Search Results

Search found 48592 results on 1944 pages for 'cannot start'.

Page 241/1944 | < Previous Page | 237 238 239 240 241 242 243 244 245 246 247 248  | Next Page >

  • pdating modules on VPS [closed]

    - by tertle
    Been trying to install openVPN on a VPS but come into a few problems when trying to start the openvpn server. Service deferred error: IPTablesServiceBase: failed to run iptables-restore [status=1]: ['FATAL: Could not load /lib/modules/2.6.18-028stab070.14/modules.dep: No such file or directory', 'FATAL: Could not load /lib/modules/2.6.18-028stab070.14/modules.dep: No such file or directory', 'iptables-restore: line 46 failed']: internet/base:1175,internet/base:752,internet/process:45,internet/process:306,internet/_baseprocess:48,internet/process:775,internet/_baseprocess:60,svc/pp:116,svc/svcnotify:26,internet/defer:238,internet/defer:307,internet/defer:323,sagent/ipts:105,sagent/ipts:39,util/error:52,util/error:32 service failed to start due to unresolved dependencies: set(['user', 'iptables_openvpn']) service failed to start due to unresolved dependencies: set(['user', 'iptables_openvpn']) service failed to start due to unresolved dependencies: set(['iptables_openvpn']) Anyway so after a bit of playing around and some advice, I found that the linux kernal and modules don't match on my server. uname -r returns: 2.6.18-028stab070.14 and ls /lib/modules returns: 2.6.18-028stab070.7 The server is running OpenVZ and my container uses ubuntu 9.10. So my question is, is it possible for me to update my modules on a VPS and if so how would I do this, or is this something I'll need to try get my host to do? Thanks in advance.

    Read the article

  • New Book - Oracle ADF Enterprise Application Development Made Simple

    - by Shay Shmeltzer
    It's nice to see another ADF book out there, this one from Sten Vesteli titled "Oracle ADF Enterprise Application Development Made Simple" comes from Packet Publishing Unlike other ADF books out there, this one doesn't aim to teach you Oracle ADF, but rather focuses on the right way to structure and manage a project that leverages ADF. This is a welcomed addition to the bookshelf for people who are looking into ADF based development. One thing I find is that some organization just start developing an ADF application without first doing much planning, something that is understandable given that it is very easy to start building a prototype with ADF and then just grow it into a full blown application. However, as the book points out, doing a bit of planning before you delve into the actual project development can save you a lot of time in the future. For example it is much better to have the right breakdown and structure of your project to allow you to do efficient team development right out of the gate, then to find out 1 year down the road that you are dealing with one monolithic size project which is hard to manage. The book touches on such topics as project organization (workspaces, projects, packages), planning your infrastructure (templates, framework classes), coding standards, team structure, etc. It also covers various aspects of application lifecycle management such as versioning, build, testing, deployment and managing requirements and tasks and how all of those are done when using JDeveloper and Oracle ADF. It's nice to see that the book covers working with Oracle Team Productivity Center - a solution that might not be getting the exposure it deserves. The book also has some chapters about security, internalization and customization of applications both with MDS and with ADF Faces skins (and it even covers the brand new skin editor). Overall I think this is definitely a book you should read if you are about to start your way on a new enterprise scale ADF application. Taking into account the topics that the book discusses before you start your work will save you time and effort down the road. By the way, don't forget that as an OTN member you can get discount on this and other books.

    Read the article

  • How to restore Windows7 after restore ubuntu bootloader?

