Search Results

Search found 2011 results on 81 pages for 'raw'.

Page 24/81 | < Previous Page | 20 21 22 23 24 25 26 27 28 29 30 31  | Next Page >

  • Amazon S3 tools for Debian?

    - by Jonik
    I need to (programmatically, in a shell script) upload an EAR file to an Amazon S3 bucket on Debian (5.0.4). What, if any, Debian package provides simple, scriptable tools for that? (I want raw S3 bucket access, so please don't suggest solutions like Jungle Disk.)

    Read the article

  • network endpoint accessible via hostname only, not address?

    - by Dustin Getz
    someone told me that this piece of network hardware (NAS) has a security setting such that it can only be accessed by hostname, not by IP address. I don't understand, as I thought DNS resolved the hostname to an address on the connecting client's side, then at protocol level always used the raw address, so how can this 'security' measure be possible?

    Read the article

  • ViewPager cycle between views?

    - by Erdem Azakli
    I want my ViewPager implementation to cycle between views instead of stopping at the last view. For example, if I have 3 views to display via a ViewPager, it should return back to the first View after the third View on fling instead of stopping at that third view. I want it to return to the first page/view when the user flings forward on the last page Thanks, Mypageradapter; package com.example.pictures; import android.content.Context; import android.media.AudioManager; import android.os.Parcelable; import android.support.v4.view.PagerAdapter; import android.support.v4.view.ViewPager; import android.view.LayoutInflater; import android.view.View; public class MyPagerAdapter extends PagerAdapter{ SoundManager snd; int sound1,sound2,sound3; boolean loaded = false; public int getCount() { return 6; } public Object instantiateItem(View collection, int position) { View view=null; LayoutInflater inflater = (LayoutInflater) collection.getContext() .getSystemService(Context.LAYOUT_INFLATER_SERVICE); this.setVolumeControlStream(AudioManager.STREAM_MUSIC); int resId = 0; switch (position) { case 0: resId = R.layout.picture1; view = inflater.inflate(resId, null); break; case 1: resId = R.layout.picture2; view = inflater.inflate(resId, null); break; case 2: resId = R.layout.picture3; view = inflater.inflate(resId, null); break; case 3: resId = R.layout.picture4; view = inflater.inflate(resId, null); break; case 4: resId = R.layout.picture5; view = inflater.inflate(resId, null); break; case 5: resId = R.layout.picture6; view = inflater.inflate(resId, null); break; } ((ViewPager) collection).addView(view, 0); return view; } @SuppressWarnings("unused") private Context getApplicationContext() { // TODO Auto-generated method stub return null; } private void setVolumeControlStream(int streamMusic) { // TODO Auto-generated method stub } @SuppressWarnings("unused") private Context getBaseContext() { // TODO Auto-generated method stub return null; } @SuppressWarnings("unused") private PagerAdapter findViewById(int myfivepanelpager) { // TODO Auto-generated method stub return null; } @Override public void destroyItem(View arg0, int arg1, Object arg2) { ((ViewPager) arg0).removeView((View) arg2); } @Override public boolean isViewFromObject(View arg0, Object arg1) { return arg0 == ((View) arg1); } @Override public Parcelable saveState() { return null; } public static Integer getItem(int position) { // TODO Auto-generated method stub return null; } } OnPageChangeListener; package com.example.pictures; import android.app.Activity; import android.content.Intent; import android.os.Bundle; import android.support.v4.view.ViewPager; import android.support.v4.view.ViewPager.OnPageChangeListener; import android.view.View; import android.widget.Button; import android.widget.Toast; public class Pictures extends Activity implements OnPageChangeListener{ SoundManager snd; int sound1,sound2,sound3; View view=null; @Override public void onCreate(Bundle savedInstanceState) { super.onCreate(savedInstanceState); setContentView(R.layout.picturespage); MyPagerAdapter adapter = new MyPagerAdapter(); ViewPager myPager = (ViewPager) findViewById(R.id.myfivepanelpager); myPager.setAdapter(adapter); myPager.setCurrentItem(0); myPager.setOnPageChangeListener(this); snd = new SoundManager(this); sound1 = snd.load(R.raw.sound1); sound2 = snd.load(R.raw.sound2); sound3 = snd.load(R.raw.sound3); } public void onPageScrollStateChanged(int arg0) { // TODO Auto-generated method stub } public void onPageScrolled(int arg0, float arg1, int arg2) { // TODO Auto-generated method stub } public void onPageSelected(int position) { // TODO Auto-generated method stub switch (position) { case 0: snd.play(sound1); break; case 1: snd.play(sound2); break; case 2: snd.play(sound3); break; case 3: Toast.makeText(this, "1", Toast.LENGTH_SHORT).show(); break; case 4: Toast.makeText(this, "2", Toast.LENGTH_SHORT).show(); break; case 5: Toast.makeText(this, "3", Toast.LENGTH_SHORT).show(); break; } } };

