Search Results

Search found 18702 results on 749 pages for 'digital input'.

Page 228/749 | < Previous Page | 224 225 226 227 228 229 230 231 232 233 234 235  | Next Page >

  • $_POST data returns empty when headers are > POST_MAX_SIZE

    - by Jared
    Hi Hopefully someone here might have an answer to my question. I have a basic form that contains simple fields, like name, number, email address etc and 1 file upload field. I am trying to add some validation into my script that detects if the file is too large and then rejects the user back to the form to select/upload a smaller file. My problem is, if a user selects a file that is bigger than my validation file size rule and larger than php.ini POST_MAX_SIZE/UPLOAD_MAX_FILESIZE and pushes submit, then PHP seems to try process the form only to fail on the POST_MAX_SIZE settings and then clears the entire $_POST array and returns nothing back to the form. Is there a way around this? Surely if someone uploads something than the max size configured in the php.ini then you can still get the rest of the $_POST data??? Here is my code. <?php function validEmail($email) { $isValid = true; $atIndex = strrpos($email, "@"); if (is_bool($atIndex) && !$atIndex) { $isValid = false; } else { $domain = substr($email, $atIndex+1); $local = substr($email, 0, $atIndex); $localLen = strlen($local); $domainLen = strlen($domain); if ($localLen < 1 || $localLen > 64) { // local part length exceeded $isValid = false; } else if ($domainLen < 1 || $domainLen > 255) { // domain part length exceeded $isValid = false; } else if ($local[0] == '.' || $local[$localLen-1] == '.') { // local part starts or ends with '.' $isValid = false; } else if (preg_match('/\\.\\./', $local)) { // local part has two consecutive dots $isValid = false; } else if (!preg_match('/^[A-Za-z0-9\\-\\.]+$/', $domain)) { // character not valid in domain part $isValid = false; } else if (preg_match('/\\.\\./', $domain)) { // domain part has two consecutive dots $isValid = false; } else if (!preg_match('/^(\\\\.|[A-Za-z0-9!#%&`_=\\/$\'*+?^{}|~.-])+$/', str_replace("\\\\","",$local))) { // character not valid in local part unless // local part is quoted if (!preg_match('/^"(\\\\"|[^"])+"$/', str_replace("\\\\","",$local))) { $isValid = false; } } } return $isValid; } //setup post variables @$name = htmlspecialchars(trim($_REQUEST['name'])); @$emailCheck = htmlspecialchars(trim($_REQUEST['email'])); @$organisation = htmlspecialchars(trim($_REQUEST['organisation'])); @$title = htmlspecialchars(trim($_REQUEST['title'])); @$phone = htmlspecialchars(trim($_REQUEST['phone'])); @$location = htmlspecialchars(trim($_REQUEST['location'])); @$description = htmlspecialchars(trim($_REQUEST['description'])); @$fileError = 0; @$phoneError = ""; //setup file upload handler $target_path = 'uploads/'; $filename = basename( @$_FILES['uploadedfile']['name']); $max_size = 8000000; // maximum file size (8mb in bytes) NB: php.ini max filesize upload is 10MB on test environment. $allowed_filetypes = Array(".pdf", ".doc", ".zip", ".txt", ".xls", ".docx", ".csv", ".rtf"); //put extensions in here that should be uploaded only. $ext = substr($filename, strpos($filename,'.'), strlen($filename)-1); // Get the extension from the filename. if(!is_writable($target_path)) die('You cannot upload to the specified directory, please CHMOD it to 777.'); //Check if we can upload to the specified upload folder. //display form function function displayForm($name, $emailCheck, $organisation, $phone, $title, $location, $description, $phoneError, $allowed_filetypes, $ext, $filename, $fileError) { //make $emailCheck global so function can get value from global scope. global $emailCheck; global $max_size; echo '<form action="geodetic_form.php" method="post" name="contact" id="contact" enctype="multipart/form-data">'."\n". '<fieldset>'."\n".'<div>'."\n"; //name echo '<label for="name"><span class="mandatory">*</span>Your name:</label>'."\n". '<input type="text" name="name" id="name" class="inputText required" value="'. $name .'" />'."\n"; //check if name field is filled out if (isset($_REQUEST['submit']) && empty($name)) { echo '<label for="name" class="error">Please enter your name.</label>'."\n"; } echo '</div>'."\n". '<div>'."\n"; //Email echo '<label for="email"><span class="mandatory">*</span>Your email:</label>'."\n". '<input type="text" name="email" id="email" class="inputText required email" value="'. $emailCheck .'" />'."\n"; // check if email field is filled out and proper format if (isset($_REQUEST['submit']) && validEmail($emailCheck) == false) { echo '<label for="email" class="error">Invalid email address entered.</label>'."\n"; } echo '</div>'."\n". '<div>'."\n"; //organisation echo '<label for="phone">Organisation:</label>'."\n". '<input type="text" name="organisation" id="organisation" class="inputText" value="'. $organisation .'" />'."\n"; echo '</div>'."\n". '</fieldset>'."\n".'<fieldset>'. "\n" . '<div>'."\n"; //title echo '<label for="phone">Title:</label>'."\n". '<input type="text" name="title" id="title" class="inputText" value="'. $title .'" />'."\n"; echo '</div>'."\n". '</fieldset>'."\n".'<fieldset>'. "\n" . '<div>'."\n"; //phone echo '<label for="phone"><span class="mandatory">*</span>Phone <br /><span class="small">(include area code)</span>:</label>'."\n". '<input type="text" name="phone" id="phone" class="inputText required" value="'. $phone .'" />'."\n"; // check if phone field is filled out that it has numbers and not characters if (isset($_REQUEST['submit']) && $phoneError == "true" && empty($phone)) echo '<label for="email" class="error">Please enter a valid phone number.</label>'."\n"; echo '</div>'."\n". '</fieldset>'."\n".'<fieldset>'. "\n" . '<div>'."\n"; //Location echo '<label class="location" for="location"><span class="mandatory">*</span>Location:</label>'."\n". '<textarea name="location" id="location" class="required">'. $location .'</textarea>'."\n"; //check if message field is filled out if (isset($_REQUEST['submit']) && empty($_REQUEST['location'])) echo '<label for="location" class="error">This field is required.</label>'."\n"; echo '</div>'."\n". '</fieldset>'."\n".'<fieldset>'. "\n" . '<div>'."\n"; //description echo '<label class="description" for="description">Description:</label>'."\n". '<textarea name="description" id="queryComments">'. $description .'</textarea>'."\n"; echo '</div>'."\n". '</fieldset>'."\n".'<fieldset>'. "\n" . '<div>'."\n"; //file upload echo '<label class="uploadedfile" for="uploadedfile">File:</label>'."\n". '<input type="file" name="uploadedfile" id="uploadedfile" value="'. $filename .'" />'."\n"; // Check if the filetype is allowed, if not DIE and inform the user. switch ($fileError) { case "1": echo '<label for="uploadedfile" class="error">The file you attempted to upload is not allowed.</label>'; break; case "2": echo '<label for="uploadedfile" class="error">The file you attempted to upload is too large.</label>'; break; } echo '</div>'."\n". '</fieldset>'; //end of form echo '<div class="submit"><input type="submit" name="submit" value="Submit" id="submit" /></div>'. '<div class="clear"><p><br /></p></div>'; } //end function //setup error validations if (isset($_REQUEST['submit']) && !empty($_REQUEST['phone']) && !is_numeric($_REQUEST['phone'])) $phoneError = "true"; if (isset($_REQUEST['submit']) && $_FILES['uploadedfile']['error'] != 4 && !in_array($ext, $allowed_filetypes)) $fileError = 1; if (isset($_REQUEST['submit']) && $_FILES["uploadedfile"]["size"] > $max_size) $fileError = 2; echo "this condition " . $fileError; $POST_MAX_SIZE = ini_get('post_max_size'); $mul = substr($POST_MAX_SIZE, -1); $mul = ($mul == 'M' ? 1048576 : ($mul == 'K' ? 1024 : ($mul == 'G' ? 1073741824 : 1))); if ($_SERVER['CONTENT_LENGTH'] > $mul*(int)$POST_MAX_SIZE && $POST_MAX_SIZE) echo "too big!!"; echo $POST_MAX_SIZE; if(empty($name) || empty($phone) || empty($location) || validEmail($emailCheck) == false || $phoneError == "true" || $fileError != 0) { displayForm($name, $emailCheck, $organisation, $phone, $title, $location, $description, $phoneError, $allowed_filetypes, $ext, $filename, $fileError); echo $fileError; echo "max size is: " .$max_size; echo "and file size is: " . $_FILES["uploadedfile"]["size"]; exit; } else { //copy file from temp to upload directory $path_of_uploaded_file = $target_path . $filename; $tmp_path = $_FILES["uploadedfile"]["tmp_name"]; echo $tmp_path; echo "and file size is: " . filesize($_FILES["uploadedfile"]["tmp_name"]); exit; if(is_uploaded_file($tmp_path)) { if(!copy($tmp_path,$path_of_uploaded_file)) { echo 'error while copying the uploaded file'; } } //test debug stuff echo "sending email..."; exit; } ?> PHP is returning this error in the log: [29-Apr-2010 10:32:47] PHP Warning: POST Content-Length of 57885895 bytes exceeds the limit of 10485760 bytes in Unknown on line 0 Excuse all the debug stuff :) FTR, I am running PHP 5.1.2 on IIS. TIA Jared

    Read the article

  • Wrapping ASP.NET Client Callbacks

    - by Ricardo Peres
    Client Callbacks are probably the less known (and I dare say, less loved) of all the AJAX options in ASP.NET, which also include the UpdatePanel, Page Methods and Web Services. The reason for that, I believe, is it’s relative complexity: Get a reference to a JavaScript function; Dynamically register function that calls the above reference; Have a JavaScript handler call the registered function. However, it has some the nice advantage of being self-contained, that is, doesn’t need additional files, such as web services, JavaScript libraries, etc, or static methods declared on a page, or any kind of attributes. So, here’s what I want to do: Have a DOM element which exposes a method that is executed server side, passing it a string and returning a string; Have a server-side event that handles the client-side call; Have two client-side user-supplied callback functions for handling the success and error results. I’m going to develop a custom control without user interface that does the registration of the client JavaScript method as well as a server-side event that can be hooked by some handler on a page. My markup will look like this: 1: <script type="text/javascript"> 1:  2:  3: function onCallbackSuccess(result, context) 4: { 5: } 6:  7: function onCallbackError(error, context) 8: { 9: } 10:  </script> 2: <my:CallbackControl runat="server" ID="callback" SendAllData="true" OnCallback="OnCallback"/> The control itself looks like this: 1: public class CallbackControl : Control, ICallbackEventHandler 2: { 3: #region Public constructor 4: public CallbackControl() 5: { 6: this.SendAllData = false; 7: this.Async = true; 8: } 9: #endregion 10:  11: #region Public properties and events 12: public event EventHandler<CallbackEventArgs> Callback; 13:  14: [DefaultValue(true)] 15: public Boolean Async 16: { 17: get; 18: set; 19: } 20:  21: [DefaultValue(false)] 22: public Boolean SendAllData 23: { 24: get; 25: set; 26: } 27:  28: #endregion 29:  30: #region Protected override methods 31:  32: protected override void Render(HtmlTextWriter writer) 33: { 34: writer.AddAttribute(HtmlTextWriterAttribute.Id, this.ClientID); 35: writer.RenderBeginTag(HtmlTextWriterTag.Span); 36:  37: base.Render(writer); 38:  39: writer.RenderEndTag(); 40: } 41:  42: protected override void OnInit(EventArgs e) 43: { 44: String reference = this.Page.ClientScript.GetCallbackEventReference(this, "arg", "onCallbackSuccess", "context", "onCallbackError", this.Async); 45: String script = String.Concat("\ndocument.getElementById('", this.ClientID, "').callback = function(arg, context, onCallbackSuccess, onCallbackError){", ((this.SendAllData == true) ? "__theFormPostCollection.length = 0; __theFormPostData = ''; WebForm_InitCallback(); " : String.Empty), reference, ";};\n"); 46:  47: this.Page.ClientScript.RegisterStartupScript(this.GetType(), String.Concat("callback", this.ClientID), script, true); 48:  49: base.OnInit(e); 50: } 51:  52: #endregion 53:  54: #region Protected virtual methods 55: protected virtual void OnCallback(CallbackEventArgs args) 56: { 57: EventHandler<CallbackEventArgs> handler = this.Callback; 58:  59: if (handler != null) 60: { 61: handler(this, args); 62: } 63: } 64:  65: #endregion 66:  67: #region ICallbackEventHandler Members 68:  69: String ICallbackEventHandler.GetCallbackResult() 70: { 71: CallbackEventArgs args = new CallbackEventArgs(this.Context.Items["Data"] as String); 72:  73: this.OnCallback(args); 74:  75: return (args.Result); 76: } 77:  78: void ICallbackEventHandler.RaiseCallbackEvent(String eventArgument) 79: { 80: this.Context.Items["Data"] = eventArgument; 81: } 82:  83: #endregion 84: } And the event argument class: 1: [Serializable] 2: public class CallbackEventArgs : EventArgs 3: { 4: public CallbackEventArgs(String argument) 5: { 6: this.Argument = argument; 7: this.Result = String.Empty; 8: } 9:  10: public String Argument 11: { 12: get; 13: private set; 14: } 15:  16: public String Result 17: { 18: get; 19: set; 20: } 21: } You will notice two properties on the CallbackControl: Async: indicates if the call should be made asynchronously or synchronously (the default); SendAllData: indicates if the callback call will include the view and control state of all of the controls on the page, so that, on the server side, they will have their properties set when the Callback event is fired. The CallbackEventArgs class exposes two properties: Argument: the read-only argument passed to the client-side function; Result: the result to return to the client-side callback function, set from the Callback event handler. An example of an handler for the Callback event would be: 1: protected void OnCallback(Object sender, CallbackEventArgs e) 2: { 3: e.Result = String.Join(String.Empty, e.Argument.Reverse()); 4: } Finally, in order to fire the Callback event from the client, you only need this: 1: <input type="text" id="input"/> 2: <input type="button" value="Get Result" onclick="document.getElementById('callback').callback(callback(document.getElementById('input').value, 'context', onCallbackSuccess, onCallbackError))"/> The syntax of the callback function is: arg: some string argument; context: some context that will be passed to the callback functions (success or failure); callbackSuccessFunction: some function that will be called when the callback succeeds; callbackFailureFunction: some function that will be called if the callback fails for some reason. Give it a try and see if it helps!