    - by Mateusz Rogulski
    At first I will describe my situation in a few points: I have installed Windows7, and then Ubuntu 11.04 on my machine. Then everything works fine and at start of system I have screen from linux where I can choose the system. Then I reinstall Windows7 and install Windows 8 on other partition. Then I can choose between Win7 and win8 when I start system. Then I need my Ubuntu back so I want restore my bootloader from Ubuntu. I boot Ubuntu from USB and in terminal write this commands: sudo fdisk -l Then I get: /dev/sda1 1 13 104391 de Dell Utility /dev/sda2 14 2805 22425601 5 Rozszerzona /dev/sda3 * 2805 41968 314572800 7 HPFS/NTFS /dev/sda4 41968 60802 151282688 7 HPFS/NTFS /dev/sda5 14 2445 19530752 83 Linux /dev/sda6 2445 2805 2893824 82 Linux swap / Solaris Next commands: sudo mount /dev/sda5 /mnt sudo mount --bind /dev /mnt/dev sudo mount --bind /proc /mnt/proc sudo chroot /mnt grub-install /dev/sda I get Installation finished. No error reported.. And when I start my machine I have old Ubuntu start screen to choose system. Ubuntu works well. But There are no Windows 8 option. But my primary problem is when I choose Windows 7 I have: error: no such device ... error: no such disk so I have no idea what can I do. I really need both systems to work. Any help would be appreciated.

    Read the article

  • Xmonad Xsession

    - by AntLord
    My user level: noob-ish, so please bear with me I'm running 12.04 LTS. I have installed and, to some extent, configured xmonad 0.10 The "automagically" created xsession for it works fine as it is, but when I login it won't run a startup script I've created and "call from" /usr/share/xsessions/xmonad.desktop, if that's right. I've read pretty much all I could find about .xinitrc and .xsession, I tried that and it somehow messed up the other "sessions", if I'm explaining myself correctly. Had to $unity --reset to have the "main session" working again. Anyway, my question is, how do I autostart xmobar and set a desktop background after login into xmonad's default Xsession? I tried this script, start-xmonad: #!/bin/bash # #I only used one of the following each time I tried, none worked #Also, do I really need the '&'? I know what they're for, but... nitrogen --restore & feh --bg-scale ~/Pictures/picture.png & #Then I want xmobar to start, again do I need the '&'? I know it's for it to run #in the background, but I tried removing the '&' and xmonad still launched xmobar & #Finally, the only thing that seems to work in this script exec xmonad Yes, I made sure I did chomd +x ~/start-xmonad The xmonad.desktop is [Desktop Entry] Name=XMonad Encoding=UTF-8 Comment=Lightweight tiling window manager Exec=/home/myusername/start-xmonad Icon=custom_xmonad_badge.png Type=XSession So, this didn't work, now I'm here. Please help :s thanks

    Read the article

  • why the difference in google search result using script for search and using a browser for search

    - by Jayapal Chandran
    I wrote a code to find the position in google search result for a search keyword. I also did the same with the browser. Both the results are different. Let me explain in detail here. I have a website and i wanted to know on which page number my domain appears for a search string. Like when i search for 'code snippets' i wanted to find in google search on which page number a certain domain appears. I wrote a php code to search page by page starting from page 1 to page n. I did the same task using a browser. The script returned page 4 and when browsed i can see the domain appearing in second page. here is the search string i use in my code. /search?hl=en&output=search&sclient=psy-ab&q=code+snippets&start=0&btnG= and for each request i change the start=0 to start=1, start=2, etc... and in the response i will check whether my domain appears in it. any idea for this different in search results?

    Read the article

  • Ideal data structure/techniques for storing generic scheduler data in C#

    - by GraemeMiller
    I am trying to implement a generic scheduler object in C# 4 which will output a table in HTML. Basic aim is to show some object along with various attributes, and whether it was doing something in a given time period. The scheduler will output a table displaying the headers: Detail Field 1 ....N| Date1.........N I want to initialise the table with a start date and an end date to create the date range (ideally could also do other time periods e.g. hours but that isn't vital). I then want to provide a generic object which will have associated events. Where an object has events within the period I want a table cell to be marked E.g. Name Height Weight 1/1/2011 2/1/2011 3/1/20011...... 31/1/2011 Ben 5.11 75 X X X Bill 5.7 83 X X So I created scheduler with Start Date=1/1/2011 and end date 31/1/2011 I'd like to give it my person object (already sorted) and tell it which fields I want displayed (Name, Height, Weight) Each person has events which have a start date and end date. Some events will start and end outwith but they should still be shown on the relevant date etc. Ideally I'd like to have been able to provide it with say a class booking object as well. So I'm trying to keep it generic. I have seen Javasript implementations etc of similar. What would a good data structure be for this? Any thoughts on techniques I could use to make it generic. I am not great with generics so any tips appreciated.