    Read the article

  • How to boot floppy image without floppy drive?

    - by Teddy
    Suppose I have a 1.44 MB floppy image with, say, a BIOS update, and a server with no floppy drive. How do I boot this image on the server? Without getting a USB floppy drive, that is. I tried copying the image to a USB drive (raw copy using dd), but it didn't boot, it just said "No kernel" and contiued booting on the HD.

    Read the article

  • Unable to start auditd

    - by George Reith
    I am on CentOS 5.8 final I recently installed auditd via yum install audit however I am unable to start it. I edited the configuration file to give a verbose output of the error it is recieving in starting up and this is the output: # service auditd start Starting auditd: Config file /etc/audit/auditd.conf opened for parsing log_file_parser called with: /var/log/audit/audit.log log_format_parser called with: RAW log_group_parser called with: root priority_boost_parser called with: 4 flush_parser called with: INCREMENTAL freq_parser called with: 20 num_logs_parser called with: 4 qos_parser called with: lossy dispatch_parser called with: /sbin/audispd name_format_parser called with: NONE max_log_size_parser called with: 5 max_log_size_action_parser called with: ROTATE space_left_parser called with: 75 space_action_parser called with: SYSLOG action_mail_acct_parser called with: root admin_space_left_parser called with: 50 admin_space_left_action_parser called with: SUSPEND disk_full_action_parser called with: SUSPEND disk_error_action_parser called with: SUSPEND tcp_listen_queue_parser called with: 5 tcp_max_per_addr_parser called with: 1 tcp_client_max_idle_parser called with: 0 enable_krb5_parser called with: no GSSAPI support is not enabled, ignoring value at line 30 krb5_principal_parser called with: auditd GSSAPI support is not enabled, ignoring value at line 31 Started dispatcher: /sbin/audispd pid: 3097 type=DAEMON_START msg=audit(1339336882.187:9205): auditd start, ver=1.8 format=raw kernel=2.6.32-042stab056.8 auid=4294967295 pid=3095 res=success config_manager init complete Error setting audit daemon pid (Connection refused) type=DAEMON_ABORT msg=audit(1339336882.189:9206): auditd error halt, auid=4294967295 pid=3095 res=failed Unable to set audit pid, exiting The audit daemon is exiting. Error setting audit daemon pid (Connection refused) [FAILED] The only information I can find online is that this may be due to SELinux, however SELinux is giving me problems of it's own. No matter what I do it appears to be disabled (I want to enable it). The configuration is set to enforced and the server has been rebooted many a time however sestatus still returns SELinux status: disabled. Can anyone shine some light on this problem? EDIT: I don't know if it is related but I noticed the following message appearing in my /var/log/messages Jun 10 16:25:22 s1 iscsid: iSCSI logger with pid=2056 started! Jun 10 16:25:22 s1 iscsid: Missing or Invalid version from /sys/module/scsi_transport_iscsi/version. Make sure a up to date scsi_transport_iscsi module is loaded and a up todate version of iscsid is running. Exiting... I try to start the iSCSI daemon myself (I have not a clue what it does; I am a linux newbie) and I get the following error: Starting iSCSI daemon: FATAL: Could not load /lib/modules/2.6.32-042stab056.8/modules.dep: No such file or directory FATAL: Could not load /lib/modules/2.6.32-042stab056.8/modules.dep: No such file or directory FATAL: Could not load /lib/modules/2.6.32-042stab056.8/modules.dep: No such file or directory FATAL: Could not load /lib/modules/2.6.32-042stab056.8/modules.dep: No such file or directory FATAL: Could not load /lib/modules/2.6.32-042stab056.8/modules.dep: No such file or directory [FAILED] If I go to /lib/modules/ I notice the directory exists but is completely empty.

