem? The tab navigation i designed uses < li and id tag do display active tab, defined in the < body tag.

    Read the article

  • 12.04 LTS won't install from CD

    - by Rob Hays
    I've been trying to install 12.04 LTS onto a Dell with a PIII from CD. Booting from the CD the install gets through the "Who are you" process, begins copying files. The progress bar gets as far as the last period in "Copying files...". The box clears, and an error box comes up "The installer has encountered an unrecoverable error. A desktop session will now be run so that you may investigae the problem or try installing again." When I try to install from this desktop session, the install gets to the same point, the copying files box closes, and then just stops. The pointer is busy, the cd drive spins up occaisonally with no data transfer, no hard drive activity. When I boot from the CD and access the disk boot menu, the disk checks good, memory checks good ( I upgraded the original memory to 512 mb). I also updated the bios to the newest from Dell. This is an older L866r, but should meet the requirements.

    Read the article

  • Is it reasonable for REST resources to be singular and plural?

    - by Evan
    I have been wondering if, rather than a more traditional layout like this: api/Products GET // gets product(s) by id PUT // updates product(s) by id DELETE // deletes (product(s) by id POST // creates product(s) Would it be more useful to have a singular and a plural, for example: api/Product GET // gets a product by id PUT // updates a product by id DELETE // deletes a product by id POST // creates a product api/Products GET // gets a collection of products by id PUT // updates a collection of products by id DELETE // deletes a collection of products (not the products themselves) POST // creates a collection of products based on filter parameters passed So, to create a collection of products you might do: POST api/Products {data: filters} // returns api/Products/<id> And then, to reference it, you might do: GET api/Products/<id> // returns array of products In my opinion, the main advantage of doing things this way is that it allows for easy caching of collections of products. One might, for example, put a lifetime of an hour on collections of products, thus drastically reducing the calls on a server. Of course, I currently only see the good side of doing things this way, what's the downside?

    Read the article

  • Wcf IInstanceProvider Behaviour never calling Realease() ?

    - by Jon
    Hi, I'm implementing my own IInstanceProvider class to override the creation and realease of new service instances but the Release() method never gets called on my implemented class? It's implemented using an IServiceBehavior to attach to the exposed endpoint. No matter how hard we hammer the service the Relaease() method nevers gets called. We have the service running a per call instanceContext mode with 50 instance max. The deconstruct of the service instance gets called but not on all created instance and this looks like the gargageCollection rather than wcf realeasing and disposing. Any ideas why the Release() method never gets called? Thanks in Advance, Jon

    Read the article

  • Does libpcap get a copy of the packet ?

    - by ShaChris23
    Does libpcap get a copy of the packet or the actual packet? By copy, I mean: the application using libpcap gets packet A, and the kernel also gets packet A. By actual, I mean: only the application using libpcap gets packet A, but the kernel didn't get it.

    Read the article

  • jQuery form check - iframe content check empty

    - by Henry
    Please check out the comment field at the bottom on http://tinyurl.com/3xow97t in Firefox - it works pretty well - the red warning gets added if empty and the submit gets disabled - once there is text inside, the submit gets re-enabled. the problem i have now, it does not work in IE. i really hope somebody can help. the iframe contents checks are inside: modules/editor/scripts/global.js

    Read the article

  • Scale image to completely fill bounding box

    - by Larsenal
    For instance, if I need to fill a bounding box that is 100px wide by 50px tall, the following input images would have the following behavior: 200w x 200h gets scaled down 50% and 25% gets chopped off the top and bottom. 200w x 100h gets scaled down 50% with no cropping. 100w x 200h gets is not scaled, but 75px get chopped off top and bottom. This seems like it'd be a common resizing function, but I haven't been able to track down an example of the algorithm. Will accept answer in any language including pseudo code. A link to a page with the answer is great too!

    Read the article

  • Reading POST data from html form sent to serversocket.