    Read the article

  • TDD: Write a separate test for object initialization or relying on other tests exercising it

    - by DXM
    This seems to be the common pattern that's emerging in some of the tests I've worked on lately. We have a class, and quite often this is legacy code whose design can't be easily altered, which has a bunch of member variables. There's some kind of "Initialize" or "Load" function which would put an object into a valid state. Only after it is initialized/loaded, are the members in the proper state so that other methods can be exercised. So when we start writing tests, first test is "TestLoad" and all we put in there is exercising initialization logic. Then we might add one (or few) TestLoadFailureXXX tests and those are definitely valuable. Then we start writing tests to verify other behaviors but all of them require the object to be loaded. So they all start by running exactly the same code as "TestLoad". So my question: Is TestLoad even necessary? Do you take it and let other tests simply exercise the loading? Or leave it so things are more explicit? I know that each unit test function should have no (or as little as possible) overlap with other test functions, but it seems like in cases of loading, this is unavoidable. And whether we like it or not, if something in the loading code breaks, we will end up with a whole test suite of failures. Is there another approach that I might be missing here? Thank you for the responses. It definitely makes sense that you want to see "InitializationTest" and if that fails you know where to start looking. In case it matters, this question is mostly about C++ and we use CppUnit framework. And now, thanks to sleske, I'll be constantly wishing that CppUnit supported test dependencies. Might have to hack something in one of these days :)

    Read the article

  • Dual Boot menu with Ubuntu and Windows 8 not showing up

    - by user180630
    I know a lot of posts have been written, and I had read most of them when I encountered the problem. None of them solved the problem. I have successfully installed Ubuntu 12.04 on top of Windows 8. Now my PC simply boots into Windows 8. If I press 'Esc' at start of BIOS, and then F9,the GRUB shows up and Ubuntu is listed at the top of the several options to boot from. I did run Boot-Repair once I logged into Ubuntu explicitly from GRUB as mentioned above. I did all said by Stormvirux in this link but was still unsuccessful. The debug info is listed here. Something which confuses me is the message which Boot-Repair stated after it did its job. You can now reboot your computer. Please do not forget to make your BIOS boot on sda (8004MB) disk! The boot files of [The OS now in use - Ubuntu 12.04.2 LTS] are far from the start of the disk. Your BIOS may not detect them. You may want to retry after creating a /boot partition (EXT4, 200MB, start of the disk). This can be performed via tools such as gParted. Then select this partition via the [Separate /boot partition:] option of [Boot Repair]. (https://help.ubuntu.com/community/BootPartition) I don't know why it says it is far from the start of the disk as I see it first in the GRUB menu which comes up at startup. One more input, when I try to place the GRUB in sda, Boot-Repair does not progress giving me the following error: GPT detected. Please create a BIOS-Boot partition (>1MB, unformatted filesystem, bios_grub flag). This can be performed via tools such as Gparted. Then try again. Alternatively, you can retry after activating the [Separate /boot/efi partition:] option. I had to select Separate /boot/efi partition: sdb2

    Read the article

  • How do I fix broken installation?