    Read the article

  • Using jQuery Live instead of jQuery Hover function

    - by hajan
    Let’s say we have a case where we need to create mouseover / mouseout functionality for a list which will be dynamically filled with data on client-side. We can use jQuery hover function, which handles the mouseover and mouseout events with two functions. See the following example: <!DOCTYPE html> <html lang="en"> <head id="Head1" runat="server">     <title>jQuery Mouseover / Mouseout Demo</title>     <script type="text/javascript" src="http://ajax.aspnetcdn.com/ajax/jquery/jquery-1.4.4.js"></script>     <style type="text/css">         .hover { color:Red; cursor:pointer;}     </style>     <script type="text/javascript">         $(function () {             $("li").hover(               function () {                   $(this).addClass("hover");               },               function () {                   $(this).removeClass("hover");               });         });     </script> </head> <body>     <form id="form2" runat="server">     <ul>         <li>Data 1</li>         <li>Data 2</li>         <li>Data 3</li>         <li>Data 4</li>         <li>Data 5</li>         <li>Data 6</li>     </ul>     </form> </body> </html> Now, if you have situation where you want to add new data dynamically... Lets say you have a button to add new item in the list. Add the following code right bellow the </ul> tag <input type="text" id="txtItem" /> <input type="button" id="addNewItem" value="Add New Item" /> And add the following button click functionality: //button add new item functionality $("#addNewItem").click(function (event) {     event.preventDefault();     $("<li>" + $("#txtItem").val() + "</li>").appendTo("ul"); }); The mouse over effect won't work for the newly added items. Therefore, we need to use live or delegate function. These both do the same job. The main difference is that for some cases delegate is considered a bit faster, and can be used in chaining. In our case, we can use both. I will use live function. $("li").live("mouseover mouseout",   function (event) {       if (event.type == "mouseover") $(this).addClass("hover");       else $(this).removeClass("hover");   }); The complete code is: <!DOCTYPE html> <html lang="en"> <head id="Head1" runat="server">     <title>jQuery Mouseover / Mouseout Demo</title>     <script type="text/javascript" src="http://ajax.aspnetcdn.com/ajax/jquery/jquery-1.4.4.js"></script>     <style type="text/css">         .hover { color:Red; cursor:pointer;}     </style>     <script type="text/javascript">         $(function () {             $("li").live("mouseover mouseout",               function (event) {                   if (event.type == "mouseover") $(this).addClass("hover");                   else $(this).removeClass("hover");               });             //button add new item functionality             $("#addNewItem").click(function (event) {                 event.preventDefault();                 $("<li>" + $("#txtItem").val() + "</li>").appendTo("ul");             });         });     </script> </head> <body>     <form id="form2" runat="server">     <ul>         <li>Data 1</li>         <li>Data 2</li>         <li>Data 3</li>         <li>Data 4</li>         <li>Data 5</li>         <li>Data 6</li>     </ul>          <input type="text" id="txtItem" />     <input type="button" id="addNewItem" value="Add New Item" />     </form> </body> </html> So, basically when replacing hover with live, you see we use the mouseover and mouseout names for both events. Check the working demo which is available HERE. Hope this was useful blog for you. Hope it’s helpful. HajanReference blog: http://codeasp.net/blogs/hajan/microsoft-net/1260/using-jquery-live-instead-of-jquery-hover-function

    Read the article

  • CSS height problem. IE8 seems correct Firefox seems wrong. Any fix?

    - by user169867
    Below is a complete html page that shows the problem. The "myDiv" should be 22px in height (including the border). Item 1 should have a 1px space between its border and the divs border. In IE8 it is. In FF 3.6.2 though it is 24px and I can't understand why. Ultimately my goal is to get the same CSS to create the same result in both browsers. It's driving me crazy! Any help would be appreciated :) <!DOCTYPE html PUBLIC "-//W3C//DTD XHTML 1.0 Transitional//EN" "http://www.w3.org/TR/xhtml1/DTD/xhtml1-transitional.dtd"> <html xmlns="http://www.w3.org/1999/xhtml" > <head> <title></title> <style type="text/css"> div.aclb {background:#EEF3FA; color:#666; cursor:text; padding:1px; overflow-y:auto; border:#BBC8D9 1px solid; } div.aclb:hover {border:#3399FF 1px solid;} div.aclb.focus {background:#FFF; border:#3399FF 1px solid;} div.aclb ul {padding:0; margin:0; list-style:none; display:table; vertical-align:middle; } div.aclb li {float:left; cursor:default; font-family:Arial; padding:0; margin:0;} div.aclb li.block {padding:0px 2px; height:16px; white-space:nowrap; border:solid 1px #BBD8FB; background:#f3f7fd; font-size:11px; line-height:16px;} div.aclb li.block:hover {border:solid 1px #5F8BD3; background:#E4ECF8; color:#000;} div.aclb li.input {} div.aclb input {margin:0; padding:0; height:18px; background:transparent; border:none; color:#666; overflow:hidden; resize:none; font-family:Arial; font-size:13px; outline:none;} div.aclb input:focus {margin:0; padding:0; height:18px; background:transparent; border:none; color:#22F; overflow:hidden; resize:none; font-family:Arial; font-size:13px; outline:none;} div.aclb a.d {cursor:pointer; display:block; color:#6B6B6B; width:13px; height:12px;float:right; margin:1px 0 1px 4px; border:solid 1px transparent; font-family:Verdana; font-size:11px; text-align:center; line-height:10px;} div.aclb a.d:hover { border:solid 1px #7DA2CE; background:#F7FAFD; color:#AD0B0B;} div.aclb a.d:active {border:solid 1px #497CBB; background:#BAD8E8; color:#A90909;} </style> </head> <body> <div id="myDiv" style="width:250px" class="aclb"> <ul> <li class="block"> <a class="d">x</a><span>Item 1</span> </li> <li class="input"> <input type="text" style="width:30px" maxlength="30"/> </li> </ul> </div> </body> </html>

    Read the article

  • Integration Patterns with Azure Service Bus Relay, Part 1: Exposing the on-premise service

    - by Elton Stoneman
    We're in the process of delivering an enabling project to expose on-premise WCF services securely to Internet consumers. The Azure Service Bus Relay is doing the clever stuff, we register our on-premise service with Azure, consumers call into our .servicebus.windows.net namespace, and their requests are relayed and serviced on-premise. In theory it's all wonderfully simple; by using the relay we get lots of protocol options, free HTTPS and load balancing, and by integrating to ACS we get plenty of security options. Part of our delivery is a suite of sample consumers for the service - .NET, jQuery, PHP - and this set of posts will cover setting up the service and the consumers. Part 1: Exposing the on-premise service In theory, this is ultra-straightforward. In practice, and on a dev laptop it is - but in a corporate network with firewalls and proxies, it isn't, so we'll walkthrough some of the pitfalls. Note that I'm using the "old" Azure portal which will soon be out of date, but the new shiny portal should have the same steps available and be easier to use. We start with a simple WCF service which takes a string as input, reverses the string and returns it. The Part 1 version of the code is on GitHub here: on GitHub here: IPASBR Part 1. Configuring Azure Service Bus Start by logging into the Azure portal and registering a Service Bus namespace which will be our endpoint in the cloud. Give it a globally unique name, set it up somewhere near you (if you’re in Europe, remember Europe (North) is Ireland, and Europe (West) is the Netherlands), and  enable ACS integration by ticking "Access Control" as a service: Authenticating and authorizing to ACS When we try to register our on-premise service as a listener for the Service Bus endpoint, we need to supply credentials, which means only trusted service providers can act as listeners. We can use the default "owner" credentials, but that has admin permissions so a dedicated service account is better (Neil Mackenzie has a good post On Not Using owner with the Azure AppFabric Service Bus with lots of permission details). Click on "Access Control Service" for the namespace, navigate to Service Identities and add a new one. Give the new account a sensible name and description: Let ACS generate a symmetric key for you (this will be the shared secret we use in the on-premise service to authenticate as a listener), but be sure to set the expiration date to something usable. The portal defaults to expiring new identities after 1 year - but when your year is up *your identity will expire without warning* and everything will stop working. In production, you'll need governance to manage identity expiration and a process to make sure you renew identities and roll new keys regularly. The new service identity needs to be authorized to listen on the service bus endpoint. This is done through claim mapping in ACS - we'll set up a rule that says if the nameidentifier in the input claims has the value serviceProvider, in the output we'll have an action claim with the value Listen. In the ACS portal you'll see that there is already a Relying Party Application set up for ServiceBus, which has a Default rule group. Edit the rule group and click Add to add this new rule: The values to use are: Issuer: Access Control Service Input claim type: http://schemas.xmlsoap.org/ws/2005/05/identity/claims/nameidentifier Input claim value: serviceProvider Output claim type: net.windows.servicebus.action Output claim value: Listen When your service namespace and identity are set up, open the Part 1 solution and put your own namespace, service identity name and secret key into the file AzureConnectionDetails.xml in Solution Items, e.g: <azure namespace="sixeyed-ipasbr">    <!-- ACS credentials for the listening service (Part1):-->   <service identityName="serviceProvider"            symmetricKey="nuR2tHhlrTCqf4YwjT2RA2BZ/+xa23euaRJNLh1a/V4="/>  </azure> Build the solution, and the T4 template will generate the Web.config for the service project with your Azure details in the transportClientEndpointBehavior:           <behavior name="SharedSecret">             <transportClientEndpointBehavior credentialType="SharedSecret">               <clientCredentials>                 <sharedSecret issuerName="serviceProvider"                               issuerSecret="nuR2tHhlrTCqf4YwjT2RA2BZ/+xa23euaRJNLh1a/V4="/>               </clientCredentials>             </transportClientEndpointBehavior>           </behavior> , and your service namespace in the Azure endpoint:         <!-- Azure Service Bus endpoints -->          <endpoint address="sb://sixeyed-ipasbr.servicebus.windows.net/net"                   binding="netTcpRelayBinding"                   contract="Sixeyed.Ipasbr.Services.IFormatService"                   behaviorConfiguration="SharedSecret">         </endpoint> The sample project is hosted in IIS, but it won't register with Azure until the service is activated. Typically you'd install AppFabric 1.1 for Widnows Server and set the service to auto-start in IIS, but for dev just navigate to the local REST URL, which will activate the service and register it with Azure. Testing the service locally As well as an Azure endpoint, the service has a WebHttpBinding for local REST access:         <!-- local REST endpoint for internal use -->         <endpoint address="rest"                   binding="webHttpBinding"                   behaviorConfiguration="RESTBehavior"                   contract="Sixeyed.Ipasbr.Services.IFormatService" /> Build the service, then navigate to: http://localhost/Sixeyed.Ipasbr.Services/FormatService.svc/rest/reverse?string=abc123 - and you should see the reversed string response: If your network allows it, you'll get the expected response as before, but in the background your service will also be listening in the cloud. Good stuff! Who needs network security? Onto the next post for consuming the service with the netTcpRelayBinding.  Setting up network access to Azure But, if you get an error, it's because your network is secured and it's doing something to stop the relay working. The Service Bus relay bindings try to use direct TCP connections to Azure, so if ports 9350-9354 are available *outbound*, then the relay will run through them. If not, the binding steps down to standard HTTP, and issues a CONNECT across port 443 or 80 to set up a tunnel for the relay. If your network security guys are doing their job, the first option will be blocked by the firewall, and the second option will be blocked by the proxy, so you'll get this error: System.ServiceModel.CommunicationException: Unable to reach sixeyed-ipasbr.servicebus.windows.net via TCP (9351, 9352) or HTTP (80, 443) - and that will probably be the start of lots of discussions. Network guys don't really like giving servers special permissions for the web proxy, and they really don't like opening ports, so they'll need to be convinced about this. The resolution in our case was to put up a dedicated box in a DMZ, tinker with the firewall and the proxy until we got a relay connection working, then run some traffic which the the network guys monitored to do a security assessment afterwards. Along the way we hit a few more issues, diagnosed mainly with Fiddler and Wireshark: System.Net.ProtocolViolationException: Chunked encoding upload is not supported on the HTTP/1.0 protocol - this means the TCP ports are not available, so Azure tries to relay messaging traffic across HTTP. The service can access the endpoint, but the proxy is downgrading traffic to HTTP 1.0, which does not support tunneling, so Azure can’t make its connection. We were using the Squid proxy, version 2.6. The Squid project is incrementally adding HTTP 1.1 support, but there's no definitive list of what's supported in what version (here are some hints). System.ServiceModel.Security.SecurityNegotiationException: The X.509 certificate CN=servicebus.windows.net chain building failed. The certificate that was used has a trust chain that cannot be verified. Replace the certificate or change the certificateValidationMode. The evocation function was unable to check revocation because the revocation server was offline. - by this point we'd given up on the HTTP proxy and opened the TCP ports. We got this error when the relay binding does it's authentication hop to ACS. The messaging traffic is TCP, but the control traffic still goes over HTTP, and as part of the ACS authentication the process checks with a revocation server to see if Microsoft’s ACS cert is still valid, so the proxy still needs some clearance. The service account (the IIS app pool identity) needs access to: www.public-trust.com mscrl.microsoft.com We still got this error periodically with different accounts running the app pool. We fixed that by ensuring the machine-wide proxy settings are set up, so every account uses the correct proxy: netsh winhttp set proxy proxy-server="http://proxy.x.y.z" - and you might need to run this to clear out your credential cache: certutil -urlcache * delete If your network guys end up grudgingly opening ports, they can restrict connections to the IP address range for your chosen Azure datacentre, which might make them happier - see Windows Azure Datacenter IP Ranges. After all that you've hopefully got an on-premise service listening in the cloud, which you can consume from pretty much any technology.

    Read the article

  • jQuery Toggle with Cookie

    - by Cameron
    I have the following toggle system, but I want it to remember what was open/closed using the jQuery cookie plugin. So for example if I open a toggle and then navigate away from the page, when I come back it should be still open. This is code I have so far, but it's becoming rather confusing, some help would be much appreciated thanks. jQuery.cookie = function (name, value, options) { if (typeof value != 'undefined') { options = options || {}; if (value === null) { value = ''; options = $.extend({}, options); options.expires = -1; } var expires = ''; if (options.expires && (typeof options.expires == 'number' || options.expires.toUTCString)) { var date; if (typeof options.expires == 'number') { date = new Date(); date.setTime(date.getTime() + (options.expires * 24 * 60 * 60 * 1000)); } else { date = options.expires; } expires = '; expires=' + date.toUTCString(); } var path = options.path ? '; path=' + (options.path) : ''; var domain = options.domain ? '; domain=' + (options.domain) : ''; var secure = options.secure ? '; secure' : ''; document.cookie = [name, '=', encodeURIComponent(value), expires, path, domain, secure].join(''); } else { var cookieValue = null; if (document.cookie && document.cookie != '') { var cookies = document.cookie.split(';'); for (var i = 0; i < cookies.length; i++) { var cookie = jQuery.trim(cookies[i]); if (cookie.substring(0, name.length + 1) == (name + '=')) { cookieValue = decodeURIComponent(cookie.substring(name.length + 1)); break; } } } return cookieValue; } }; // var showTop = $.cookie('showTop'); if ($.cookie('showTop') == 'collapsed') { $(".toggle_container").hide(); $(".trigger").toggle(function () { $(this).addClass("active"); }, function () { $(this).removeClass("active"); }); $(".trigger").click(function () { $(this).next(".toggle_container").slideToggle("slow,"); }); } else { $(".toggle_container").show(); $(".trigger").toggle(function () { $(this).addClass("active"); }, function () { $(this).removeClass("active"); }); $(".trigger").click(function () { $(this).next(".toggle_container").slideToggle("slow,"); }); }; $(".trigger").click(function () { if ($(".toggle_container").is(":hidden")) { $(this).next(".toggle_container").slideToggle("slow,"); $.cookie('showTop', 'expanded'); } else { $(this).next(".toggle_container").slideToggle("slow,"); $.cookie('showTop', 'collapsed'); } return false; }); and this is a snippet of the HTML it works with: <li> <label for="small"><input type="checkbox" id="small" /> Small</label> <a class="trigger" href="#">Toggle</a> <div class="toggle_container"> <p class="funding"><strong>Funding</strong></p> <ul class="childs"> <li class="child"> <label for="fully-funded1"><input type="checkbox" id="fully-funded1" /> Fully Funded</label> <a class="trigger" href="#">Toggle</a> <div class="toggle_container"> <p class="days"><strong>Days</strong></p> <ul class="days clearfix"> <li><label for="1pre16">Pre 16</label> <input type="text" id="1pre16" /></li> <li><label for="2post16">Post 16</label> <input type="text" id="2post16" /></li> <li><label for="3teacher">Teacher</label> <input type="text" id="3teacher" /></li> </ul> </div> </li>