    Read the article

  • Building NanoBSD inside a jail

    - by ptomli
    I'm trying to setup a jail to enable building a NanoBSD image. It's actually a jail on top of a NanoBSD install. The problem I have is that I'm unable to mount the md device in order to do the 'build image' part. Is it simply not possible to mount an md device inside a jail, or is there some other knob I need to twiddle? On the host /etc/rc.conf.local jail_enable="YES" jail_mount_enable="YES" jail_list="build" jail_set_hostname_allow="NO" jail_build_hostname="build.vm" jail_build_ip="192.168.0.100" jail_build_rootdir="/mnt/zpool0/jails/build/home" jail_build_devfs_enable="YES" jail_build_devfs_ruleset="devfsrules_jail_build" /etc/devfs.rules [devfsrules_jail_build=5] # nothing Inside the jail [root@build /usr/obj/nanobsd.PROLIANT_MICROSERVER]# sysctl security.jail security.jail.param.cpuset.id: 0 security.jail.param.host.hostid: 0 security.jail.param.host.hostuuid: 64 security.jail.param.host.domainname: 256 security.jail.param.host.hostname: 256 security.jail.param.children.max: 0 security.jail.param.children.cur: 0 security.jail.param.enforce_statfs: 0 security.jail.param.securelevel: 0 security.jail.param.path: 1024 security.jail.param.name: 256 security.jail.param.parent: 0 security.jail.param.jid: 0 security.jail.enforce_statfs: 1 security.jail.mount_allowed: 1 security.jail.chflags_allowed: 1 security.jail.allow_raw_sockets: 0 security.jail.sysvipc_allowed: 0 security.jail.socket_unixiproute_only: 1 security.jail.set_hostname_allowed: 0 security.jail.jail_max_af_ips: 255 security.jail.jailed: 1 [root@build /usr/obj/nanobsd.PROLIANT_MICROSERVER]# mdconfig -l md2 md0 md1 md0 and md1 are the ramdisks of the host. bsdlabel looks sensible [root@build /usr/obj/nanobsd.PROLIANT_MICROSERVER]# bsdlabel /dev/md2s1 # /dev/md2s1: 8 partitions: # size offset fstype [fsize bsize bps/cpg] a: 1012016 16 4.2BSD 0 0 0 c: 1012032 0 unused 0 0 # "raw" part, don't edit newfs runs ok [root@build /usr/obj/nanobsd.PROLIANT_MICROSERVER]# newfs -U /dev/md2s1a /dev/md2s1a: 494.1MB (1012016 sectors) block size 16384, fragment size 2048 using 4 cylinder groups of 123.55MB, 7907 blks, 15872 inodes. with soft updates super-block backups (for fsck -b #) at: 160, 253184, 506208, 759232 mount fails [root@build /usr/obj/nanobsd.PROLIANT_MICROSERVER]# mount /dev/md2s1a _.mnt/ mount: /dev/md2s1a : Operation not permitted UPDATE: One of my colleagues pointed out There are some file systems types that can't be securely mounted within a jail no matter what, like UFS, MSDOFS, EXTFS, XFS, REISERFS, NTFS, etc. because the user mounting it has access to raw storage and can corrupt it in a way that it will panic entire system. From http://www.mail-archive.com/[email protected]/msg160389.html So it seems that the standard nanobsd.sh won't run inside a jail while it uses the md device to build the image. One potential solution I'll try is to chroot from the host into the build jail, rather than jexec a shell.