    - by user32167
    i try to write simplest possible server app in Java, displaying html form with textarea input, which after submitting gives me possibility to parse xml typed in that textarea. For now i build simple serversocket based server like that: import java.io.BufferedReader; import java.io.InputStreamReader; import java.io.PrintWriter; import java.net.ServerSocket; import java.net.Socket; public class WebServer { protected void start() { ServerSocket s; String gets = ""; System.out.println("Start on port 80"); try { // create the main server socket s = new ServerSocket(80); } catch (Exception e) { System.out.println("Error: " + e); return; } System.out.println("Waiting for connection"); for (;;) { try { // wait for a connection Socket remote = s.accept(); // remote is now the connected socket System.out.println("Connection, sending data."); BufferedReader in = new BufferedReader(new InputStreamReader( remote.getInputStream())); PrintWriter out = new PrintWriter(remote.getOutputStream()); String str = "."; while (!str.equals("")) { str = in.readLine(); if (str.contains("GET")){ gets = str; break; } } out.println("HTTP/1.0 200 OK"); out.println("Content-Type: text/html"); out.println(""); // Send the HTML page String method = "get"; out.print("<html><form method="+method+">"); out.print("<textarea name=we></textarea></br>"); out.print("<input type=text name=a><input type=submit></form></html>"); out.println(gets); out.flush(); remote.close(); } catch (Exception e) { System.out.println("Error: " + e); } } } public static void main(String args[]) { WebServer ws = new WebServer(); ws.start(); } } After form (textarea with xml and one additional text input) is submitted in 'gets' String-type variable I have Urlencoded values of my variables (also displayed on the screen, it looks like that: gets = GET /?we=%3Cnetwork+ip_addr%3D%2210.0.0.0%2F8%22+save_ip%3D%22true%22%3E%0D%0A%3Csubnet+interf_used%3D%22200%22+name%3D%22lan1%22+%2F%3E%0D%0A%3Csubnet+interf_used%3D%22254%22+name%3D%22lan2%22+%2F%3E%0D%0A%3C%2Fnetwork%3E&a=fooBar HTTP/1.1 What can i do to change GET to POST method (if i simply change it in form and than put " if (str.contains("POST")){" it gives me string like gets = POST / HTTP/1.1 with no variables. And after that, how i can use xml from my textarea field (called 'we')?

    Read the article

  • Using Loops for prompts with If/Else/Esif

    - by Dante
    I started with: puts "Hello there, and what's your favorite number?" favnum = gets.to_i puts "Your favorite number is #{favnum}?" " A better favorite number is #{favnum + 1}!" puts "Now, what's your favorite number greater than 10?" favnumOverTen = gets.to_i if favnumOverTen < 10 puts "Hey! I said GREATER than 10! Try again buddy." else puts "Your favorite number great than 10 is #{favnumOverTen}?" puts "A bigger and better number over 10 is #{favnumOverTen * 10}!" puts "It's literally 10 times better!" end That worked fine, but if the user entered a number less than 10 the program ended. I want the user to be prompted to try again until they enter a number greater than 10. Am I supposed to do that with a loop? Here's what I took a swing at, but clearly it's wrong: puts "Hello there, and what's your favorite number?" favnum = gets.to_i puts "Your favorite number is #{favnum}?" " A better favorite number is #{favnum + 1}!" puts "Now, what's your favorite number greater than 10?" favnumOverTen = gets.to_i if favnumOverTen < 10 loop.do puts "Hey! I said GREATER than 10! Try again buddy." favnumOverTen = gets.to_i until favnumOverTen > 10 else puts "Your favorite number great than 10 is #{favnumOverTen}?" puts "A bigger and better number over 10 is #{favnumOverTen * 10}!" puts "It's literally 10 times better!" end

    Read the article

  • [java] reading POST data from html form sent to serversocket.