    Read the article

  • No GLX on Intel card with multiseat with additional nVidia card

    - by MeanEYE
    I have multiseat configured and my Xorg has 2 server layouts. One is for nVidia card and other is for Intel card. They both work, but display server assigned to Intel card doesn't have hardware acceleration since DRI and GLX module being used is from nVidia driver. So my question is, can I configure layouts somehow to use right DRI and GLX with each card? My Xorg.conf: Section "ServerLayout" Identifier "Default" Screen 0 "Screen0" 0 0 Option "Xinerama" "0" EndSection Section "ServerLayout" Identifier "TV" Screen 0 "Screen1" 0 0 Option "Xinerama" "0" EndSection Section "Monitor" # HorizSync source: edid, VertRefresh source: edid Identifier "Monitor0" VendorName "Unknown" ModelName "DELL E198WFP" HorizSync 30.0 - 83.0 VertRefresh 56.0 - 75.0 Option "DPMS" EndSection Section "Monitor" Identifier "Monitor1" VendorName "Unknown" Option "DPMS" EndSection Section "Device" Identifier "Device0" Driver "nvidia" VendorName "NVIDIA Corporation" BoardName "GeForce GT 610" EndSection Section "Device" Identifier "Device1" Driver "intel" BusID "PCI:0:2:0" Option "AccelMethod" "uxa" EndSection Section "Screen" Identifier "Screen0" Device "Device0" Monitor "Monitor0" DefaultDepth 24 Option "Stereo" "0" Option "nvidiaXineramaInfoOrder" "DFP-1" Option "metamodes" "DFP-0: nvidia-auto-select +1440+0, DFP-1: nvidia-auto-select +0+0" SubSection "Display" Depth 24 EndSubSection EndSection Section "Screen" Identifier "Screen1" Device "Device1" Monitor "Monitor1" DefaultDepth 24 SubSection "Display" Depth 24 EndSubSection EndSection Log file for Intel: [ 18.239] X.Org X Server 1.13.0 Release Date: 2012-09-05 [ 18.239] X Protocol Version 11, Revision 0 [ 18.239] Build Operating System: Linux 2.6.24-32-xen x86_64 Ubuntu [ 18.239] Current Operating System: Linux bytewiper 3.5.0-18-generic #29-Ubuntu SMP Fri Oct 19 10:26:51 UTC 2012 x86_64 [ 18.239] Kernel command line: BOOT_IMAGE=/boot/vmlinuz-3.5.0-18-generic root=UUID=fc0616fd-f212-4846-9241-ba4a492f0513 ro quiet splash [ 18.239] Build Date: 20 September 2012 11:55:20AM [ 18.239] xorg-server 2:1.13.0+git20120920.70e57668-0ubuntu0ricotz (For technical support please see http://www.ubuntu.com/support) [ 18.239] Current version of pixman: 0.26.0 [ 18.239] Before reporting problems, check http://wiki.x.org to make sure that you have the latest version. [ 18.239] Markers: (--) probed, (**) from config file, (==) default setting, (++) from command line, (!!) notice, (II) informational, (WW) warning, (EE) error, (NI) not implemented, (??) unknown. [ 18.239] (==) Log file: "/var/log/Xorg.1.log", Time: Wed Nov 21 18:32:14 2012 [ 18.239] (==) Using config file: "/etc/X11/xorg.conf" [ 18.239] (==) Using system config directory "/usr/share/X11/xorg.conf.d" [ 18.239] (++) ServerLayout "TV" [ 18.239] (**) |-->Screen "Screen1" (0) [ 18.239] (**) | |-->Monitor "Monitor1" [ 18.240] (**) | |-->Device "Device1" [ 18.240] (**) Option "Xinerama" "0" [ 18.240] (==) Automatically adding devices [ 18.240] (==) Automatically enabling devices [ 18.240] (==) Automatically adding GPU devices [ 18.240] (WW) The directory "/usr/share/fonts/X11/cyrillic" does not exist. [ 18.240] Entry deleted from font path. [ 18.240] (WW) The directory "/usr/share/fonts/X11/100dpi/" does not exist. [ 18.240] Entry deleted from font path. [ 18.240] (WW) The directory "/usr/share/fonts/X11/75dpi/" does not exist. [ 18.240] Entry deleted from font path. [ 18.240] (WW) The directory "/usr/share/fonts/X11/100dpi" does not exist. [ 18.240] Entry deleted from font path. [ 18.240] (WW) The directory "/usr/share/fonts/X11/75dpi" does not exist. [ 18.240] Entry deleted from font path. [ 18.240] (WW) The directory "/var/lib/defoma/x-ttcidfont-conf.d/dirs/TrueType" does not exist. [ 18.240] Entry deleted from font path. [ 18.240] (==) FontPath set to: /usr/share/fonts/X11/misc, /usr/share/fonts/X11/Type1, built-ins [ 18.240] (==) ModulePath set to "/usr/lib/x86_64-linux-gnu/xorg/extra-modules,/usr/lib/xorg/extra-modules,/usr/lib/xorg/modules" [ 18.240] (II) The server relies on udev to provide the list of input devices. If no devices become available, reconfigure udev or disable AutoAddDevices. [ 18.240] (II) Loader magic: 0x7f6917944c40 [ 18.240] (II) Module ABI versions: [ 18.240] X.Org ANSI C Emulation: 0.4 [ 18.240] X.Org Video Driver: 13.0 [ 18.240] X.Org XInput driver : 18.0 [ 18.240] X.Org Server Extension : 7.0 [ 18.240] (II) config/udev: Adding drm device (/dev/dri/card0) [ 18.241] (--) PCI: (0:0:2:0) 8086:0152:1043:84ca rev 9, Mem @ 0xf7400000/4194304, 0xd0000000/268435456, I/O @ 0x0000f000/64 [ 18.241] (--) PCI:*(0:1:0:0) 10de:104a:1458:3546 rev 161, Mem @ 0xf6000000/16777216, 0xe0000000/134217728, 0xe8000000/33554432, I/O @ 0x0000e000/128, BIOS @ 0x????????/524288 [ 18.241] (II) Open ACPI successful (/var/run/acpid.socket) [ 18.241] Initializing built-in extension Generic Event Extension [ 18.241] Initializing built-in extension SHAPE [ 18.241] Initializing built-in extension MIT-SHM [ 18.241] Initializing built-in extension XInputExtension [ 18.241] Initializing built-in extension XTEST [ 18.241] Initializing built-in extension BIG-REQUESTS [ 18.241] Initializing built-in extension SYNC [ 18.241] Initializing built-in extension XKEYBOARD [ 18.241] Initializing built-in extension XC-MISC [ 18.241] Initializing built-in extension SECURITY [ 18.241] Initializing built-in extension XINERAMA [ 18.241] Initializing built-in extension XFIXES [ 18.241] Initializing built-in extension RENDER [ 18.241] Initializing built-in extension RANDR [ 18.241] Initializing built-in extension COMPOSITE [ 18.241] Initializing built-in extension DAMAGE [ 18.241] Initializing built-in extension MIT-SCREEN-SAVER [ 18.241] Initializing built-in extension DOUBLE-BUFFER [ 18.241] Initializing built-in extension RECORD [ 18.241] Initializing built-in extension DPMS [ 18.241] Initializing built-in extension X-Resource [ 18.241] Initializing built-in extension XVideo [ 18.241] Initializing built-in extension XVideo-MotionCompensation [ 18.241] Initializing built-in extension XFree86-VidModeExtension [ 18.241] Initializing built-in extension XFree86-DGA [ 18.241] Initializing built-in extension XFree86-DRI [ 18.241] Initializing built-in extension DRI2 [ 18.241] (II) LoadModule: "glx" [ 18.241] (II) Loading /usr/lib/x86_64-linux-gnu/xorg/extra-modules/libglx.so [ 18.247] (II) Module glx: vendor="NVIDIA Corporation" [ 18.247] compiled for 4.0.2, module version = 1.0.0 [ 18.247] Module class: X.Org Server Extension [ 18.247] (II) NVIDIA GLX Module 310.19 Thu Nov 8 01:12:43 PST 2012 [ 18.247] Loading extension GLX [ 18.247] (II) LoadModule: "intel" [ 18.248] (II) Loading /usr/lib/xorg/modules/drivers/intel_drv.so [ 18.248] (II) Module intel: vendor="X.Org Foundation" [ 18.248] compiled for 1.13.0, module version = 2.20.13 [ 18.248] Module class: X.Org Video Driver [ 18.248] ABI class: X.Org Video Driver, version 13.0 [ 18.248] (II) intel: Driver for Intel Integrated Graphics Chipsets: i810, i810-dc100, i810e, i815, i830M, 845G, 854, 852GM/855GM, 865G, 915G, E7221 (i915), 915GM, 945G, 945GM, 945GME, Pineview GM, Pineview G, 965G, G35, 965Q, 946GZ, 965GM, 965GME/GLE, G33, Q35, Q33, GM45, 4 Series, G45/G43, Q45/Q43, G41, B43, B43, Clarkdale, Arrandale, Sandybridge Desktop (GT1), Sandybridge Desktop (GT2), Sandybridge Desktop (GT2+), Sandybridge Mobile (GT1), Sandybridge Mobile (GT2), Sandybridge Mobile (GT2+), Sandybridge Server, Ivybridge Mobile (GT1), Ivybridge Mobile (GT2), Ivybridge Desktop (GT1), Ivybridge Desktop (GT2), Ivybridge Server, Ivybridge Server (GT2), Haswell Desktop (GT1), Haswell Desktop (GT2), Haswell Desktop (GT2+), Haswell Mobile (GT1), Haswell Mobile (GT2), Haswell Mobile (GT2+), Haswell Server (GT1), Haswell Server (GT2), Haswell Server (GT2+), Haswell SDV Desktop (GT1), Haswell SDV Desktop (GT2), Haswell SDV Desktop (GT2+), Haswell SDV Mobile (GT1), Haswell SDV Mobile (GT2), Haswell SDV Mobile (GT2+), Haswell SDV Server (GT1), Haswell SDV Server (GT2), Haswell SDV Server (GT2+), Haswell ULT Desktop (GT1), Haswell ULT Desktop (GT2), Haswell ULT Desktop (GT2+), Haswell ULT Mobile (GT1), Haswell ULT Mobile (GT2), Haswell ULT Mobile (GT2+), Haswell ULT Server (GT1), Haswell ULT Server (GT2), Haswell ULT Server (GT2+), Haswell CRW Desktop (GT1), Haswell CRW Desktop (GT2), Haswell CRW Desktop (GT2+), Haswell CRW Mobile (GT1), Haswell CRW Mobile (GT2), Haswell CRW Mobile (GT2+), Haswell CRW Server (GT1), Haswell CRW Server (GT2), Haswell CRW Server (GT2+), ValleyView PO board [ 18.248] (++) using VT number 8 [ 18.593] (II) intel(0): using device path '/dev/dri/card0' [ 18.593] (**) intel(0): Depth 24, (--) framebuffer bpp 32 [ 18.593] (==) intel(0): RGB weight 888 [ 18.593] (==) intel(0): Default visual is TrueColor [ 18.593] (**) intel(0): Option "AccelMethod" "uxa" [ 18.593] (--) intel(0): Integrated Graphics Chipset: Intel(R) Ivybridge Desktop (GT1) [ 18.593] (**) intel(0): Relaxed fencing enabled [ 18.593] (**) intel(0): Wait on SwapBuffers? enabled [ 18.593] (**) intel(0): Triple buffering? enabled [ 18.593] (**) intel(0): Framebuffer tiled [ 18.593] (**) intel(0): Pixmaps tiled [ 18.593] (**) intel(0): 3D buffers tiled [ 18.593] (**) intel(0): SwapBuffers wait enabled ... [ 20.312] (II) Module fb: vendor="X.Org Foundation" [ 20.312] compiled for 1.13.0, module version = 1.0.0 [ 20.312] ABI class: X.Org ANSI C Emulation, version 0.4 [ 20.312] (II) Loading sub module "dri2" [ 20.312] (II) LoadModule: "dri2" [ 20.312] (II) Module "dri2" already built-in [ 20.312] (==) Depth 24 pixmap format is 32 bpp [ 20.312] (II) intel(0): [DRI2] Setup complete [ 20.312] (II) intel(0): [DRI2] DRI driver: i965 [ 20.312] (II) intel(0): Allocated new frame buffer 1920x1080 stride 7680, tiled [ 20.312] (II) UXA(0): Driver registered support for the following operations: [ 20.312] (II) solid [ 20.312] (II) copy [ 20.312] (II) composite (RENDER acceleration) [ 20.312] (II) put_image [ 20.312] (II) get_image [ 20.312] (==) intel(0): Backing store disabled [ 20.312] (==) intel(0): Silken mouse enabled [ 20.312] (II) intel(0): Initializing HW Cursor [ 20.312] (II) intel(0): RandR 1.2 enabled, ignore the following RandR disabled message. [ 20.313] (**) intel(0): DPMS enabled [ 20.313] (==) intel(0): Intel XvMC decoder enabled [ 20.313] (II) intel(0): Set up textured video [ 20.313] (II) intel(0): [XvMC] xvmc_vld driver initialized. [ 20.313] (II) intel(0): direct rendering: DRI2 Enabled [ 20.313] (==) intel(0): hotplug detection: "enabled" [ 20.332] (--) RandR disabled [ 20.335] (EE) Failed to initialize GLX extension (Compatible NVIDIA X driver not found) [ 20.335] (II) intel(0): Setting screen physical size to 508 x 285 [ 20.338] (II) XKB: reuse xkmfile /var/lib/xkb/server-B20D7FC79C7F597315E3E501AEF10E0D866E8E92.xkm [ 20.340] (II) config/udev: Adding input device Power Button (/dev/input/event1) [ 20.340] (**) Power Button: Applying InputClass "evdev keyboard catchall" [ 20.340] (II) LoadModule: "evdev" [ 20.340] (II) Loading /usr/lib/xorg/modules/input/evdev_drv.so

    Read the article

  • How to store generated eigen faces for future face recognition?