    Read the article

  • Software to capture the packets in an MPEG Transport Stream

    - by Crippledsmurf
    I have a DVB-T capture card and would like to capture the packets from the MPEG stream it receives so i can analyse them just for a bit of fun and learning I've googled and found a lot of converters and software to capture the video from these streams but very little in the area of capturing raw data from a stream. What software exists that can capture and dump the MPEG stream from a tuner?

    Read the article

  • My pivot chart has the wrong Y axis values but correct data point values

    - by Mark Harnett
    I created a pivot chart based on some raw data for the x axis (dates) and 4 calculated fields for the Y values. The values on resulting lines are correct (see the data label at the end of the line) but the Y axis is off by about 100, but not off by any consistent amount. I have played with auto axis on and off, turn log scale on and off. All to no avail. Does anybody have any thoughts? Image link

    Read the article

  • Problems connecting Clariion LUNS to Solaris 10

    - by vialde
    I've got a Clariion San and a Solaris 10 server with an emulex HBA. The Thin LUNS are visible in Solaris and I can happily format the raw devices. Unfortunately that's all I can do. All other operations result in I/O errors. I'm running current versions of PowerPath and Solaris is patched as high as it'll go. Anyone have any similar experiences?

    Read the article

  • Ubuntu says FAT16, windows says NTF?

    - by myforwik
    I created a partition on USB harddisk in windows and it reports to be an NTFS partition. Yet in ubuntu 9.10 fdisk says it a FAT16 partition. If I mount with -t ntfs I see nothing, but if I mount without it I see all the files. Can anyone tell me whats going on here? Windows computer disk management definately says its NTFS, and a quick look at the raw data suggests it is NTFS, as I know the FAT16 very well.

    Read the article

  • Stop duplicate icmp echo replies when bridging to a dummy interface?