    - by Daniel
    Let me start off by saying I'm dual booting 11.04 and Windows 7 on a Thinkpad T61p. The problem may have arisen when I hit the power button during normal startup. I'm fully aware how stupid this is. I don't know why I did it. I did it. Now, I can't get in to Ubuntu. Windows works fine. But when I try to start Ubuntu normally, it seems to run some checks, and does not start up. Sometimes, I see a black screen, and it tells me that it's running certain checks, and then, [ok]. Like... Battery Check Somethingorother [ok] It'll give me 1-5 of these. And then it just does nothing, and I have to turn it off. When I try to start in safe mode... I tried low graphics mode, and after going through a couple of dialogue boxes, I'm brought right back to the safe mode dialogue box. And if I hit 'resume,' a shell pushes up (still that grey on black "your computer is broken" type shell) and asks me to log in. I do, and try to run unity. It tells me something along the lines of: WARNING no DISPLAY variable set and then sets it to " :0" , which doesn't work. And then I can't do anything, really, and I have to restart. (I don't know how to do this from the command line, so I just hard reset. That command would be helpful). Does anybody have any idea how I can get Ubuntu working right again? FTP is less pleasant in Explorer than it is in Nautilus or w/e it is now.

    Read the article

  • Help me with this logic (newbie) [migrated]

    - by Surendra
    I need to generate a half pyramid number series with the entered starting number and the number of lines in a html page using Javascript and show the result in html page . I have done the Java scripting and stuff . What I don't get is the logic to it. Take a look at this you may get an idea what I'm talking about: Here is my function in Javascript that will be triggered on a button click function doFunction(){ var enteredNumber=document.getElementById("start"); var lines=document.getElementById("lines"); var result; for(i=0;i<=lines.value;i++) { for(j=enteredNumber.value;j<=i;j++) { document.write(j + "&nbsp;" + "&nbsp;"); } document.write("<br />"); } } Help me with the logic to print following order: 1 1 2 1 2 3 1 2 3 4 1 2 3 4 5 There is a condition. I will specify $start and $lines. If $start = 5 and $lines = 3 then output should be like: 5 5 6 5 6 7 I have had used the for loop , but that doesn't work if I give my own start number that is higher than the number of lines. I actually need it done with Javascript, I have had done the necessary but I'm confused with the logic to generate such series (with the user given values) I had actually used two for loops to generate the regular number series like below 1 1 2 1 2 3 and so on.