    - by user32167
    i try to write simplest possible server app in Java, displaying html form with textarea input, which after submitting gives me possibility to parse xml typed in thet textarea. For now i build simple serversocket based server like that: import java.io.BufferedReader; import java.io.InputStreamReader; import java.io.PrintWriter; import java.net.ServerSocket; import java.net.Socket; public class WebServer { protected void start() { ServerSocket s; String gets = ""; System.out.println("Start on port 80"); try { // create the main server socket s = new ServerSocket(80); } catch (Exception e) { System.out.println("Error: " + e); return; } System.out.println("Waiting for connection"); for (;;) { try { // wait for a connection Socket remote = s.accept(); // remote is now the connected socket System.out.println("Connection, sending data."); BufferedReader in = new BufferedReader(new InputStreamReader( remote.getInputStream())); PrintWriter out = new PrintWriter(remote.getOutputStream()); String str = "."; while (!str.equals("")) { str = in.readLine(); if (str.contains("GET")){ gets = str; break; } } out.println("HTTP/1.0 200 OK"); out.println("Content-Type: text/html"); out.println(""); // Send the HTML page String method = "get"; out.print("<html><form method="+method+">"); out.print("<textarea name=we></textarea></br>"); out.print("<input type=text name=a><input type=submit></form></html>"); out.println(gets); out.flush(); remote.close(); } catch (Exception e) { System.out.println("Error: " + e); } } } public static void main(String args[]) { WebServer ws = new WebServer(); ws.start(); } } After form (textarea with xml and one additional text input) is submitted in 'gets' String-type variable I have Urlencoded values of my variables (also displayed on the screen, it looks like that: gets = GET /?we=%3Cnetwork+ip_addr%3D%2210.0.0.0%2F8%22+save_ip%3D%22true%22%3E%0D%0A%3Csubnet+interf_used%3D%22200%22+name%3D%22lan1%22+%2F%3E%0D%0A%3Csubnet+interf_used%3D%22254%22+name%3D%22lan2%22+%2F%3E%0D%0A%3C%2Fnetwork%3E&a=fooBar HTTP/1.1 What can i do to change GET to POST method (if i simply change it in form and than put " if (str.contains("GET")){" it gives me string like gets = POST / HTTP/1.1 with no variables. And after that, how i can use xml from my textarea field (called 'we')?

    Read the article

  • Using a named system semaphore as an event to trigger something in another process.

    - by jbraz
    I have a thread that runs all the time: private void DoSomeStuffThread() { Semaphore sem = new Semaphore(0, 3, "sem_DoStuff"); sem.WaitOne(); do { //do some stuff } while (sem.WaitOne()); } I want to be able to only execute the stuff in the do block when something from another process says so. I am trying to use the "sem_DoStuff" named system semaphore to allow this to happen. The code that gets executed in my other process: public string DoStuff() { try { Semaphore sem = Semaphore.OpenExisting("sem_DoStuff"); sem.Release(); } catch (Exception e) { return e.Message; } } So, the idea is that when DoStuff gets called, the semaphore gets released, and DoSomeStuffThread stops waiting, executes what is in the do block, and then waits for DoStuff again before it is getting called. But, when DoStuff gets called, I'm getting the exception 'No handle of the given name exists.'. What am I doing wrong? Thanks.

    Read the article

  • Questions About SQl BulkCopy

    - by chobo2
    Hi I am wondering how can do a mass insert and bulk copy at the same time? I have 2 tables that should be affect by the bulk copy as they both depend on each other. So I want it that if while inserting table 1 a record dies it gets rolled back and table 2 never gets updated. Also if table 1 inserts good and table 2 an update fails table 1 gets rolled back. Can this be done with bulk copy?

    Read the article

  • copy - paste in javascript

    - by Dumbledore of flash
    I have this code <input name="mpan[]" value="" maxlength="2" size="2"> <input name="mpan[]" value="" maxlength="2" size="3"> <input name="mpan[]" value="" maxlength="2" size="3"> <input name="mpan[]" value="" maxlength="2" size="12"> What I have to do is I am provided with a large key for example 0380112129021. When I do Ctrl+C on that key and select any box and press Ctrl+V, the number automatically get pasted in different box, for example: first input box gets 03, next gets 801, next gets 112 and rest gets pasted on last one 129021.how do i achive this from javascript

    Read the article

< Previous Page | 18 19 20 21 22 23 24 25 26 27 28 29  | Next Page >