    - by user3237134
    My code works in the following manner: 1.First, it obtains several images from the training set 2.After loading these images, we find the normalized faces,mean face and perform several calculation. 3.Next, we ask for the name of an image we want to recognize 4.We then project the input image into the eigenspace, and based on the difference from the eigenfaces we make a decision. 5.Depending on eigen weight vector for each input image we make clusters using kmeans command. Source code i tried: clear all close all clc % number of images on your training set. M=1200; %Chosen std and mean. %It can be any number that it is close to the std and mean of most of the images. um=60; ustd=32; %read and show images(bmp); S=[]; %img matrix for i=1:M str=strcat(int2str(i),'.jpg'); %concatenates two strings that form the name of the image eval('img=imread(str);'); [irow icol d]=size(img); % get the number of rows (N1) and columns (N2) temp=reshape(permute(img,[2,1,3]),[irow*icol,d]); %creates a (N1*N2)x1 matrix S=[S temp]; %X is a N1*N2xM matrix after finishing the sequence %this is our S end %Here we change the mean and std of all images. We normalize all images. %This is done to reduce the error due to lighting conditions. for i=1:size(S,2) temp=double(S(:,i)); m=mean(temp); st=std(temp); S(:,i)=(temp-m)*ustd/st+um; end %show normalized images for i=1:M str=strcat(int2str(i),'.jpg'); img=reshape(S(:,i),icol,irow); img=img'; end %mean image; m=mean(S,2); %obtains the mean of each row instead of each column tmimg=uint8(m); %converts to unsigned 8-bit integer. Values range from 0 to 255 img=reshape(tmimg,icol,irow); %takes the N1*N2x1 vector and creates a N2xN1 matrix img=img'; %creates a N1xN2 matrix by transposing the image. % Change image for manipulation dbx=[]; % A matrix for i=1:M temp=double(S(:,i)); dbx=[dbx temp]; end %Covariance matrix C=A'A, L=AA' A=dbx'; L=A*A'; % vv are the eigenvector for L % dd are the eigenvalue for both L=dbx'*dbx and C=dbx*dbx'; [vv dd]=eig(L); % Sort and eliminate those whose eigenvalue is zero v=[]; d=[]; for i=1:size(vv,2) if(dd(i,i)>1e-4) v=[v vv(:,i)]; d=[d dd(i,i)]; end end %sort, will return an ascending sequence [B index]=sort(d); ind=zeros(size(index)); dtemp=zeros(size(index)); vtemp=zeros(size(v)); len=length(index); for i=1:len dtemp(i)=B(len+1-i); ind(i)=len+1-index(i); vtemp(:,ind(i))=v(:,i); end d=dtemp; v=vtemp; %Normalization of eigenvectors for i=1:size(v,2) %access each column kk=v(:,i); temp=sqrt(sum(kk.^2)); v(:,i)=v(:,i)./temp; end %Eigenvectors of C matrix u=[]; for i=1:size(v,2) temp=sqrt(d(i)); u=[u (dbx*v(:,i))./temp]; end %Normalization of eigenvectors for i=1:size(u,2) kk=u(:,i); temp=sqrt(sum(kk.^2)); u(:,i)=u(:,i)./temp; end % show eigenfaces; for i=1:size(u,2) img=reshape(u(:,i),icol,irow); img=img'; img=histeq(img,255); end % Find the weight of each face in the training set. omega = []; for h=1:size(dbx,2) WW=[]; for i=1:size(u,2) t = u(:,i)'; WeightOfImage = dot(t,dbx(:,h)'); WW = [WW; WeightOfImage]; end omega = [omega WW]; end % Acquire new image % Note: the input image must have a bmp or jpg extension. % It should have the same size as the ones in your training set. % It should be placed on your desktop ed_min=[]; srcFiles = dir('G:\newdatabase\*.jpg'); % the folder in which ur images exists for b = 1 : length(srcFiles) filename = strcat('G:\newdatabase\',srcFiles(b).name); Imgdata = imread(filename); InputImage=Imgdata; InImage=reshape(permute((double(InputImage)),[2,1,3]),[irow*icol,1]); temp=InImage; me=mean(temp); st=std(temp); temp=(temp-me)*ustd/st+um; NormImage = temp; Difference = temp-m; p = []; aa=size(u,2); for i = 1:aa pare = dot(NormImage,u(:,i)); p = [p; pare]; end InImWeight = []; for i=1:size(u,2) t = u(:,i)'; WeightOfInputImage = dot(t,Difference'); InImWeight = [InImWeight; WeightOfInputImage]; end noe=numel(InImWeight); % Find Euclidean distance e=[]; for i=1:size(omega,2) q = omega(:,i); DiffWeight = InImWeight-q; mag = norm(DiffWeight); e = [e mag]; end ed_min=[ed_min MinimumValue]; theta=6.0e+03; %disp(e) z(b,:)=InImWeight; end IDX = kmeans(z,5); clustercount=accumarray(IDX, ones(size(IDX))); disp(clustercount); QUESTIONS: 1.It is working fine for M=50(i.e Training set contains 50 images) but not for M=1200(i.e Training set contains 1200 images).It is not showing any error.There is no output.I waited for 10 min still there is no output. I think it is going infinite loop.What is the problem?Where i was wrong? 2.Instead of running the training set everytime how eigen faces generated are stored so that stored eigen faces are used for future face recoginition for a new input image.So it reduces wastage of time.

    Read the article

  • SQL University: What and why of database refactoring

    - by Mladen Prajdic
    This is a post for a great idea called SQL University started by Jorge Segarra also famously known as SqlChicken on Twitter. It’s a collection of blog posts on different database related topics contributed by several smart people all over the world. So this week is mine and we’ll be talking about database testing and refactoring. In 3 posts we’ll cover: SQLU part 1 - What and why of database testing SQLU part 2 - What and why of database refactoring SQLU part 3 - Tools of the trade This is a second part of the series and in it we’ll take a look at what database refactoring is and why do it. Why refactor a database To know why refactor we first have to know what refactoring actually is. Code refactoring is a process where we change module internals in a way that does not change that module’s input/output behavior. For successful refactoring there is one crucial thing we absolutely must have: Tests. Automated unit tests are the only guarantee we have that we haven’t broken the input/output behavior before refactoring. If you haven’t go back ad read my post on the matter. Then start writing them. Next thing you need is a code module. Those are views, UDFs and stored procedures. By having direct table access we can kiss fast and sweet refactoring good bye. One more point to have a database abstraction layer. And no, ORM’s don’t fall into that category. But also know that refactoring is NOT adding new functionality to your code. Many have fallen into this trap. Don’t be one of them and resist the lure of the dark side. And it’s a strong lure. We developers in general love to add new stuff to our code, but hate fixing our own mistakes or changing existing code for no apparent reason. To be a good refactorer one needs discipline and focus. Now we know that refactoring is all about changing inner workings of existing code. This can be due to performance optimizations, changing internal code workflows or some other reason. This is a typical black box scenario to the outside world. If we upgrade the car engine it still has to drive on the road (preferably faster) and not fly (no matter how cool that would be). Also be aware that white box tests will break when we refactor. What to refactor in a database Refactoring databases doesn’t happen that often but when it does it can include a lot of stuff. Let us look at a few common cases. Adding or removing database schema objects Adding, removing or changing table columns in any way, adding constraints, keys, etc… All of these can be counted as internal changes not visible to the data consumer. But each of these carries a potential input/output behavior change. Dropping a column can result in views not working anymore or stored procedure logic crashing. Adding a unique constraint shows duplicated data that shouldn’t exist. Foreign keys break a truncate table command executed from an application that runs once a month. All these scenarios are very real and can happen. With the proper database abstraction layer fully covered with black box tests we can make sure something like that does not happen (hopefully at all). Changing physical structures Physical structures include heaps, indexes and partitions. We can pretty much add or remove those without changing the data returned by the database. But the performance can be affected. So here we use our performance tests. We do have them, right? Just by adding a single index we can achieve orders of magnitude performance improvement. Won’t that make users happy? But what if that index causes our write operations to crawl to a stop. again we have to test this. There are a lot of things to think about and have tests for. Without tests we can’t do successful refactoring! Fixing bad code We all have some bad code in our systems. We usually refer to that code as code smell as they violate good coding practices. Examples of such code smells are SQL injection, use of SELECT *, scalar UDFs or cursors, etc… Each of those is huge code smell and can result in major code changes. Take SELECT * from example. If we remove a column from a table the client using that SELECT * statement won’t have a clue about that until it runs. Then it will gracefully crash and burn. Not to mention the widely unknown SELECT * view refresh problem that Tomas LaRock (@SQLRockstar on Twitter) and Colin Stasiuk (@BenchmarkIT on Twitter) talk about in detail. Go read about it, it’s informative. Refactoring this includes replacing the * with column names and most likely change to application using the database. Breaking apart huge stored procedures Have you ever seen seen a stored procedure that was 2000 lines long? I have. It’s not pretty. It hurts the eyes and sucks the will to live the next 10 minutes. They are a maintenance nightmare and turn into things no one dares to touch. I’m willing to bet that 100% of time they don’t have a single test on them. Large stored procedures (and functions) are a clear sign that they contain business logic. General opinion on good database coding practices says that business logic has no business in the database. That’s the applications part. Refactoring such behemoths requires writing lots of edge case tests for the stored procedure input/output behavior and then start to refactor it. First we split the logic inside into smaller parts like new stored procedures and UDFs. Those then get called from the master stored procedure. Once we’ve successfully modularized the database code it’s best to transfer that logic into the applications consuming it. This only leaves the stored procedure with common data manipulation logic. Of course this isn’t always possible so having a plethora of performance and behavior unit tests is absolutely necessary to confirm we’ve actually improved the codebase in some way.   Refactoring is not a popular chore amongst developers or managers. The former don’t like fixing old code, the latter can’t see the financial benefit. Remember how we talked about being lousy at estimating future costs in the previous post? But there comes a time when it must be done. Hopefully I’ve given you some ideas how to get started. In the last post of the series we’ll take a look at the tools to use and an example of testing and refactoring.

    Read the article

  • Oracle Enterprise Manager Ops Center : Using Operational Profiles to Install Packages and other Content

    - by LeonShaner
    Oracle Enterprise Manager Ops Center provides numerous ways to deploy content, such as through OS Update Profiles, or as part of an OS Provisioning plan or combinations of those and other "Install Software" capabilities of Deployment Plans.  This short "how-to" blog will highlight an alternative way to deploy content using Operational Profiles. Usually we think of Operational Profiles as a way to execute a simple "one-time" script to perform a basic system administration function, which can optionally be based on user input; however, Operational Profiles can be much more powerful than that.  There is often more to performing an action than merely running a script -- sometimes configuration files, packages, binaries, and other scripts, etc. are needed to perform the action, and sometimes the user would like to leave such content on the system for later use. For shell scripts and other content written to be generic enough to work on any flavor of UNIX, converting the same scripts and configuration files into Solaris 10 SVR4 package, Solaris 11 IPS package, and/or a Linux RPM's might be seen as three times the work, for little appreciable gain.   That is where using an Operational Profile to deploy simple scripts and other generic content can be very helpful.  The approach is so powerful, that pretty much any kind of content can be deployed using an Operational Profile, provided the files involved are not overly large, and it is not necessary to convert the content into UNIX variant-specific formats. The basic formula for deploying content with an Operational Profile is as follows: Begin with a traditional script header, which is a UNIX shell script that will be responsible for decoding and extracting content, copying files into the right places, and executing any other scripts and commands needed to install and configure that content. Include steps to make the script platform-aware, to do the right thing for a given UNIX variant, or a "sorry" message if the operator has somehow tried to run the Operational Profile on a system where the script is not designed to run.  Ops Center can constrain execution by target type, so such checks at this level are an added safeguard, but also useful with the generic target type of "Operating System" where the admin wants the script to "do the right thing," whatever the UNIX variant. Include helpful output to show script progress, and any other informational messages that can help the admin determine what has gone wrong in the case of a problem in script execution.  Such messages will be shown in the job execution log. Include necessary "clean up" steps for normal and error exit conditions Set non-zero exit codes when appropriate -- a non-zero exit code will cause an Operational Profile job to be marked failed, which is the admin's cue to look into the job details for diagnostic messages in the output from the script. That first bullet deserves some explanation.  If Operational Profiles are usually simple "one-time" scripts and binary content is not allowed, then how does the actual content, packages, binaries, and other scripts get delivered along with the script?  More specifically, how does one include such content without needing to first create some kind of traditional package?   All that is required is to simply encode the content and append it to the end of the Operational Profile.  The header portion of the Operational Profile will need to contain the commands to decode the embedded content that has been appended to the bottom of the script.  The header code can do whatever else is needed, and finally clean up any intermediate files that were created during the decoding and extraction of the content. One way to encode binary and other content for inclusion in a script is to use the "uuencode" utility to convert the content into simple base64 ASCII text -- a form that is suitable to be appended to an Operational Profile.   The behavior of the "uudecode" utility is such that it will skip over any parts of the input that do not fit the uuencoded "begin" and "end" clauses.  For that reason, your header script will be skipped over, and uudecode will find your embedded content, that you will uuencode and paste at the end of the Operational Profile.  You can have as many "begin" / "end" clauses as you need -- just separate each embedded file by an empty line between "begin" and "end" clauses. Example:  Install SUNWsneep and set the system serial number Script:  deploySUNWsneep.sh ( <- right-click / save to download) Highlights: #!/bin/sh # Required variables: OC_SERIAL="$OC_SERIAL" # The user-supplied serial number for the asset ... Above is a good practice, showing right up front what kind of input the Operational Profile will require.   The right-hand side where $OC_SERIAL appears in this example will be filled in by Ops Center based on the user input at deployment time. The script goes on to restrict the use of the program to the intended OS type (Solaris 10 or older, in this example, but other content might be suitable for Solaris 11, or Linux -- it depends on the content and the script that will handle it). A temporary working directory is created, and then we have the command that decodes the embedded content from "self" which in scripting terms is $0 (a variable that expands to the name of the currently executing script): # Pass myself through uudecode, which will extract content to the current dir uudecode $0 At that point, whatever content was appended in uuencoded form at the end of the script has been written out to the current directory.  In this example that yields a file, SUNWsneep.7.0.zip, which the rest of the script proceeds to unzip, and pkgadd, followed by running "/opt/SUNWsneep/bin/sneep -s $OC_SERIAL" which is the command that stores the system serial for future use by other programs such as Explorer.   Don't get hung up on the example having used a pkgadd command.  The content started as a zip file and it could have been a tar.gz, or any other file.  This approach simply decodes the file.  The header portion of the script has to make sense of the file and do the right thing (e.g. it's up to you). The script goes on to clean up after itself, whether or not the above was successful.  Errors are echo'd by the script and a non-zero exit code is set where appropriate. Second to last, we have: # just in case, exit explicitly, so that uuencoded content will not cause error OPCleanUP exit # The rest of the script is ignored, except by uudecode # # UUencoded content follows # # e.g. for each file needed, #  $ uuencode -m {source} {source} > {target}.uu5 # then paste the {target}.uu5 files below # they will be extracted into the workding dir at $TDIR # The commentary above also describes how to encode the content. Finally we have the uuencoded content: begin-base64 444 SUNWsneep.7.0.zip UEsDBBQAAAAIAPsRy0Di3vnukAAAAMcAAAAKABUAcmVhZG1lLnR4dFVUCQADOqnVT7up ... VXgAAFBLBQYAAAAAAgACAJEAAADTNwEAAAA= ==== That last line of "====" is the base64 uuencode equivalent of a blank line, followed by "end" and as mentioned you can have as many begin/end clauses as you need.  Just separate each embedded file by a blank line after each ==== and before each begin-base64. Deploying the example Operational Profile looks like this (where I have pasted the system serial number into the required field): The job succeeded, but here is an example of the kind of diagnostic messages that the example script produces, and how Ops Center displays them in the job details: This same general approach could be used to deploy Explorer, and other useful utilities and scripts. Please let us know what you think?  Until next time...\Leon-- Leon Shaner | Senior IT/Product ArchitectSystems Management | Ops Center Engineering @ Oracle The views expressed on this [blog; Web site] are my own and do not necessarily reflect the views of Oracle. For more information, please go to Oracle Enterprise Manager  web page or  follow us at :  Twitter | Facebook | YouTube | Linkedin | Newsletter

    Read the article

  • Recursion in the form of a Recursive Func&lt;T, T&gt;