    Read the article

  • Can not execute Sonar

    - by senzacionale
    my pom.xml <project xmlns="http://maven.apache.org/POM/4.0.0" xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xsi:schemaLocation="http://maven.apache.org/POM/4.0.0 http://maven.apache.org/xsd/maven-4.0.0.xsd"> <modelVersion>4.0.0</modelVersion> <groupId>RCC</groupId> <artifactId>tmp</artifactId> <name>tmp</name> <version>1.0</version> <build> <sourceDirectory>C:\Projekti\KIS\Model\src </sourceDirectory> <outputDirectory>C:\Projekti\KIS\Model\classes</outputDirectory> <plugins> <plugin> <groupId>org.apache.maven.plugins</groupId> <artifactId>maven-compiler-plugin</artifactId> <configuration> <source>1.5</source> <target>1.5</target> <excludes> <exclude>**/*.*</exclude> </excludes> </configuration> </plugin> </plugins> </build> <properties> <sonar.dynamicAnalysis>false</sonar.dynamicAnalysis> </properties> </project> running sonnar C:\Projekti\Metrics>mvn sonar:sonar -e + Error stacktraces are turned on. [INFO] Scanning for projects... [INFO] Searching repository for plugin with prefix: 'sonar'. [INFO] ------------------------------------------------------------------------ [INFO] Building tmp [INFO] task-segment: [sonar:sonar] (aggregator-style) [INFO] ------------------------------------------------------------------------ [INFO] [sonar:sonar {execution: default-cli}] [INFO] Sonar host: http://localhost:9000 [INFO] Sonar version: 2.1.2 [INFO] [sonar-core:internal {execution: default-internal}] [INFO] ------------------------------------------------------------------------ [ERROR] BUILD ERROR [INFO] ------------------------------------------------------------------------ [INFO] Can not execute Sonar Embedded error: Can not analyze the project org.apache.derby.jdbc.ClientDriver [INFO] ------------------------------------------------------------------------ [INFO] Trace org.apache.maven.lifecycle.LifecycleExecutionException: Can not execute Sonar at org.apache.maven.lifecycle.DefaultLifecycleExecutor.executeGoals(DefaultLifecycleExecutor.java:719) at org.apache.maven.lifecycle.DefaultLifecycleExecutor.executeStandaloneGoal(DefaultLifecycleExecutor.java:569) at org.apache.maven.lifecycle.DefaultLifecycleExecutor.executeGoal(DefaultLifecycleExecutor.java:539) at org.apache.maven.lifecycle.DefaultLifecycleExecutor.executeGoalAndHandleFailures(DefaultLifecycleExecutor.java:387) at org.apache.maven.lifecycle.DefaultLifecycleExecutor.executeTaskSegments(DefaultLifecycleExecutor.java:284) at org.apache.maven.lifecycle.DefaultLifecycleExecutor.execute(DefaultLifecycleExecutor.java:180) at org.apache.maven.DefaultMaven.doExecute(DefaultMaven.java:328) at org.apache.maven.DefaultMaven.execute(DefaultMaven.java:138) at org.apache.maven.cli.MavenCli.main(MavenCli.java:362) at org.apache.maven.cli.compat.CompatibleMain.main(CompatibleMain.java:60) at sun.reflect.NativeMethodAccessorImpl.invoke0(Native Method) at sun.reflect.NativeMethodAccessorImpl.invoke(NativeMethodAccessorImpl.java:39) at sun.reflect.DelegatingMethodAccessorImpl.invoke(DelegatingMethodAccessorImpl.java:25) at java.lang.reflect.Method.invoke(Method.java:585) at org.codehaus.classworlds.Launcher.launchEnhanced(Launcher.java:315) at org.codehaus.classworlds.Launcher.launch(Launcher.java:255) at org.codehaus.classworlds.Launcher.mainWithExitCode(Launcher.java:430) at org.codehaus.classworlds.Launcher.main(Launcher.java:375) Caused by: org.apache.maven.plugin.MojoExecutionException: Can not execute Sonar at org.codehaus.mojo.sonar.Bootstraper.executeMojo(Bootstraper.java:87) at org.codehaus.mojo.sonar.Bootstraper.start(Bootstraper.java:65) at org.codehaus.mojo.sonar.SonarMojo.execute(SonarMojo.java:117) at org.apache.maven.plugin.DefaultPluginManager.executeMojo(DefaultPluginManager.java:490) at org.apache.maven.lifecycle.DefaultLifecycleExecutor.executeGoals(DefaultLifecycleExecutor.java:694) ... 17 more Caused by: org.apache.maven.plugin.MojoExecutionException: Can not analyze the project at org.sonar.maven2.BatchMojo.executeBatch(BatchMojo.java:152) at org.sonar.maven2.BatchMojo.execute(BatchMojo.java:131) at org.apache.maven.plugin.DefaultPluginManager.executeMojo(DefaultPluginManager.java:490) at org.codehaus.mojo.sonar.Bootstraper.executeMojo(Bootstraper.java:82) ... 