    - by mbrownnyc
    I recently configured a bridge br0 with members as eth0 (real if) and dummy0 (dummy.ko if). When I ping this machine, I receive duplicate replies as: # ping SERVERA PING SERVERA.domain.local (192.168.100.115) 56(84) bytes of data. 64 bytes from SERVERA.domain.local (192.168.100.115): icmp_seq=1 ttl=62 time=113 ms 64 bytes from SERVERA.domain.local (192.168.100.115): icmp_seq=1 ttl=62 time=114 ms (DUP!) 64 bytes from SERVERA.domain.local (192.168.100.115): icmp_seq=2 ttl=62 time=113 ms 64 bytes from SERVERA.domain.local (192.168.100.115): icmp_seq=2 ttl=62 time=113 ms (DUP!) Using tcpdump on SERVERA, I was able to see icmp echo replies being sent from eth0 and br0 itself as follows (oddly two echo request packets arrive "from" my Windows box myhost): 23:19:05.324192 IP myhost.domain.local > SERVERA.domain.local: ICMP echo request, id 512, seq 43781, length 40 23:19:05.324212 IP SERVERA.domain.local > myhost.domain.local: ICMP echo reply, id 512, seq 43781, length 40 23:19:05.324217 IP myhost.domain.local > SERVERA.domain.local: ICMP echo request, id 512, seq 43781, length 40 23:19:05.324221 IP SERVERA.domain.local > myhost.domain.local: ICMP echo reply, id 512, seq 43781, length 40 23:19:05.324264 IP SERVERA.domain.local > myhost.domain.local: ICMP echo reply, id 512, seq 43781, length 40 23:19:05.324272 IP SERVERA.domain.local > myhost.domain.local: ICMP echo reply, id 512, seq 43781, length 40 It's worth noting, testing reveals that hosts on the same physical switch do not see DUP icmp echo responses (a host on the same VLAN on another switch does see a dup icmp echo response). I've read that this could be due to the ARP table of a switch, but I can't find any info directly related to bridges, just bonds. I have a feeling my problem lay in the stack on linux, not the switch, but am opened to any suggestions. The system is running centos6/el6 kernel 2.6.32-71.29.1.el6.i686. How do I stop ICMP echo replies from being sent in duplicate when dealing with a bridge interface/bridged interfaces? Thanks, Matt [edit] Quick note: It was recommended in #linux to: [08:53] == mbrownnyc [gateway/web/freenode/] has joined ##linux [08:57] <lkeijser> mbrownnyc: what happens if you set arp_ignore to 1 for the dummy interface? [08:59] <lkeijser> also set arp_announce to 2 for that interface [09:24] <mbrownnyc> lkeijser: I set arp_annouce to 2, arp_ignore to 2 in /etc/sysctl.conf and rebooted the machine... verifying that the bits are set after boot... the problem is still present I did this and came up empty. Same dup problem. I will be moving away from including the dummy interface in the bridge as: [09:31] == mbrownnyc [gateway/web/freenode/] has joined #Netfilter [09:31] <mbrownnyc> Hello all... I'm wondering, is it correct that even with an interface in PROMISC that the kernel will drop /some/ packets before they reach applications? [09:31] <whaffle> What would you make think so? [09:32] <mbrownnyc> I ask because I am receiving ICMP echo replies after configuring a bridge with a dummy interface in order for ipt_netflow to see all packets, only as reported in it's documentation: http://ipt-netflow.git.sourceforge.net/git/gitweb.cgi?p=ipt-netflow/ipt-netflow;a=blob;f=README.promisc [09:32] <mbrownnyc> but I do not know if PROMISC will do the same job [09:33] <mbrownnyc> I was referred here from #linux. any assistance is appreciated [09:33] <whaffle> The following conditions need to be met: PROMISC is enabled (bridges and applications like tcpdump will do this automatically, otherwise they won't function). [09:34] <whaffle> If an interface is part of a bridge, then all packets that enter the bridge should already be visible in the raw table. [09:35] <mbrownnyc> thanks whaffle PROMISC must be set manually for ipt_netflow to function, but [09:36] <whaffle> promisc does not need to be set manually, because the bridge will do it for you. [09:36] <whaffle> When you do not have a bridge, you can easily create one, thereby rendering any kernel patches moot. [09:36] <mbrownnyc> whaffle: I speak without the bridge [09:36] <whaffle> It is perfectly valid to have a "half-bridge" with only a single interface in it. [09:36] <mbrownnyc> whaffle: I am unfamiliar with the raw table, does this mean that PROMISC allows the raw table to be populated with packets the same as if the interface was part of a bridge? [09:37] <whaffle> Promisc mode will cause packets with {a dst MAC address that does not equal the interface's MAC address} to be delivered from the NIC into the kernel nevertheless. [09:37] <mbrownnyc> whaffle: I suppose I mean to clearly ask: what benefit would creating a bridge have over setting an interface PROMISC? [09:38] <mbrownnyc> whaffle: from your last answer I feel that the answer to my question is "none," is this correct? [09:39] <whaffle> Furthermore, the linux kernel itself has a check for {packets with a non-local MAC address}, so that packets that will not enter a bridge will be discarded as well, even in the face of PROMISC. [09:46] <mbrownnyc> whaffle: so, this last bit of information is quite clearly why I would need and want a bridge in my situation [09:46] <mbrownnyc> okay, the ICMP echo reply duplicate issue is likely out of the realm of this channel, but I sincerely appreciate the info on the kernels inner-workings [09:52] <whaffle> mbrownnyc: either the kernel patch, or a bridge with an interface. Since the latter is quicker, yes [09:54] <mbrownnyc> thanks whaffle [edit2] After removing the bridge, and removing the dummy kernel module, I only had a single interface chilling out, lonely. I still received duplicate icmp echo replies... in fact I received a random amount: http://pastebin.com/2LNs0GM8 The same thing doesn't happen on a few other hosts on the same switch, so it has to do with the linux box itself. I'll likely end up rebuilding it next week. Then... you know... this same thing will occur again. [edit3] Guess what? I rebuilt the box, and I'm still receiving duplicate ICMP echo replies. Must be the network infrastructure, although the ARP tables do not contain multiple entries. [edit4] How ridiculous. The machine was a network probe, so I was (ingress and egress) mirroring an uplink port to a node that was the NIC. So, the flow (must have) gone like this: ICMP echo request comes in through the mirrored uplink port. (the real) ICMP echo request is received by the NIC (the mirrored) ICMP echo request is received by the NIC ICMP echo reply is sent for both. I'm ashamed of myself, but now I know. It was suggested on #networking to either isolate the mirrored traffic to an interface that does not have IP enabled, or tag the mirrored packets with dot1q.