    - by ToStringTheory
    I gotta admit, I am kind of surprised that I didn’t realize I could do this sooner.  I recently had a problem which required a recursive function call to come up with the answer.  After some time messing around with a recursive method, and creating an API that I was not happy with, I was able to create an API that I enjoy, and seems intuitive. Introduction To bring it to a simple example, consider the summation to n: A mathematically identical formula is: In a .NET function, this can be represented by a function: Func<int, int> summation = x => x*(x+1)/2 Calling summation with an input integer will yield the summation to that number: var sum10 = summation(4); //sum10 would be equal to 10 But what if I wanted to get a second level summation…  First some to n, and then use that argument as the input to the same function, to find the second level summation: So as an easy example, calculate the summation to 3, which yields 6.  Then calculate the summation to 6 which yields 21. Represented as a mathematical formula - So what if I wanted to represent this as .NET functions.  I can always do: //using the summation formula from above var sum3 = summation(3); //sets sum3 to 6 var sum3_2 = summation(sum3); //sets sum3 to 21 I could always create a while loop to perform the calculations too: Func<int, int> summation = x => x*(x+1)/2; //for the interests of a smaller example, using shorthand int sumResultTo = 3; int level = 2; while(level-- > 0) { sumResultTo = summation(sumResultTo); } //sumResultTo is equal to 21 now. Or express it as a for-loop, method calls, etc…  I really didn’t like any of the options that I tried.  Then it dawned on me – since I was using a Func<T, T> anyways, why not use the Func’s output from one call as the input as another directly. Some Code So, I decided that I wanted a recursion class.  Something that I would be generic and reusable in case I ever wanted to do something like this again. It is limited to only the Func<T1, T2> level of Func, and T1 must be the same as T2. The first thing in this class is a private field for the function: private readonly Func<T, T> _functionToRecurse; So, I since I want the function to be unchangeable, I have defined it as readonly.  Therefore my constructor looks like: public Recursion(Func<T, T> functionToRecurse) { if (functionToRecurse == null) { throw new ArgumentNullException("functionToRecurse", "The function to recurse can not be null"); } _functionToRecurse = functionToRecurse; } Simple enough.  If you have any questions, feel free to post them in the comments, and I will be sure to answer them. Next, I want enough. If be able to get the result of a function dependent on how many levels of recursion: private Func<T, T> GetXLevel(int level) { if (level < 1) { throw new ArgumentOutOfRangeException("level", level, "The level of recursion must be greater than 0"); } if (level == 1) return _functionToRecurse; return _GetXLevel(level - 1, _functionToRecurse); } So, if you pass in 1 for the level, you get just the Func<T,T> back.  If you say that you want to go deeper down the rabbit hole, it calls a method which accepts the level it is at, and the function which it needs to use to recurse further: private Func<T, T> _GetXLevel(int level, Func<T, T> prevFunc) { if (level == 1) return y => prevFunc(_functionToRecurse(y)); return _GetXLevel(level - 1, y => prevFunc(_functionToRecurse(y))); } That is really all that is needed for this class. If I exposed the GetXLevel function publicly, I could use that to get the function for a level, and pass in the argument..  But I wanted something better.  So, I used the ‘this’ array operator for the class: public Func<T,T> this[int level] { get { if (level < 1) { throw new ArgumentOutOfRangeException("level", level, "The level of recursion must be greater than 0"); } return this.GetXLevel(level); } } So, using the same example above of finding the second recursion of the summation of 3: var summator = new Recursion<int>(x => (x * (x + 1)) / 2); var sum_3_level2 = summator[2](3); //yields 21 You can even find just store the delegate to the second level summation, and use it multiple times: var summator = new Recursion<int>(x => (x * (x + 1)) / 2); var sum_level2 = summator[2]; var sum_3_level2 = sum_level2(3); //yields 21 var sum_4_level2 = sum_level2(4); //yields 55 var sum_5_level2 = sum_level2(5); //yields 120 Full Code Don’t think I was just going to hold off on the full file together and make you do the hard work…  Copy this into a new class file: public class Recursion<T> { private readonly Func<T, T> _functionToRecurse; public Recursion(Func<T, T> functionToRecurse) { if (functionToRecurse == null) { throw new ArgumentNullException("functionToRecurse", "The function to recurse can not be null"); } _functionToRecurse = functionToRecurse; } public Func<T,T> this[int level] { get { if (level < 1) { throw new ArgumentOutOfRangeException("level", level, "The level of recursion must be greater than 0"); } return this.GetXLevel(level); } } private Func<T, T> GetXLevel(int level) { if (level < 1) { throw new ArgumentOutOfRangeException("level", level, "The level of recursion must be greater than 0"); } if (level == 1) return _functionToRecurse; return _GetXLevel(level - 1, _functionToRecurse); } private Func<T, T> _GetXLevel(int level, Func<T, T> prevFunc) { if (level == 1) return y => prevFunc(_functionToRecurse(y)); return _GetXLevel(level - 1, y => prevFunc(_functionToRecurse(y))); } } Conclusion The great thing about this class, is that it can be used with any function with same input/output parameters.  I strived to find an implementation that I found clean and useful, and I finally settled on this.  If you have feedback – good or bad, I would love to hear it!

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • plupload variable upload path?

    - by SoulieBaby
    Hi all, I'm using plupload to upload files to my server (http://www.plupload.com/index.php), however I wanted to know if there was any way of making the upload path variable. Basically I need to select the upload path folder first, then choose the files using plupload and then upload to the initially selected folder. I've tried a few different ways but I can't seem to pass along the variable folder path to the upload.php file. I'm using the flash version of plupload. If someone could help me out, that would be fantastic!! :) Here's my plupload jquery: jQuery.noConflict(); jQuery(document).ready(function() { jQuery("#flash_uploader").pluploadQueue({ // General settings runtimes: 'flash', url: '/assets/upload/upload.php', max_file_size: '10mb', chunk_size: '1mb', unique_names: false, // Resize images on clientside if we can resize: {width: 500, height: 350, quality: 100}, // Flash settings flash_swf_url: '/assets/upload/flash/plupload.flash.swf' }); }); And here's the upload.php file: <?php /** * upload.php * * Copyright 2009, Moxiecode Systems AB * Released under GPL License. * * License: http://www.plupload.com/license * Contributing: http://www.plupload.com/contributing */ // HTTP headers for no cache etc header('Content-type: text/plain; charset=UTF-8'); header("Expires: Mon, 26 Jul 1997 05:00:00 GMT"); header("Last-Modified: ".gmdate("D, d M Y H:i:s")." GMT"); header("Cache-Control: no-store, no-cache, must-revalidate"); header("Cache-Control: post-check=0, pre-check=0", false); header("Pragma: no-cache"); // Settings $targetDir = $_SERVER['DOCUMENT_ROOT']."/tmp/uploads"; //temp directory <- need these to be variable $finalDir = $_SERVER['DOCUMENT_ROOT']."/tmp/uploads2"; //final directory <- need these to be variable $cleanupTargetDir = true; // Remove old files $maxFileAge = 60 * 60; // Temp file age in seconds // 5 minutes execution time @set_time_limit(5 * 60); // usleep(5000); // Get parameters $chunk = isset($_REQUEST["chunk"]) ? $_REQUEST["chunk"] : 0; $chunks = isset($_REQUEST["chunks"]) ? $_REQUEST["chunks"] : 0; $fileName = isset($_REQUEST["name"]) ? $_REQUEST["name"] : ''; // Clean the fileName for security reasons $fileName = preg_replace('/[^\w\._]+/', '', $fileName); // Create target dir if (!file_exists($targetDir)) @mkdir($targetDir); // Remove old temp files if (is_dir($targetDir) && ($dir = opendir($targetDir))) { while (($file = readdir($dir)) !== false) { $filePath = $targetDir . DIRECTORY_SEPARATOR . $file; // Remove temp files if they are older than the max age if (preg_match('/\\.tmp$/', $file) && (filemtime($filePath) < time() - $maxFileAge)) @unlink($filePath); } closedir($dir); } else die('{"jsonrpc" : "2.0", "error" : {"code": 100, "message": "Failed to open temp directory."}, "id" : "id"}'); // Look for the content type header if (isset($_SERVER["HTTP_CONTENT_TYPE"])) $contentType = $_SERVER["HTTP_CONTENT_TYPE"]; if (isset($_SERVER["CONTENT_TYPE"])) $contentType = $_SERVER["CONTENT_TYPE"]; if (strpos($contentType, "multipart") !== false) { if (isset($_FILES['file']['tmp_name']) && is_uploaded_file($_FILES['file']['tmp_name'])) { // Open temp file $out = fopen($targetDir . DIRECTORY_SEPARATOR . $fileName, $chunk == 0 ? "wb" : "ab"); if ($out) { // Read binary input stream and append it to temp file $in = fopen($_FILES['file']['tmp_name'], "rb"); if ($in) { while ($buff = fread($in, 4096)) fwrite($out, $buff); } else die('{"jsonrpc" : "2.0", "error" : {"code": 101, "message": "Failed to open input stream."}, "id" : "id"}'); fclose($out); unlink($_FILES['file']['tmp_name']); } else die('{"jsonrpc" : "2.0", "error" : {"code": 102, "message": "Failed to open output stream."}, "id" : "id"}'); } else die('{"jsonrpc" : "2.0", "error" : {"code": 103, "message": "Failed to move uploaded file."}, "id" : "id"}'); } else { // Open temp file $out = fopen($targetDir . DIRECTORY_SEPARATOR . $fileName, $chunk == 0 ? "wb" : "ab"); if ($out) { // Read binary input stream and append it to temp file $in = fopen("php://input", "rb"); if ($in) { while ($buff = fread($in, 4096)){ fwrite($out, $buff); } } else die('{"jsonrpc" : "2.0", "error" : {"code": 101, "message": "Failed to open input stream."}, "id" : "id"}'); fclose($out); } else die('{"jsonrpc" : "2.0", "error" : {"code": 102, "message": "Failed to open output stream."}, "id" : "id"}'); } //Moves the file from $targetDir to $finalDir after receiving the final chunk if($chunk == ($chunks-1)){ rename($targetDir . DIRECTORY_SEPARATOR . $fileName, $finalDir . DIRECTORY_SEPARATOR . $fileName); } // Return JSON-RPC response die('{"jsonrpc" : "2.0", "result" : null, "id" : "id"}'); ?>

    Read the article

  • Is there any better way for creating a dynamic HTML table without using any javascript library like

    - by piemesons
    Dont worry we dont need to find out any bug in this code.. Its working perfectly.:-P My boss came to me and said "Hey just tell me whats the best of way of writing code for a dynamic HTML table (add row, delete row, update row).No need to add any CSS. Just javascript. No Jquery library etc. I was confused that in the middle of the project why he asking for some stupid exercise like this. What ever i wrote the following code and mailed him and after 15 mins i got a mail from him. " I was expecting much better code from a guy like you. Anyways good job monkey.(And with a picture of monkey as attachment.) thats was the mail. Line by line. I want to reply him but before that i want to know about the quality of my code. Is this really shitty...!!! Or he was just making fun of mine. I dont think that code is really shitty. Still correct me if you can.Code is working perfectly fine. Just copy paste it in a HTML file. <html> <head> <title> Exercise CSS </title> <script type="text/javascript"> function add_row() { var table = document.getElementById('table'); var rowCount = table.rows.length; var row = table.insertRow(rowCount); var cell1 = row.insertCell(0); var element1 = document.createElement("input"); element1.type = "text"; cell1.appendChild(element1); var cell2 = row.insertCell(1); var element2 = document.createElement("input"); element2.type = "text"; cell2.appendChild(element2); var cell3 = row.insertCell(2); cell3.innerHTML = ' <span onClick="edit(this)">Edit</span>/<span onClick="delete_row(this)">Delete</span>'; cell3.setAttribute("style", "display:none;"); var cell4 = row.insertCell(3); cell4.innerHTML = '<span onClick="save(this)">Save</span>'; } function save(e) { var elTableCells = e.parentNode.parentNode.getElementsByTagName("td"); elTableCells[0].innerHTML=elTableCells[0].firstChild.value; elTableCells[1].innerHTML=elTableCells[1].firstChild.value; elTableCells[2].setAttribute("style", "display:block;"); elTableCells[3].setAttribute("style", "display:none;"); } function edit(e) { var elTableCells = e.parentNode.parentNode.getElementsByTagName("td"); elTableCells[0].innerHTML='<input type="text" value="'+elTableCells[0].innerHTML+'">'; elTableCells[1].innerHTML='<input type="text" value="'+elTableCells[1].innerHTML+'">'; elTableCells[2].setAttribute("style", "display:none;"); elTableCells[3].setAttribute("style", "display:block;"); } function delete_row(e) { e.parentNode.parentNode.parentNode.removeChild(e.parentNode.parentNode); } </script> </head> <body > <div id="display"> <table id='table'> <tr id='id'> <td> Piemesons </td> <td> 23 </td> <td > <span onClick="edit(this)">Edit</span>/<span onClick="delete_row(this)">Delete</span> </td> <td style="display:none;"> <span onClick="save(this)">Save</span> </td> </tr> </table> <input type="button" value="Add new row" onClick="add_row();" /> </div> </body>