21 more Caused by: org.picocontainer.PicoLifecycleException: PicoLifecycleException: method 'public void org.sonar.api.database.AbstractDatabaseConnector.start()', instance 'org.sonar.api.database.DriverDatabaseConnector@c87621, java.lang.RuntimeException: wrapper at org.picocontainer.monitors.NullComponentMonitor.lifecycleInvocationFailed(NullComponentMonitor.java:77) at org.picocontainer.lifecycle.ReflectionLifecycleStrategy.monitorAndThrowReflectionLifecycleException(ReflectionLifecycleStrategy.java:132) at org.picocontainer.lifecycle.ReflectionLifecycleStrategy.invokeMethod(ReflectionLifecycleStrategy.java:115) at org.picocontainer.lifecycle.ReflectionLifecycleStrategy.start(ReflectionLifecycleStrategy.java:89) at org.picocontainer.injectors.AbstractInjectionFactory$LifecycleAdapter.start(AbstractInjectionFactory.java:84) at org.picocontainer.behaviors.AbstractBehavior.start(AbstractBehavior.java:169) at org.picocontainer.behaviors.Stored$RealComponentLifecycle.start(Stored.java:132) at org.picocontainer.behaviors.Stored.start(Stored.java:110) at org.picocontainer.DefaultPicoContainer.potentiallyStartAdapter(DefaultPicoContainer.java:996) at org.picocontainer.DefaultPicoContainer.startAdapters(DefaultPicoContainer.java:989) at org.picocontainer.DefaultPicoContainer.start(DefaultPicoContainer.java:746) at org.sonar.batch.AggregatorBatch.execute(AggregatorBatch.java:84) at org.sonar.maven2.BatchMojo.executeBatch(BatchMojo.java:149) ... 24 more Caused by: java.lang.RuntimeException: wrapper at org.picocontainer.lifecycle.ReflectionLifecycleStrategy.monitorAndThrowReflectionLifecycleException(ReflectionLifecycleStrategy.java:130) ... 35 more Caused by: org.sonar.api.database.DatabaseException: Cannot open connection to database: SQL driver not found org.apache.derby.jdbc.ClientDriver at org.sonar.api.database.AbstractDatabaseConnector.testConnection(AbstractDatabaseConnector.java:182) at org.sonar.api.database.AbstractDatabaseConnector.start(AbstractDatabaseConnector.java:94) at sun.reflect.NativeMethodAccessorImpl.invoke0(Native Method) at sun.reflect.NativeMethodAccessorImpl.invoke(NativeMethodAccessorImpl.java:39) at sun.reflect.DelegatingMethodAccessorImpl.invoke(DelegatingMethodAccessorImpl.java:25) at java.lang.reflect.Method.invoke(Method.java:585) at org.picocontainer.lifecycle.ReflectionLifecycleStrategy.invokeMethod(ReflectionLifecycleStrategy.java:110) ... 34 more Caused by: java.sql.SQLException: SQL driver not found org.apache.derby.jdbc.ClientDriver at org.sonar.api.database.DriverDatabaseConnector.getConnection(DriverDatabaseConnector.java:70) at org.sonar.api.database.AbstractDatabaseConnector.testConnection(AbstractDatabaseConnector.java:178) ... 40 more Caused by: java.lang.ClassNotFoundException: org.apache.derby.jdbc.ClientDriver at java.net.URLClassLoader$1.run(URLClassLoader.java:200) at java.security.AccessController.doPrivileged(Native Method) at java.net.URLClassLoader.findClass(URLClassLoader.java:188) at java.lang.ClassLoader.loadClass(ClassLoader.java:306) at org.codehaus.classworlds.RealmClassLoader.loadClassDirect(RealmClassLoader.java:195) at org.codehaus.classworlds.DefaultClassRealm.loadClass(DefaultClassRealm.java:255) at org.codehaus.classworlds.DefaultClassRealm.loadClass(DefaultClassRealm.java:274) at org.codehaus.classworlds.RealmClassLoader.loadClass(RealmClassLoader.java:214) at java.lang.ClassLoader.loadClass(ClassLoader.java:251) at java.lang.ClassLoader.loadClassInternal(ClassLoader.java:319) at java.lang.Class.forName0(Native Method) at java.lang.Class.forName(Class.java:164) at org.sonar.api.database.DriverDatabaseConnector.getConnection(DriverDatabaseConnector.java:68) ... 41 more [INFO] ------------------------------------------------------------------------ [INFO] Total time: 3 seconds [INFO] Finished at: Wed Jun 09 12:12:55 CEST 2010 [INFO] Final Memory: 12M/23M [INFO] ------------------------------------------------------------------------ any idea why not working Sonar with maven?