    Read the article

  • exim4, avoid emails end up in spam folder

    - by MultiformeIngegno
    I have a VPS: I set up exim, problem is emails always go in the spam folder.. this is a sample header: http://pastebin.com/raw.php?i=4NJ2ZaUs As you can see it PASSes SPF test but still emails don't pass spam filters (I tried with Gmail).. Here's my exim config: dc_eximconfig_configtype='internet' dc_other_hostnames='MY_DOMAIN' dc_local_interfaces='' dc_readhost='MY_DOMAIN' dc_relay_domains='MY_DOMAIN' dc_minimaldns='false' dc_relay_nets='' dc_smarthost='MY_DOMAIN' CFILEMODE='644' dc_use_split_config='false' dc_hide_mailname='' dc_mailname_in_oh='true' dc_localdelivery='mail_spool' Why does this happen?

    Read the article

  • Recover harddrive data

    - by gameshints
    I have a dell laptop that recently "died" (It would get the blue screen of death upon starting) and the hard drive would make a weird cyclic clicking noises. I wanted to see if I could use some tools on my linux machine to recover the data, so I plugged it into there. If I run "fdisk" I get: Disk /dev/sdb: 20.0 GB, 20003880960 bytes 64 heads, 32 sectors/track, 19077 cylinders Units = cylinders of 2048 * 512 = 1048576 bytes Disk identifier: 0x64651a0a Disk /dev/sdb doesn't contain a valid partition table Fine, the partition table is messed up. However if I run "testdisk" in attempt to fix the table, it freezes at this point, making the same cyclical clicking noises: Disk /dev/sdb - 20 GB / 18 GiB - CHS 19078 64 32 Analyse cylinder 158/19077: 00% I don't really care about the hard drive working again, and just the data, so I ran "gpart" to figure out where the partitions used to be. I got this: dev(/dev/sdb) mss(512) chs(19077/64/32)(LBA) #s(39069696) size(19077mb) * Warning: strange partition table magic 0x2A55. Primary partition(1) type: 222(0xDE)(UNKNOWN) size: 15mb #s(31429) s(63-31491) chs: (0/1/1)-(3/126/63)d (0/1/32)-(15/24/4)r hex: 00 01 01 00 DE 7E 3F 03 3F 00 00 00 C5 7A 00 00 Primary partition(2) type: 007(0x07)(OS/2 HPFS, NTFS, QNX or Advanced UNIX) (BOOT) size: 19021mb #s(38956987) s(31492-38988478) chs: (4/0/1)-(895/126/63)d (15/24/5)-(19037/21/31)r hex: 80 00 01 04 07 7E FF 7F 04 7B 00 00 BB 6F 52 02 So I tried to mount just to the old NTFS partition, but got an error: sudo mount -o loop,ro,offset=16123904 -t ntfs /dev/sdb /mnt/usb NTFS signature is missing. Ugh. Okay. But then I tried to get a raw data dump by running dd if=/dev/sdb of=/home/erik/brokenhd skip=31492 count=38956987 But the file got up to 59885568 bytes, and made the same cyclical clicking noises. Obviously there is a bad sector, but I don't know what to do about it! The data is still there... if I view that 57MB file in textpad... I can see raw data from files. How can I get my data back? Thanks for any suggestions, Solution: I was able to recover about 90% of my data: Froze harddrive in freezer Used Ddrescue to make a copy of the drive Since Ddrescue wasn't able to get enough of my drive to use testdisk to recover my partitions/file system, I ended up using photorec to recover most of my files

    Read the article

  • how to disable these logs on the screen?