    Read the article

  • how to generate tinymce to ajax generated textarea

    - by Jai_pans
    Hi, i have a image multi-uloader script which also each item uploaded was preview 1st b4 it submitted and each images has its following textarea which are also generated by javascript and my problem is i want to use the tinymce editor to each textarea generated by the ajax. Any help will be appreciated.. here is my script function fileQueueError(file, errorCode, message) { try { var imageName = "error.gif"; var errorName = ""; if (errorCode === SWFUpload.errorCode_QUEUE_LIMIT_EXCEEDED) { errorName = "You have attempted to queue too many files."; } if (errorName !== "") { alert(errorName); return; } switch (errorCode) { case SWFUpload.QUEUE_ERROR.ZERO_BYTE_FILE: imageName = "zerobyte.gif"; break; case SWFUpload.QUEUE_ERROR.FILE_EXCEEDS_SIZE_LIMIT: imageName = "toobig.gif"; break; case SWFUpload.QUEUE_ERROR.ZERO_BYTE_FILE: case SWFUpload.QUEUE_ERROR.INVALID_FILETYPE: default: alert(message); break; } addImage("images/" + imageName); } catch (ex) { this.debug(ex); } } function fileDialogComplete(numFilesSelected, numFilesQueued) { try { if (numFilesQueued 0) { this.startUpload(); } } catch (ex) { this.debug(ex); } } function uploadProgress(file, bytesLoaded) { try { var percent = Math.ceil((bytesLoaded / file.size) * 100); var progress = new FileProgress(file, this.customSettings.upload_target); progress.setProgress(percent); if (percent === 100) { progress.setStatus("Creating thumbnail..."); progress.toggleCancel(false, this); } else { progress.setStatus("Uploading..."); progress.toggleCancel(true, this); } } catch (ex) { this.debug(ex); } } function uploadSuccess(file, serverData) { try { var progress = new FileProgress(file, this.customSettings.upload_target); if (serverData.substring(0, 7) === "FILEID:") { addRow("tableID","thumbnail.php?id=" + serverData.substring(7),file.name); //setup(); //generateTinyMCE('itemdescription[]'); progress.setStatus("Thumbnail Created."); progress.toggleCancel(false); } else { addImage("images/error.gif"); progress.setStatus("Error."); progress.toggleCancel(false); alert(serverData); } } catch (ex) { this.debug(ex); } } function uploadComplete(file) { try { /* I want the next upload to continue automatically so I'll call startUpload here */ if (this.getStats().files_queued 0) { this.startUpload(); } else { var progress = new FileProgress(file, this.customSettings.upload_target); progress.setComplete(); progress.setStatus("All images received."); progress.toggleCancel(false); } } catch (ex) { this.debug(ex); } } function uploadError(file, errorCode, message) { var imageName = "error.gif"; var progress; try { switch (errorCode) { case SWFUpload.UPLOAD_ERROR.FILE_CANCELLED: try { progress = new FileProgress(file, this.customSettings.upload_target); progress.setCancelled(); progress.setStatus("Cancelled"); progress.toggleCancel(false); } catch (ex1) { this.debug(ex1); } break; case SWFUpload.UPLOAD_ERROR.UPLOAD_STOPPED: try { progress = new FileProgress(file, this.customSettings.upload_target); progress.setCancelled(); progress.setStatus("Stopped"); progress.toggleCancel(true); } catch (ex2) { this.debug(ex2); } case SWFUpload.UPLOAD_ERROR.UPLOAD_LIMIT_EXCEEDED: imageName = "uploadlimit.gif"; break; default: alert(message); break; } addImage("images/" + imageName); } catch (ex3) { this.debug(ex3); } } function addRow(tableID,src,filename) { var table = document.getElementById(tableID); var rowCount = table.rows.length; var row = table.insertRow(rowCount); rowCount + 1; row.id = "row"+rowCount; var cell0 = row.insertCell(0); cell0.innerHTML = rowCount; cell0.style.background = "#FFFFFF"; var cell1 = row.insertCell(1); cell1.align = "center"; cell1.style.background = "#FFFFFF"; var imahe = document.createElement("img"); imahe.setAttribute("src",src); var hidden = document.createElement("input"); hidden.setAttribute("type","hidden"); hidden.setAttribute("name","filename[]"); hidden.setAttribute("value",filename); /*var hidden2 = document.createElement("input"); hidden2.setAttribute("type","hidden"); hidden2.setAttribute("name","filename[]"); hidden2.setAttribute("value",filename); cell1.appendChild(hidden2);*/ cell1.appendChild(hidden); cell1.appendChild(imahe); var cell2 = row.insertCell(2); cell2.align = "left"; cell2.valign = "top"; cell2.style.background = "#FFFFFF"; //tr1.appendChild(td1); var div2 = document.createElement("div"); div2.style.padding ="0 0 0 10px"; div2.style.width = "400px"; var alink = document.createElement("a"); //alink.style.margin="40px 0 0 0"; alink.href ="#"; alink.innerHTML ="Cancel"; alink.onclick= function () { document.getElementById(row.id).style.display='none'; document.getElementById(textfield.id).disabled='disabled'; }; var div = document.createElement("div"); div.style.margin="10px 0"; div.appendChild(alink); var textfield = document.createElement("input"); textfield.id = "file"+rowCount; textfield.type = "text"; textfield.name = "itemname[]"; textfield.style.margin = "10px 0"; textfield.style.width = "400px"; textfield.value = "Item Name"; textfield.onclick= function(){ //textfield.value=""; if(textfield.value=="Item Name") textfield.value=""; if(desc.innerHTML=="") desc.innerHTML ="Item Description"; if(price.value=="") price.value="Item Price"; } var desc = document.createElement("textarea"); desc.name = "itemdescription[]"; desc.cols = "80"; desc.rows = "4"; desc.innerHTML = "Item Description"; desc.onclick = function(){ if(desc.innerHTML== "Item Description") desc.innerHTML = ""; if(textfield.value=="Item name" || textfield.value=="") textfield.value="Item Name"; if(price.value=="") price.value="Item Price"; } var price = document.createElement("input"); price.id = "file"+rowCount; price.type = "text"; price.name = "itemprice[]"; price.style.margin = "10px 0"; price.style.width = "400px"; price.value = "Item Price"; price.onclick= function(){ if(price.value=="Item Price") price.value=""; if(desc.innerHTML=="") desc.innerHTML ="Item Description"; if(textfield.value=="") textfield.value="Item Name"; } var span = document.createElement("span"); span.innerHTML = "View"; span.style.width = "auto"; span.style.padding = "10px 0"; var view = document.createElement("input"); view.id = "file"+rowCount; view.type = "checkbox"; view.name = "publicview[]"; view.value = "y"; view.checked = "checked"; var div3 = document.createElement("div"); div3.appendChild(span); div3.appendChild(view); var div4 = document.createElement("div"); div4.style.padding = "10px 0"; var span2 = document.createElement("span"); span2.innerHTML = "Default Display"; span2.style.width = "auto"; span2.style.padding = "10px 0"; var radio = document.createElement("input"); radio.type = "radio"; radio.name = "setdefault"; radio.value = "y"; div4.appendChild(span2); div4.appendChild(radio); div2.appendChild(div); //div2.appendChild(label); //div2.appendChild(table); div2.appendChild(textfield); div2.appendChild(desc); div2.appendChild(price); div2.appendChild(div3); div2.appendChild(div4); cell2.appendChild(div2); } function addImage(src,val_id) { var newImg = document.createElement("img"); newImg.style.margin = "5px 50px 5px 5px"; newImg.style.display= "inline"; newImg.id=val_id; document.getElementById("thumbnails").appendChild(newImg); if (newImg.filters) { try { newImg.filters.item("DXImageTransform.Microsoft.Alpha").opacity = 0; } catch (e) { // If it is not set initially, the browser will throw an error. This will set it if it is not set yet. newImg.style.filter = 'progid:DXImageTransform.Microsoft.Alpha(opacity=' + 0 + ')'; } } else { newImg.style.opacity = 0; } newImg.onload = function () { fadeIn(newImg, 0); }; newImg.src = src; } function fadeIn(element, opacity) { var reduceOpacityBy = 5; var rate = 30; // 15 fps if (opacity < 100) { opacity += reduceOpacityBy; if (opacity > 100) { opacity = 100; } if (element.filters) { try { element.filters.item("DXImageTransform.Microsoft.Alpha").opacity = opacity; } catch (e) { // If it is not set initially, the browser will throw an error. This will set it if it is not set yet. element.style.filter = 'progid:DXImageTransform.Microsoft.Alpha(opacity=' + opacity + ')'; } } else { element.style.opacity = opacity / 100; } } if (opacity < 100) { setTimeout(function () { fadeIn(element, opacity); }, rate); } } /* ************************************** * FileProgress Object * Control object for displaying file info * ************************************** */ function FileProgress(file, targetID) { this.fileProgressID = "divFileProgress"; this.fileProgressWrapper = document.getElementById(this.fileProgressID); if (!this.fileProgressWrapper) { this.fileProgressWrapper = document.createElement("div"); this.fileProgressWrapper.className = "progressWrapper"; this.fileProgressWrapper.id = this.fileProgressID; this.fileProgressElement = document.createElement("div"); this.fileProgressElement.className = "progressContainer"; var progressCancel = document.createElement("a"); progressCancel.className = "progressCancel"; progressCancel.href = "#"; progressCancel.style.visibility = "hidden"; progressCancel.appendChild(document.createTextNode(" ")); var progressText = document.createElement("div"); progressText.className = "progressName"; progressText.appendChild(document.createTextNode(file.name)); var progressBar = document.createElement("div"); progressBar.className = "progressBarInProgress"; var progressStatus = document.createElement("div"); progressStatus.className = "progressBarStatus"; progressStatus.innerHTML = "&nbsp;"; this.fileProgressElement.appendChild(progressCancel); this.fileProgressElement.appendChild(progressText); this.fileProgressElement.appendChild(progressStatus); this.fileProgressElement.appendChild(progressBar); this.fileProgressWrapper.appendChild(this.fileProgressElement); document.getElementById(targetID).appendChild(this.fileProgressWrapper); fadeIn(this.fileProgressWrapper, 0); } else { this.fileProgressElement = this.fileProgressWrapper.firstChild; this.fileProgressElement.childNodes[1].firstChild.nodeValue = file.name; } this.height = this.fileProgressWrapper.offsetHeight; } FileProgress.prototype.setProgress = function (percentage) { this.fileProgressElement.className = "progressContainer green"; this.fileProgressElement.childNodes[3].className = "progressBarInProgress"; this.fileProgressElement.childNodes[3].style.width = percentage + "%"; }; FileProgress.prototype.setComplete = function () { this.fileProgressElement.className = "progressContainer blue"; this.fileProgressElement.childNodes[3].className = "progressBarComplete"; this.fileProgressElement.childNodes[3].style.width = ""; }; FileProgress.prototype.setError = function () { this.fileProgressElement.className = "progressContainer red"; this.fileProgressElement.childNodes[3].className = "progressBarError"; this.fileProgressElement.childNodes[3].style.width = ""; }; FileProgress.prototype.setCancelled = function () { this.fileProgressElement.className = "progressContainer"; this.fileProgressElement.childNodes[3].className = "progressBarError"; this.fileProgressElement.childNodes[3].style.width = ""; }; FileProgress.prototype.setStatus = function (status) { this.fileProgressElement.childNodes[2].innerHTML = status; }; FileProgress.prototype.toggleCancel = function (show, swfuploadInstance) { this.fileProgressElement.childNodes[0].style.visibility = show ? "visible" : "hidden"; if (swfuploadInstance) { var fileID = this.fileProgressID; this.fileProgressElement.childNodes[0].onclick = function () { swfuploadInstance.cancelUpload(fileID); return false; }; } }; i am using a swfuploader an i jst added a input fields and a textarea when it preview the images which ready to be uploaded and from my html i have this script var swfu; window.onload = function () { swfu = new SWFUpload({ // Backend Settings upload_url: "../we_modules/upload.php", // Relative to the SWF file or absolute post_params: {"PHPSESSID": ""}, // File Upload Settings file_size_limit : "20 MB", // 2MB file_types : "*.*", //file_types : "", file_types_description : "jpg", file_upload_limit : "0", file_queue_limit : "0", // Event Handler Settings - these functions as defined in Handlers.js // The handlers are not part of SWFUpload but are part of my website and control how // my website reacts to the SWFUpload events. //file_queued_handler : fileQueued, file_queue_error_handler : fileQueueError, file_dialog_complete_handler : fileDialogComplete, upload_progress_handler : uploadProgress, upload_error_handler : uploadError, upload_success_handler : uploadSuccess, upload_complete_handler : uploadComplete, // Button Settings button_image_url : "../we_modules/images/SmallSpyGlassWithTransperancy_17x18.png", // Relative to the SWF file button_placeholder_id : "spanButtonPlaceholder", button_width: 180, button_height: 18, button_text : 'Select Files(2 MB Max)', button_text_style : '.button { font-family: Helvetica, Arial, sans-serif; font-size: 12pt;cursor:pointer } .buttonSmall { font-size: 10pt; }', button_text_top_padding: 0, button_text_left_padding: 18, button_window_mode: SWFUpload.WINDOW_MODE.TRANSPARENT, button_cursor: SWFUpload.CURSOR.HAND, // Flash Settings flash_url : "../swfupload/swfupload.swf", custom_settings : { upload_target : "divFileProgressContainer" }, // Debug Settings debug: false }); }; where should i put on the tinymce function as you mention below?

    Read the article

  • What's the best/most efficent way to create a semi-intelligent AI for a tic tac toe game?

    - by Link
    basically I am attempting to make a a efficient/smallish C game of Tic-Tac-Toe. I have implemented everything other then the AI for the computer so far. my squares are basically structs in an array with an assigned value based on the square. For example s[1].value = 1; therefore it's a x, and then a value of 3 would be a o. My question is whats the best way to create a semi-decent game playing AI for my tic-tac-toe game? I don't really want to use minimax, since It's not what I need. So how do I avoid a a lot of if statments and make it more efficient. Here is the rest of my code: #include <stdio.h> #include <stdlib.h> #include <string.h> #include <time.h> struct state{ // defined int state; // 0 is tie, 1 is user loss, 2 is user win, 3 is ongoing game int moves; }; struct square{ // one square of the board int value; // 1 is x, 3 is o char sign; // no space used }; struct square s[9]; //set up the struct struct state gamestate = {0,0}; //nothing void setUpGame(){ // setup the game int i = 0; for(i = 0; i < 9; i++){ s[i].value = 0; s[i].sign = ' '; } gamestate.moves=0; printf("\nHi user! You're \"x\"! I'm \"o\"! Good Luck :)\n"); } void displayBoard(){// displays the game board printf("\n %c | %c | %c\n", s[6].sign, s[7].sign, s[8].sign); printf("-----------\n"); printf(" %c | %c | %c\n", s[3].sign, s[4].sign, s[5].sign); printf("-----------\n"); printf(" %c | %c | %c\n\n", s[0].sign, s[1].sign, s[2].sign); } void getHumanMove(){ // get move from human int i; while(1){ printf(">>:"); char line[255]; // input the move to play fgets(line, sizeof(line), stdin); while(sscanf(line, "%d", &i) != 1) { //1 match of defined specifier on input line printf("Sorry, that's not a valid move!\n"); fgets(line, sizeof(line), stdin); } if(s[i-1].value != 0){printf("Sorry, That moves already been taken!\n\n");continue;} break; } s[i-1].value = 1; s[i-1].sign = 'x'; gamestate.moves++; } int sum(int x, int y, int z){return(x*y*z);} void getCompMove(){ // get the move from the computer } void checkWinner(){ // check the winner int i; for(i = 6; i < 9; i++){ // check cols if((sum(s[i].value,s[i-3].value,s[i-6].value)) == 8){printf("The Winner is o!\n");gamestate.state=1;} if((sum(s[i].value,s[i-3].value,s[i-6].value)) == 1){printf("The Winner is x!\n");gamestate.state=2;} } for(i = 0; i < 7; i+=3){ // check rows if((sum(s[i].value,s[i+1].value,s[i+2].value)) == 8){printf("The Winner is o!\n");gamestate.state=1;} if((sum(s[i].value,s[i+1].value,s[i+2].value)) == 1){printf("The Winner is x!\n");gamestate.state=2;} } if((sum(s[0].value,s[4].value,s[8].value)) == 8){printf("The Winner is o!\n");gamestate.state=1;} if((sum(s[0].value,s[4].value,s[8].value)) == 1){printf("The Winner is x!\n");gamestate.state=2;} if((sum(s[2].value,s[4].value,s[6].value)) == 8){printf("The Winner is o!\n");gamestate.state=1;} if((sum(s[2].value,s[4].value,s[6].value)) == 1){printf("The Winner is x!\n");gamestate.state=2;} } void playGame(){ // start playing the game gamestate.state = 3; //set-up the gamestate srand(time(NULL)); int temp = (rand()%2) + 1; if(temp == 2){ // if two comp goes first temp = (rand()%2) + 1; if(temp == 2){ s[4].value = 2; s[4].sign = 'o'; gamestate.moves++; }else{ s[2].value = 2; s[2].sign = 'o'; gamestate.moves++; } } displayBoard(); while(gamestate.state == 3){ if(gamestate.moves<10); getHumanMove(); if(gamestate.moves<10); getCompMove(); checkWinner(); if(gamestate.state == 3 && gamestate.moves==9){ printf("The game is a tie :p\n"); break; } displayBoard(); } } int main(int argc, const char *argv[]){ printf("Welcome to Tic Tac Toe\nby The Elite Noob\nEnter 1-9 To play a move, standard numpad\n1 is bottom-left, 9 is top-right\n"); while(1){ // while game is being played printf("\nPress 1 to play a new game, or any other number to exit;\n>>:"); char line[255]; // input whether or not to play the game fgets(line, sizeof(line), stdin); int choice; // user's choice about playing or not while(sscanf(line, "%d", &choice) != 1) { //1 match of defined specifier on input line printf("Sorry, that's not a valid option!\n"); fgets(line, sizeof(line), stdin); } if(choice == 1){ setUpGame(); // set's up the game playGame(); // Play a Game }else {break;} // exit the application } printf("\nThank's For playing!\nHave a good Day!\n"); return 0; }