    Read the article

  • JPA/Hibernate Embedded id

    - by RoD
    I would like to do something like that: An object ReportingFile that can be a LogRequest or a LogReport file. ( both got the same structure) An object Reporting containing for one logRequest, a list of logReport with a date. I tryed to set an EmbededId, that would be an attribute of the logRequest. And that's the problem i got. I don't arrive to mannage embedded id. ( http://docs.jboss.org/hibernate/stable/annotations/reference/en/html_single/#entity-mapping-identifier ) If you have a clue on how i should do it :) An example (not working) would be: @Entity @AssociationOverride( name="logRequest.fileName", joinColumns = { @JoinColumn(name="log_request_file_name") } ) public class Reporting { @EmbeddedId private ReportingFile logRequest; @CollectionOfElements(fetch = FetchType.EAGER) @JoinTable(name = "t_reports", schema="", joinColumns = {@JoinColumn(name = "log_report")}) @Fetch(FetchMode.SELECT) private List<ReportingFile> reports; @Column(name="generated_date",nullable=true) private Date generatedDate; [...] } @Embeddable public class ReportingFile { @Column(name="file_name",length=255) private String fileName; @Column(name="xml_content") private Clob xmlContent; [...] } In this sample, i have a the following error: 15.03.2010 16:37:59 [ERROR] org.springframework.web.context.ContextLoader Context initialization failed org.springframework.beans.factory.BeanCreationException: Error creating bean with name 'org.springframework.dao.annotation.PersistenceExceptionTranslationPostProcessor#0' defined in class path resource [config/persistenceContext.xml]: Initialization of bean failed; nested exception is org.springframework.beans.factory.BeanCreationException: Error creating bean with name 'entityManagerFactory' defined in class path resource [config/persistenceContext.xml]: Invocation of init method failed; nested exception is javax.persistence.PersistenceException: [PersistenceUnit: test] Unable to configure EntityManagerFactory at org.springframework.beans.factory.support.AbstractAutowireCapableBeanFactory.doCreateBean(AbstractAutowireCapableBeanFactory.java:480) at org.springframework.beans.factory.support.AbstractAutowireCapableBeanFactory$1.run(AbstractAutowireCapableBeanFactory.java:409) at java.security.AccessController.doPrivileged(Native Method) at org.springframework.beans.factory.support.AbstractAutowireCapableBeanFactory.createBean(AbstractAutowireCapableBeanFactory.java:380) at org.springframework.beans.factory.support.AbstractBeanFactory$1.getObject(AbstractBeanFactory.java:264) at org.springframework.beans.factory.support.DefaultSingletonBeanRegistry.getSingleton(DefaultSingletonBeanRegistry.java:221) at org.springframework.beans.factory.support.AbstractBeanFactory.doGetBean(AbstractBeanFactory.java:261) at org.springframework.beans.factory.support.AbstractBeanFactory.getBean(AbstractBeanFactory.java:185) at org.springframework.beans.factory.support.AbstractBeanFactory.getBean(AbstractBeanFactory.java:164) at org.springframework.context.support.AbstractApplicationContext.getBean(AbstractApplicationContext.java:881) at org.springframework.context.support.AbstractApplicationContext.registerBeanPostProcessors(AbstractApplicationContext.java:597) at org.springframework.context.support.AbstractApplicationContext.refresh(AbstractApplicationContext.java:366) at org.springframework.web.context.ContextLoader.createWebApplicationContext(ContextLoader.java:255) at org.springframework.web.context.ContextLoader.initWebApplicationContext(ContextLoader.java:199) at org.springframework.web.context.ContextLoaderListener.contextInitialized(ContextLoaderListener.java:45) at