    - by user62367
    using Fedora 14: http://pastebin.com/raw.php?i=jUvcfugw i mount an anonym Samba share [checks it in every 5 sec] it's working, ok, great! But: when i shut down my Fedora box, i can see the lines containing this scripts lines! Many times, about ~50x on the screen. How could i disable these lines when shutting down? I [and other people] don't want to see those lines for about ~ 5 sec Thank you!

    Read the article

  • Grub Error 18 - Solid State Drive

    - by clint
    I recently used Raw Copy to make an image of my 300gb Raptor Hd to a OCZ Vertex SSD 60GB. And When I pluged in the SSD to boot I get a Grub Error 18. I have tried to changed in the BIOS setting to LBA, Large, Auto, trying different combination's. Any advice. thanks, Clint

    Read the article

  • How to Import flip video to Final Cut Pro and edit flip video in Final Cut Pro?

    - by Yinahd
    Final Cut Pro is a professional video editing application for Mac users and it is widely used even by many Hollywood people on professional movie post-production. If you are a flip video fan and you want to give professional editing to your flip videos, Final Cut Pro is a great choice. However, Final Cut Pro does not allow raw flip videos to be imported to Final Cut Pro and you will need to convert flip video to Final Cut Pro supported formats.

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • How to keep group-writeable shares on Samba with OSX clients?

    - by Oliver Salzburg
    I have a FreeNAS server on a network with OSX and Windows clients. When the OSX clients interact with SMB/CIFS shares on the server, they are causing permission problems for all other clients. Update: I can no longer verify any answers because we abandoned the project, but feel free to post any help for future visitors. The details of this behavior seem to also be dependent on the version of OSX the client is running. For this question, let's assume a client running 10.8.2. When I mount the CIFS share on an OSX client and create a new directory on it, the directory will be created with drwxr-x-rx permissions. This is undesirable because it will not allow anyone but me to write to the directory. There are other users in my group which should have write permissions as well. This behavior happens even though the following settings are present in smb.conf on the server: [global] create mask= 0666 directory mask= 0777 [share] force directory mode= 0775 force create mode= 0660 I was under the impression that these settings should make sure that directories are at least created with rwxrwxr-x permissions. But, I guess, that doesn't stop the client from changing the permissions after creating the directory. When I create a folder on the same share from a Windows client, the new folder will have the desired access permissions (rwxrwxrwx), so I'm currently assuming that the problem lies with the OSX client. I guess this wouldn't be such an issue if you could easily change the permissions of the directories you've created, but you can't. When opening the directory info in Finder, I get the old "You have custom access" notice with no ability to make any changes. I'm assuming that this is caused because we're using Windows ACLs on the share, but that's just a wild guess. Changing the write permissions for the group through the terminal works fine, but this is unpractical for the deployment and unreasonable to expect from anyone to do. This is the complete smb.conf: [global] encrypt passwords = yes dns proxy = no strict locking = no read raw = yes write raw = yes oplocks = yes max xmit = 65535 deadtime = 15 display charset = LOCALE max log size = 10 syslog only = yes syslog = 1 load printers = no printing = bsd printcap name = /dev/null disable spoolss = yes smb passwd file = /var/etc/private/smbpasswd private dir = /var/etc/private getwd cache = yes guest account = nobody map to guest = Bad Password obey pam restrictions = Yes # NOTE: read smb.conf. directory name cache size = 0 max protocol = SMB2 netbios name = freenas workgroup = COMPANY server string = FreeNAS Server store dos attributes = yes hostname lookups = yes security = user passdb backend = ldapsam:ldap://ldap.company.local ldap admin dn = cn=admin,dc=company,dc=local ldap suffix = dc=company,dc=local ldap user suffix = ou=Users ldap group suffix = ou=Groups ldap machine suffix = ou=Computers ldap ssl = off ldap replication sleep = 1000 ldap passwd sync = yes #ldap debug level = 1 #ldap debug threshold = 1 ldapsam:trusted = yes idmap uid = 10000-39999 idmap gid = 10000-39999 create mask = 0666 directory mask = 0777 client ntlmv2 auth = yes dos charset = CP437 unix charset = UTF-8 log level = 1 [share] path = /mnt/zfs0 printable = no veto files = /.snap/.windows/.zfs/ writeable = yes browseable = yes inherit owner = no inherit permissions = no vfs objects = zfsacl guest ok = no inherit acls = Yes map archive = No map readonly = no nfs4:mode = special nfs4:acedup = merge nfs4:chown = yes hide dot files force directory mode = 0775 force create mode = 0660