    Read the article

  • Panel is not displaying in JFrame

    - by mallikarjun
    I created a chat panel and added to Jframe but the panel is not displaying. But my sop in the chat panel are displaying in the console. Any one please let me know what could be the problem My Frame public class MyFrame extends JFrame { MyPanel chatClient; String input; public MyFrame() { input = (String)JOptionPane.showInputDialog(null, "Name:", "Connect to chat server", JOptionPane.QUESTION_MESSAGE, null,null, "Test"); input=input.trim(); chatClient = new MyPanel("localhost",input); setVisible(true); setDefaultCloseOperation(JFrame.EXIT_ON_CLOSE); add(chatClient); } public static void main(String...args){ new MyFrame(); } } MyPanel: public class MyPanel extends JPanel{ ChatClient chatClient; public MyPanel(String host, String uid) { chatClient= new ChatClient(host,uid); add(chatClient.getChatPanel()); this.setVisible(true); } } chat panel: public class ChatClient { Client client; String name; ChatPanel chatPanel; String hostid; public ChatClient(String host,String uid){ client = new Client(); client.start(); System.out.println("in constructor"); Network.register(client); client.addListener(new Listener(){ public void connected(Connection connection){ System.out.println("in client connected method"); Network.RegisterName registerName = new Network.RegisterName(); registerName.name=name; client.sendTCP(registerName); } public void received(Connection connection,Object object){ System.out.println("in client received method"); if (object instanceof Network.UpdateNames) { Network.UpdateNames updateNames = (Network.UpdateNames)object; //chatFrame.setNames(updateNames.names); System.out.println("got it message"); return; } if (object instanceof Network.ChatMessage) { Network.ChatMessage chatMessage = (Network.ChatMessage)object; //chatFrame.addMessage(chatMessage.text); System.out.println("send it message"); return; } } }); // end of listner name=uid.trim(); hostid=host.trim(); chatPanel = new ChatPanel(hostid,name); chatPanel.setSendListener(new Runnable(){ public void run(){ Network.ChatMessage chatMessage = new Network.ChatMessage(); chatMessage.chatMessage=chatPanel.getSendText(); client.sendTCP(chatMessage); } }); new Thread("connect"){ public void run(){ try{ client.connect(5000, hostid,Network.port); }catch(IOException e){ e.printStackTrace(); } } }.start(); }//end of constructor static public class ChatPanel extends JPanel{ CardLayout cardLayout; JList messageList,nameList; JTextField sendText; JButton sendButton; JPanel topPanel,bottomPanel,panel; public ChatPanel(String host,String user){ setSize(600, 200); this.setVisible(true); System.out.println("Chat panel "+host+"user: "+user); { panel = new JPanel(new BorderLayout()); { topPanel = new JPanel(new GridLayout(1,2)); panel.add(topPanel); { topPanel.add(new JScrollPane(messageList=new JList())); messageList.setModel(new DefaultListModel()); } { topPanel.add(new JScrollPane(nameList=new JList())); nameList.setModel(new DefaultListModel()); } DefaultListSelectionModel disableSelections = new DefaultListSelectionModel() { public void setSelectionInterval (int index0, int index1) { } }; messageList.setSelectionModel(disableSelections); nameList.setSelectionMode(ListSelectionModel.SINGLE_SELECTION); } { bottomPanel = new JPanel(new GridBagLayout()); panel.add(bottomPanel,BorderLayout.SOUTH); bottomPanel.add(sendText=new JTextField(),new GridBagConstraints(0,0,1,1,1,0,GridBagConstraints.CENTER,GridBagConstraints.BOTH,new Insets(0,0,0,0),0,0)); bottomPanel.add(sendButton=new JButton(),new GridBagConstraints(1,0,1,1,0,0,GridBagConstraints.CENTER,0,new Insets(0,0,0,0),0,0)); } } sendText.addActionListener(new ActionListener(){ public void actionPerformed(ActionEvent e){ sendButton.doClick(); } }); } public void setSendListener (final Runnable listener) { sendButton.addActionListener(new ActionListener() { public void actionPerformed (ActionEvent evt) { if (getSendText().length() == 0) return; listener.run(); sendText.setText(""); sendText.requestFocus(); } }); } public String getSendText () { return sendText.getText().trim(); } public void setNames (final String[] names) { EventQueue.invokeLater(new Runnable(){ public void run(){ DefaultListModel model = (DefaultListModel)nameList.getModel(); model.removeAllElements(); for(String name:names) model.addElement(name); } }); } public void addMessage (final String message) { EventQueue.invokeLater(new Runnable() { public void run () { DefaultListModel model = (DefaultListModel)messageList.getModel(); model.addElement(message); messageList.ensureIndexIsVisible(model.size() - 1); } }); } } public JPanel getChatPanel(){ return chatPanel; } }

    Read the article

  • Saving a Join Model

    - by Thorpe Obazee
    I've been reading the cookbook for a while now and still don't get how I'm supposed to do this: My original problem was this: A related Model isn't being validated From RabidFire's commment: If you want to count the number of Category models that a new Post is associated with (on save), then you need to do this in the beforeSave function as I've mentioned. As you've currently set up your models, you don't need to use the multiple rule anywhere. If you really, really want to validate against a list of Category IDs for some reason, then create a join model, and validate category_id with the multiple rule there. Now, I have these models and are now validating. The problem now is that data isn't being saved in the Join Table: class Post extends AppModel { var $name = 'Post'; var $hasMany = array( 'CategoryPost' => array( 'className' => 'CategoryPost' ) ); var $belongsTo = array( 'Page' => array( 'className' => 'Page' ) ); class Category extends AppModel { var $name = 'Category'; var $hasMany = array( 'CategoryPost' => array( 'className' => 'CategoryPost' ) ); class CategoryPost extends AppModel { var $name = 'CategoryPost'; var $validate = array( 'category_id' => array( 'rule' => array('multiple', array('in' => array(1, 2, 3, 4))), 'required' => FALSE, 'message' => 'Please select one, two or three options' ) ); var $belongsTo = array( 'Post' => array( 'className' => 'Post' ), 'Category' => array( 'className' => 'Category' ) ); This is the new Form: <div id="content-wrap"> <div id="main"> <h2>Add Post</h2> <?php echo $this->Session->flash();?> <div> <?php echo $this->Form->create('Post'); echo $this->Form->input('Post.title'); echo $this->Form->input('CategoryPost.category_id', array('multiple' => 'checkbox')); echo $this->Form->input('Post.body', array('rows' => '3')); echo $this->Form->input('Page.meta_keywords'); echo $this->Form->input('Page.meta_description'); echo $this->Form->end('Save Post'); ?> </div> <!-- main ends --> </div> The data I am producing from the form is as follows: Array ( [Post] => Array ( [title] => 1234 [body] => 1234 ) [CategoryPost] => Array ( [category_id] => Array ( [0] => 1 [1] => 2 ) ) [Page] => Array ( [meta_keywords] => 1234 [meta_description] => 1234 [title] => 1234 [layout] => index ) ) UPDATE: controller action //Controller action function admin_add() { // pr(Debugger::trace()); $this->set('categories', $this->Post->CategoryPost->Category->find('list')); if ( ! empty($this->data)) { $this->data['Page']['title'] = $this->data['Post']['title']; $this->data['Page']['layout'] = 'index'; debug($this->data); if ($this->Post->saveAll($this->data)) { $this->Session->setFlash('Your post has been saved', 'flash_good'); $this->redirect($this->here); } } } UPDATE #2: Should I just do this manually? The problem is that the join tables doesn't have things saved in it. Is there something I'm missing? UPDATE #3 RabidFire gave me a solution. I already did this before and am quite surprised as so why it didn't work. Thus, me asking here. The reason I think there is something wrong. I don't know where: Post beforeSave: function beforeSave() { if (empty($this->id)) { $this->data[$this->name]['uri'] = $this->getUniqueUrl($this->data[$this->name]['title']); } if (isset($this->data['CategoryPost']['category_id']) && is_array($this->data['CategoryPost']['category_id'])) { echo 'test'; $categoryPosts = array(); foreach ($this->data['CategoryPost']['category_id'] as $categoryId) { $categoryPost = array( 'category_id' => $categoryId ); array_push($categoryPosts, $categoryPost); } $this->data['CategoryPost'] = $categoryPosts; } debug($this->data); // Gives RabidFire's correct array for saving. return true; } My Post action: function admin_add() { // pr(Debugger::trace()); $this->set('categories', $this->Post->CategoryPost->Category->find('list')); if ( ! empty($this->data)) { $this->data['Page']['title'] = $this->data['Post']['title']; $this->data['Page']['layout'] = 'index'; debug($this->data); // First debug is giving the correct array as above. if ($this->Post->saveAll($this->data)) { debug($this->data); // STILL gives the above array. which shouldn't be because of the beforeSave in the Post Model // $this->Session->setFlash('Your post has been saved', 'flash_good'); // $this->redirect($this->here); } } }

    Read the article

  • PROBLEM: PHP strip_tags & multi-dimensional array form parameter

    - by Tunji Gbadamosi
    I'm having problems stripping the tags from the textual inputs retrieved from my form so as to do something with them in checkout.php. The input is stored in a multi-dimensional array. Here's my form: echo '<form name="choose" action="checkout.php" method="post" onsubmit="return validate_second_form(this);">'; echo '<input type="hidden" name="hidden_value" value="'.$no_guests.'" />'; if($no_guests >= 1){ echo '<div class="volunteer">'; echo '<fieldset>'; echo '<legend>Volunteer:</legend>'; echo '<label>Table:</label>'; echo '<select name="volunteer_table">'; foreach($tables as $t){ echo '<option>'.$t.'</option>'; } echo '</select><br><br>'; echo '<label>Seat number:</label>'; echo '<select name="volunteer_seat">'; foreach($seats as $seat){ echo '<option>'.$seat.'</option>'; } echo '</select><br><br>'; //echo '<br>'; echo '</fieldset>'; echo '</div>'; for($i=0;$i<$no_guests;$i++){ $guest = "guest_".$i; echo '<div class="'.$guest.'">'; echo '<fieldset>'; echo '<legend>Guest '.$i.':</legend>'; echo '<label>First Name:</label>'; echo '<input type="text" name="guest['.$i.']['.$first_name.']" id="fn'.$i.'">'; echo '<label>Surname:</label>'; echo '<input type="text" name="guest['.$i.']['.$surname.']" id="surname'.$i.'"><br><br>'; echo '<label>Date of Birth:</label> <br>'; echo '<label>Day:</label>'; echo '<select name="guest['.$i.'][dob_day]">'; for($j=1;$j<32;$j++){ echo"<option value='$j'>$j</option>"; } echo '</select>'; echo '<label>Month:</label>'; echo '<select name="guest['.$i.'][dob_month]">'; for($j=0;$j<sizeof($month);$j++){ $value = ($j + 1); echo"<option value='$value'>$month[$j]</option>"; } echo '</select>'; echo '<label>Year:</label>'; echo '<select name="guest['.$i.'][dob_year]">'; for($j=1900;$j<$year_limit;$j++){ echo"<option value='$j'>$j</option>"; } echo '</select> <br><br>'; echo '<label>Sex:</label>'; echo '<select name="guest['.$i.']['.$sex.']">'; echo '<option>Female</option>'; echo '<option>Male</option>'; echo '</select><br><br>'; echo '<label>Table:</label>'; echo '<select name="guest['.$i.']['.$table.']">'; foreach($tables as $t){ echo '<option>'.$t.'</option>'; } echo '</select><br><br>'; echo '<label>Seat number:</label>'; echo '<select name="guest['.$i.']['.$seat_no.']">'; foreach($seats as $seat){ echo '<option>'.$seat.'</option>'; } echo '</select><br><br>'; //echo '<br>'; echo '</fieldset>'; echo '</div>'; } } else{ echo '<div id="volunteer">'; echo '<fieldset>'; echo '<legend>Volunteer:</legend>'; echo '<label>Table:</label>'; echo '<select name="volunteer['.$table.']">'; foreach($tables as $t){ echo '<option>'.$t.'</option>'; } echo '</select><br><br>'; echo '<label>Seat number:</label>'; echo '<select name="volunteer['.$seat_no.']">'; foreach($seats as $seat){ echo '<option>'.$seat.'</option>'; } echo '</select><br><br>'; //echo '<br>'; echo '</fieldset>'; echo '</div>'; } echo '<input type="submit" value="Submit form">'; echo '</form>'; here's checkout.php: if(isset($_POST['guest'])){ foreach($_POST['guest'] as $guest){ $guest['first_name'] = strip_tags($guest['first_name']); $guest['surname'] = strip_tags($guest['surname']); } //$_SESSION['guest'] = $guests; }

    Read the article

  • jQuery getting these functions to work together

    - by brett
    I'm new to jQuery and have tried looking around for an answer on how to do this. I have 2 functions and I would like both to work together. The one function is submitHandler and its used to hide a form and at the same time add a class to a hidden element to unhide it - ie a thank you for submitting h1. The other function is to grab the input data and display it onsubmit in the form. So the problem is that I can get that one to work but then the other doesnt. Ie on form submit I can see the data input but not the h1 Thank you message. Here are the functions: SubmitHandler: submitHandler: function() { $("#content").empty(); $("#content").append( "<p>If you want to be kept in the loop...</p>" + "<p>Or you can contact...</p>" ); $('h1.success_').removeClass('success_').addClass('success_form'); $('#contactform').hide(); }, onsubmit="return inputdata()" function inputdata(){ var usr = document.getElementById('contactname').value; var eml = document.getElementById('email').value; var msg = document.getElementById('message').value; document.getElementById('out').innerHTML = usr + " " + eml + msg; document.getElementById('out').style.display = "block"; return true; }, The form uses PHP and jQuery - I dont know about AJAX but after some reading even less sure. Please help me out I dont know what I'm doing and at the moment I am learning but its a long road for me still. Thank you The form: <form method="post" action="<?php echo $_SERVER['PHP_SELF']; ?>" id="contactform" onsubmit="return inputdata()"> <div class="_required"><p class="label_left">Name*</p><input type="text" size="50" name="contactname" id="contactname" value="" class="required" /></div><br/><br/> <div class="_required"><p class="label_left">E-mail address*</p><input type="text" size="50" name="email" id="email" value="" class="required email" /></div><br/><br/> <p class="label_left">Message</p><textarea rows="5" cols="50" name="message" id="message" class="required"></textarea><br/> <input type="submit" value="submit" name="submit" id="submit" /> </form> The PHP bit: <?php $subject = "Website Contact Form Enquiry"; //If the form is submitted if(isset($_POST['submit'])) { //Check to make sure that the name field is not empty if(trim($_POST['contactname']) == '') { $hasError = true; } else { $name = trim($_POST['contactname']); } //Check to make sure sure that a valid email address is submitted if(trim($_POST['email']) == '') { $hasError = true; } else if (!eregi("^[A-Z0-9._%-]+@[A-Z0-9._%-]+\.[A-Z]{2,4}$", trim($_POST['email']))) { $hasError = true; } else { $email = trim($_POST['email']); } //Check to make sure comments were entered if(trim($_POST['message']) == '') { $hasError = true; } else { if(function_exists('stripslashes')) { $comments = stripslashes(trim($_POST['message'])); } else { $comments = trim($_POST['message']); } } //If there is no error, send the email if(!isset($hasError)) { $emailTo = '[email protected]'; //Put your own email address here $body = "Name: $name \n\nEmail: $email \n\nComments:\n $comments"; $headers = 'From: My Site <'.$emailTo.'>' . "\r\n" . 'Reply-To: ' . $email; mail($emailTo, $subject, $body, $headers); $emailSent = true; } } ? The Jquery Validate bit: $(document).ready(function(){ $('#contactform').validate({ showErrors: function(errorMap, errorList) { //restore the normal look $('#contactform div.xrequired').removeClass('xrequired').addClass('_required'); //stop if everything is ok if (errorList.length == 0) return; //Iterate over the errors for(var i = 0;i < errorList.length; i++) $(errorList[i].element).parent().removeClass('_required').addClass('xrequired'); }, Here is the full jQuery bit: $(document).ready(function(){ $('#contactform').validate({ showErrors: function(errorMap, errorList) { //restore the normal look $('#contactform div.xrequired').removeClass('xrequired').addClass('_required'); //stop if everything is ok if (errorList.length == 0) return; //Iterate over the errors for(var i = 0;i < errorList.length; i++) $(errorList[i].element).parent().removeClass('_required').addClass('xrequired'); }, submitHandler: function() { $('h1.success_').removeClass('success_').addClass('success_form'); $("#content").empty(); $("#content").append('#sadhu'); $('#contactform').hide(); }, }); }); Latest edit - Looks like this: $(document).ready(function(){ $('#contactform').validate({ showErrors: function(errorMap, errorList) { //restore the normal look $('#contactform div.xrequired').removeClass('xrequired').addClass('_required'); //stop if everything is ok if (errorList.length == 0) return; //Iterate over the errors for(var i = 0;i < errorList.length; i++) $(errorList[i].element).parent().removeClass('_required').addClass('xrequired'); }, function submitHandler() { $('h1.success_').removeClass('success_').addClass('success_form'); $("#content").empty(); $("#content").append('#sadhu'); $('#contactform').hide(); }, function inputdata() { var usr = document.getElementById('contactname').value; var eml = document.getElementById('email').value; var msg = document.getElementById('message').value; document.getElementById('out').innerHTML = usr + " " + eml + msg; document.getElementById('out').style.display = "block"; }, $(document).ready(function(){ $('#contactForm').submit(function() { inputdata(); submitHandler(); }); }); });