    Read the article

  • I need to monitor a physical RS232 port on an appliance?

    - by Kendor
    I need to verify what's being output on an RS232 port of an appliance that's running proprietary software (e.g. NOT Windows or Linux). The port is sending data to a target app on another appliance, but I need to verify/log the actual data raw outside of the appliances. Would appreciate a recommendation on process/software to attach to the physical sending port (I have a straight through RS232 cable) and grab sample output of that port.

    Read the article

  • Descending list ordered by file modification time

    - by user62367
    How can i generate a list of files in a directory [e.g.: "/mnt/hdd/PUB/"] ordered by the files modification time? [in descending order, the oldest modified file is at the lists end] ls -A -lRt would be great: https://pastebin.com/raw.php?i=AzuSVmrJ but if a file is changed in a directory it lists the full directory...so the pastebined link isn't good [i don't want a list ordered by "directories", i need a "per file" ordered list] os: openwrt..[no perl - not enough space for it :( + no "stat", or "file" command] Thank you!

    Read the article

  • How can I compress a movie to a specific file size in Windows 7's Live Movie Maker?

    - by Nathan Fellman
    In previous versions of Windows Movie Maker I could take a raw video file and specify the file size to compress it to, and Movie Maker would compress it accordingly (with the appropriate loss in quality). Live Movie Maker, which comes with Windows 7, doesn't seem to have this option. I can only set specify the requested quality. Is there any way to specify the size of the target file for Windows Live Movie Maker?

    Read the article

  • Descending list ordered by file modification time

    - by LanceBaynes
    How can I generate a list of files in a directory [for example, "/mnt/hdd/PUB/"] ordered by the files modification time? [in descending order, the oldest modified file is at the lists end] ls -A -lRt would be great: https://pastebin.com/raw.php?i=AzuSVmrJ But if a file is changed in a directory, it lists the full directory, so the pastebined link isn't good [I don't want a list ordered by "directories", I need a "per file" ordered list] OS: OpenWrt [no Perl - not enough space for it :( + no "stat", or "file" command].

    Read the article

  • DVD ripper for Windows

    - by Shawn Miller
    I am looking for a good DVD ripper software for Windows. Looking for something that will easily rip the raw bits DVD to hard drive without any loss of quality. Looking for something that will easily copy the VOB files to a server location for use with the Window Media Center DVD Library feature.

    Read the article

  • How do I import an AVI into iMovie '09?

    - by sludge
    I have a raw (no codec used for compression) AVI file that I am trying to import into iMovie '09. When I did this with the old iMovie '06, I was able to import it. Now it is just grayed out. Is there a lossless step I can use to import this video into iMovie? If the answer is a straight NO, what software alternative should I investigate for my movie editing needs?

    Read the article

< Previous Page | 20 21 22 23 24 25 26 27 28 29 30 31  | Next Page >