    Read the article

  • how to validate the form using jquery

    - by kumar
    I have this Fieldset values.. <fieldset class="clearfix" id="fieldset-exception"> <legend>Mass Edit Exception Information</legend> <div id="#error-msg-ID" class="ui-widget hide"> <div class="ui-state-highlight ui-corner-all"> <p><span style="float: left; margin-right: 0.3em;" class="ui-icon ui-icon-info"></span> <span></span></p> </div> </div> <div class="fiveper"> <label for="ExceptionStatus"> Status: <span> </span> </label> <label for="ResolutionCode"> Resolution: <span> <%=Html.DropDownListFor(model => model.Exception.ResolutionCode, new SelectList(Model.LookupCodes["C_EXCPT_RESL"], "Key", "Value"))%> </span> </label> <label for="ReasonCode"> Reason: <span><%=Html.DropDownListFor(model => model.Exception.ReasonCode, new SelectList(Model.LookupCodes["C_EXCPT_RSN"], "Key", "Value"))%></span> </label> <label for="ExceptionStatus"> Action Taken: <span><%=Html.DropDownListFor(model => model.Exception.ActionCode, new SelectList(Model.LookupCodes["C_EXCPT_ACT"], "Key", "Value"))%></span> </label> </div> <div class="fiveper"> <label for="FollowupDate"> Follow-up: <span><input type="text" id="exc-flwup" name="fdate" /></span> <%--<%=Html.EditorFor(model=>model.Exception.FollowupDate) %>--%> </label> <label for="IOL"> Inquiry #: <%=Html.TextBox("Inquiry", ViewData["inq"] ?? "")%> </label> <label>Comment</label> <span> <%=Html.TextArea("value", ViewData["Comnt"] ?? "")%> <%=Html.ValidationMessage("value")%> </span> </div> <br /> <br /> <div> <input type="submit" class="button" value="Save" /> </div> </fieldset> before submiting I need to do some time of validation..below validation not working for me is that right what I am doing here? These all fieds user is entering from UI.. thanks <script type="text/javascript"> $(document).ready(function() { $('#btnSelectAll').click(function() { $('#EditExceptions input[name=chk]').attr('checked', true); }); $('#btnCancel').click(function() { $('#EditExceptions input[name=chk]').attr('checked',false); }); function validate_excpt(formData, jqForm, options) { var form = jqForm[0]; **if (form.e_Exception_ResolutionCode.value && !form.e_Exception_ReasonCode.value) { alert('All Resolution Codes need a Reason Code.'); return false; }** } // post-submit callback function showResponse(responseText, statusText, xhr, $form) { if (responseText[0].substring(0, 16) != "System.Exception") { $('#error-msg-ID span:last').html('<strong>Update successful.</strong>'); $().ShowDialog('Success', 'Update successful'); } else { $('#error-msg-ID span:last').html('<strong>Update failed.</strong> ' + responseText[0].substring(0, 48)); $().ShowDialog('Failed', 'Update failed'); } $('#error-msg-ID').removeClass('hide'); $('#gui-stat-').html(responseText[1]); } $('#exc-').ajaxForm({ beforeSubmit: validate_excpt, success: showResponse, dataType: 'json' }); $('.button').button(); $("input[id^='exc-flwup']").datepicker({ duration: '', showTime: true, constrainInput: true, stepMinutes: 30, stepHours: 1, altTimeField: '', time24h: true, minDate: 0 }); $('#ui-timepicker-div').bgiframe(); }); </script>

    Read the article

  • Json / Jsonp not connecting to php (Phonegap + jquerymobile)

    - by Madhulika Mukherjee
    I am trying to make - an android WEB application with phonegap layout with JqueryMobile What Im doing - An html form that takes ID, name, and address as input 'Serialize's this data using ajax makes a json object out of it Should send it to a file called 'connection.php' Where, this data is put into a database (MySql) Other details - My server is localhost, Im using xampp I have already created a database and table using phpmyadmin The problem - My html file, where my json object is created, does not connect to the php file which is hosted by my localhost Here is my COMPLETE html file: <!DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.01//EN" "http://www.w3.org/TR/html4/strict.dtd"> <html> <head> <!-- Change this if you want to allow scaling --> <meta name="viewport" content="width=default-width; user-scalable=no" /> <meta http-equiv="Content-type" content="text/html;charset=utf-8"> <title>Trial app</title> <link rel="stylesheet" href="thestylesheet.css" type="text/css"> <script type="text/javascript" charset="utf-8" src="javascript1.js"></script> <script type="text/javascript" charset="utf-8" src="javascript2.js"></script> <script type="text/javascript" charset="utf-8" src="cordova-1.8.0.js"></script> <script> $(document).ready(function () { $("#btn").click( function() { alert('hello hello'); $.ajax({ url: "connection.php", type: "POST", data: { id: $('#id').val(), name: $('#name').val(), Address: $('#Address').val() }, datatype: "json", success: function (status) { if (status.success == false) { alert("Failure!"); } else { alert("Success!"); } } }); }); }); </script> </head> <body> <div data-role="header"> <h1>Heading of the app</h1> </div><!-- /header --> <div data-role="content"> <form id="target" method="post"> <label for="id"> <input type="text" id="id" placeholder="ID"> </label> <label for="name"> <input type="text" id="name" placeholder="Name"> </label> <label for="Address"> <input type="text" id="Address" placeholder="Address"> </label> <div id="btn" data-role="button" data-icon="star" data-theme="e">Add record</div> <!--<input type="submit" value="Add record" data-icon="star" data-theme="e"> --> </form> </div> </body> </html> And here is my 'connection.php' hosted by my localhost <?php header('Content-type: application/json'); $server = "localhost"; $username = "root"; $password = ""; $database = "jqueryex"; $con = mysql_connect($server, $username, $password); if($con) { echo "Connected to database!"; } else { echo "Could not connect!"; } //or die ("Could not connect: " . mysql_error()); mysql_select_db($database, $con); /* CREATE TABLE `sample` ( `id` int(11) unsigned NOT NULL AUTO_INCREMENT, `name` varchar(45) DEFAULT NULL, `Address` varchar(45) DEFAULT NULL, PRIMARY KEY (`id`) ) */ $id= json_decode($_POST['id']); $name = json_decode($_POST['name']); $Address = json_decode($_POST['Address']); $sql = "INSERT INTO sample (id, name, Address) "; $sql .= "VALUES ($id, '$name', '$Address')"; if (!mysql_query($sql, $con)) { die('Error: ' . mysql_error()); } else { echo "Comment added"; } mysql_close($con); ?> My doubts: No entry is made in my table 'sample' when i view it in phpmyadmin So obviously, i see no success messages either I dont get any errors, not from ajax and neither from the php file. Stuff Im suspecting: Should i be using jsonp instead of json? Im new to this. Is there a problem with my php file? Perhaps I need to include some more javascript files in my html file? I assume this is a very simple problem so please help me out! I think there is just some conceptual error, as i have only just started with jquery, ajax, and json. Thank you.

    Read the article

  • Jquery returns index -1 always

    - by jfreak53
    This is my index code that I use to return the buttons parent div's index: j('#optionform').index( j(this).parent() ) I'm trying to find out the DIV index of the button clicked, so I can remove the DIV. The HTML layout is like so: <form id="optionform" onsubmit="return false;"> <label><input type="checkbox" id="s_name" value="s_name"> Survey Name </label> <label><input type="checkbox" id="s_type" value="s_type"> Survey Type </label><br> Filter Results:<br> <div id="template" style="display: none;"> Column: <select id="fcolumn[]"> <option></option> <option value="s_name">Survey Name</option> <option value="s_type">Survey Type</option> </select><br> Filter Type: <select id="ftype[]"> <option></option> <option value="=">Equals</option> <option value="LIKE">Like</option> </select><br> Filter content: <input type="text" id="fcontent[]"><br> <img src="images/add.png" width="32px" onclick="addTemp(); return false;"> <img src="images/delete.png" width="32px" onclick="alert(j(this).attr('src')); remTemp(j('#optionform').index( j(this).parent() )); return false;"> </div> <div class="template" style="display: block;"> Column: <select id="fcolumn[]"> <option></option> <option value="s_name">Survey Name</option> <option value="s_type">Survey Type</option> </select><br> Filter Type: <select id="ftype[]"> <option></option> <option value="=">Equals</option> <option value="LIKE">Like</option> </select><br> Filter content: <input type="text" id="fcontent[]"><br> <img src="images/add.png" width="32px" onclick="addTemp(); return false;"> <img src="images/delete.png" width="32px" onclick="alert(j(this).attr('src')); remTemp(j('#optionform').index( j(this).parent() )); return false;"> </div> <div class="template" style="display: block;"> Column: <select id="fcolumn[]"> <option></option> <option value="s_name">Survey Name</option> <option value="s_type">Survey Type</option> </select><br> Filter Type: <select id="ftype[]"> <option></option> <option value="=">Equals</option> <option value="LIKE">Like</option> </select><br> Filter content: <input type="text" id="fcontent[]"><br> <img src="images/add.png" width="32px" onclick="addTemp(); return false;"> <img src="images/delete.png" width="32px" onclick="alert(j(this).attr('src')); remTemp(j('#optionform').index( j(this).parent() )); return false;"> </div> </form> But it always returns -1 in the index.

    Read the article

  • Mistake in display and insert methods (double-ended queue)

    - by MANAL
    1) My problem when i make remove from right or left program will be remove true but when i call diplay method the content wrong like this I insert 12 43 65 23 and when make remove from left program will remove 12 but when call display method show like this 12 43 65 and when make remove from right program will remove 23 but when call display method show like this 12 43 Why ?????? ); and when i try to make insert after remove write this Can not insert right because the queue is full . first remove right and then u can insert right where is the problem ?? Please Help me please 2) My code FIRST CLASS class dqueue { private int fullsize; //number of all cells private int item_num; // number of busy cells only private int front,rear; public int j; private double [] dqarr; //========================================== public dqueue(int s) //constructor { fullsize = s; front = 0; rear = -1; item_num = 0; dqarr = new double[fullsize]; } //========================================== public void insert(double data) { if (rear == fullsize-1) rear = -1; rear++; dqarr[rear] = data; item_num++; } public double removeLeft() // take item from front of queue { double temp = dqarr[front++]; // get value and incr front if(front == fullsize) front = 0; item_num --; // one less item return temp; } public double removeRight() // take item from rear of queue { double temp = dqarr[rear--]; // get value and decr rear if(rear == -1) // rear = item_num -1; item_num --; // one less item return temp; } //========================================= public void display () //display items { for (int j=0;j<item_num;j++) // for every element System.out.print(dqarr[j] +" " ); // display it System.out.println(""); } //========================================= public int size() //number of items in queue { return item_num; } //========================================== public boolean isEmpty() // true if queue is empty { return (item_num ==0); } } SECOND CLASS import java.util.Scanner; class dqueuetest { public static void main(String[] args) { Scanner input = new Scanner(System.in); System.out.println(" ***** Welcome here***** "); System.out.println(" ***** Mind Of Programming Group***** "); System.out.println(" _____________________________________________ "); System.out.println("enter size of your dqueue"); int size = input.nextInt(); dqueue mydq = new dqueue(size); System.out.println(""); System.out.println("enter your itemes"); //===================================== for(int i = 0;i<=size-1;i++) { System.out.printf("item %d:",i+1); double item = input.nextDouble(); mydq.insert(item); System.out.println(""); } //===================================== int queue =size ; int c = 0 ; while (c != 6) { System.out.println(""); System.out.println("************************************************"); System.out.println(" MAIN MENUE"); System.out.println("1- INSERT RIGHT "); System.out.println("2- REMOVE LEFT"); System.out.println("3- REMOVE RIGHT"); System.out.println("4- DISPLAY"); System.out.println("5- SIZE"); System.out.println("6- EXIT"); System.out.println("************************************************"); System.out.println("choose your operation by number(1-6)"); c = input.nextInt(); switch (c) { case 1: if (queue == size) System.out.print("Can not insert right because the queue is full . first remove right and then u can insert right "); else { System.out.print("enter your item: "); double item = input.nextDouble(); mydq.insert(item);} break; case 2: System.out.println("REMOVE FROM REAR :"); if( !mydq.isEmpty() ) { double item = mydq.removeLeft(); System.out.print(item + "\t"); } // end while System.out.println(""); mydq.display(); break; case 3: System.out.println("REMOVE FROM FRONT :"); if( !mydq.isEmpty() ) { double item = mydq.removeRight(); System.out.print(item + "\t"); } // end while System.out.println(""); mydq.display(); break; case 4: System.out.println("The items in Queue are :"); mydq.display(); break; case 5: System.out.println("The Size of the Queue is :"+mydq.size()); break; case 6: System.out.println("Good Bye"); break; default: System.out.println("wrong chiose enter again"); } //end switch } //end while } // end main }//end class

    Read the article

  • strange behavior while including a class in php

    - by user1864539
    I'm experiencing a strange behavior with PHP. Basically I want to require a class within a PHP script. I know it is straight forward and I did it before but when I do so, it change the behavior of my jquery (1.8.3) ajax response. I'm running a wamp setup and my PHP version is 5.4.6. Here is a sample as for my index.html head (omitting the jquery js include) <script> $(document).ready(function(){ $('#submit').click(function(){ var action = $('#form').attr('action'); var form_data = { fname: $('#fname').val(), lname: $('#lname').val(), phone: $('#phone').val(), email: $('#email').val(), is_ajax: 1 }; $.ajax({ type: $('#form').attr('method'), url: action, data: form_data, success: function(response){ switch(response){ case 'ok': var msg = 'data saved'; break; case 'ko': var msg = 'Oops something wrong happen'; break; default: var msg = 'misc:<br/>'+response; break; } $('#message').html(msg); } }); return false; }); }); </script> body <div id="message"></div> <form id="form" action="handler.php" method="post"> <p> <input type="text" name="fname" id="fname" placeholder="fname"> <input type="text" name="lname" id="lname" placeholder="lname"> </p> <p> <input type="text" name="phone" id="phone" placeholder="phone"> <input type="text" name="email" id="email" placeholder="email"> </p> <input type="submit" name="submit" value="submit" id="submit"> </form> And as for the handler.php file: <?php require('class/Container.php'); $filename = 'xml/memory.xml'; $is_ajax = $_REQUEST['is_ajax']; if(isset($is_ajax) && $is_ajax){ $fname = $_REQUEST['fname']; $lname = $_REQUEST['lname']; $phone = $_REQUEST['phone']; $email = $_REQUEST['email']; $obj = new Container; $obj->insertData('fname',$fname); $obj->insertData('lname',$lname); $obj->insertData('phone',$phone); $obj->insertData('email',$email); $tmp = $obj->give(); $result = $tmp['_obj']; /* Push data inside array */ $array = array(); foreach($result as $key => $value){ array_push($array,$key,$value); } $xml = simplexml_load_file($filename); // check if there is any data in if(count($xml->elements->data) == 0){ // if not, create the structure $xml->elements->addChild('data',''); } // proceed now that we do have the structure if(count($xml->elements->data) == 1){ foreach($result as $key => $value){ $xml->elements->data->addChild($key,$value); } $xml->saveXML($filename); echo 'ok'; }else{ echo 'ko'; } } ? The Container class: <?php class Container{ private $_obj; public function __construct(){ $this->_obj = array(); } public function addData($data = array()){ if(!empty($data)){ $oldData = $this->_obj; $data = array_merge($oldData,$data); $this->_obj = $data; } } public function removeData($key){ if(!empty($key)){ $oldData = $this->_obj; unset($oldData[$key]); $this->_obj = $oldData; } } public function outputData(){ return $this->_obj; } public function give(){ return get_object_vars($this); } public function insertData($key,$value){ $this->_obj[$key] = $value; } } ? The strange thing is that my result always fall under the default switch statement and the ajax response fit both present statement. I noticed then if I just paste the Container class on the top of the handler.php file, everything works properly but it kind of defeat what I try to achieve. I tried different way to include the Container class but it seem to be than the issue is specific to this current scenario. I'm still learning PHP and my guess is that I'm missing something really basic. I also search on stackoverflow regarding the issue I'm experiencing as well as PHP.net, without success. Regards,

    Read the article

< Previous Page | 224 225 226 227 228 229 230 231 232 233 234 235  | Next Page >