org.apache.catalina.core.StandardContext.listenerStart(StandardContext.java:3843) at org.apache.catalina.core.StandardContext.start(StandardContext.java:4350) at org.apache.catalina.core.ContainerBase.start(ContainerBase.java:1045) at org.apache.catalina.core.StandardHost.start(StandardHost.java:719) at org.apache.catalina.core.ContainerBase.start(ContainerBase.java:1045) at org.apache.catalina.core.StandardEngine.start(StandardEngine.java:443) at org.apache.catalina.core.StandardService.start(StandardService.java:516) at org.apache.catalina.core.StandardServer.start(StandardServer.java:710) at org.apache.catalina.startup.Catalina.start(Catalina.java:578) at sun.reflect.NativeMethodAccessorImpl.invoke0(Native Method) at sun.reflect.NativeMethodAccessorImpl.invoke(NativeMethodAccessorImpl.java:39) at sun.reflect.DelegatingMethodAccessorImpl.invoke(DelegatingMethodAccessorImpl.java:25) at java.lang.reflect.Method.invoke(Method.java:597) at org.apache.catalina.startup.Bootstrap.start(Bootstrap.java:288) at org.apache.catalina.startup.Bootstrap.main(Bootstrap.java:413) Caused by: org.springframework.beans.factory.BeanCreationException: Error creating bean with name 'entityManagerFactory' defined in class path resource [config/persistenceContext.xml]: Invocation of init method failed; nested exception is javax.persistence.PersistenceException: [PersistenceUnit: test] Unable to configure EntityManagerFactory at org.springframework.beans.factory.support.AbstractAutowireCapableBeanFactory.initializeBean(AbstractAutowireCapableBeanFactory.java:1337) at org.springframework.beans.factory.support.AbstractAutowireCapableBeanFactory.doCreateBean(AbstractAutowireCapableBeanFactory.java:473) at org.springframework.beans.factory.support.AbstractAutowireCapableBeanFactory$1.run(AbstractAutowireCapableBeanFactory.java:409) at java.security.AccessController.doPrivileged(Native Method) at org.springframework.beans.factory.support.AbstractAutowireCapableBeanFactory.createBean(AbstractAutowireCapableBeanFactory.java:380) at org.springframework.beans.factory.support.AbstractBeanFactory$1.getObject(AbstractBeanFactory.java:264) at org.springframework.beans.factory.support.DefaultSingletonBeanRegistry.getSingleton(DefaultSingletonBeanRegistry.java:221) at org.springframework.beans.factory.support.AbstractBeanFactory.doGetBean(AbstractBeanFactory.java:261) at org.springframework.beans.factory.support.AbstractBeanFactory.getBean(AbstractBeanFactory.java:185) at org.springframework.beans.factory.support.AbstractBeanFactory.getBean(AbstractBeanFactory.java:164) at org.springframework.beans.factory.support.DefaultListableBeanFactory.getBeansOfType(DefaultListableBeanFactory.java:308) at org.springframework.beans.factory.BeanFactoryUtils.beansOfTypeIncludingAncestors(BeanFactoryUtils.java:270) at org.springframework.dao.support.PersistenceExceptionTranslationInterceptor.detectPersistenceExceptionTranslators(PersistenceExceptionTranslationInterceptor.java:122) at org.springframework.dao.support.PersistenceExceptionTranslationInterceptor.<init>(PersistenceExceptionTranslationInterceptor.java:78) at org.springframework.dao.annotation.PersistenceExceptionTranslationAdvisor.<init>(PersistenceExceptionTranslationAdvisor.java:70) at org.springframework.dao.annotation.PersistenceExceptionTranslationPostProcessor.setBeanFactory(PersistenceExceptionTranslationPostProcessor.java:97) at org.springframework.beans.factory.support.AbstractAutowireCapableBeanFactory.initializeBean(AbstractAutowireCapableBeanFactory.java:1325) at org.springframework.beans.factory.support.AbstractAutowireCapableBeanFactory.doCreateBean(AbstractAutowireCapableBeanFactory.java:473) ... 29 more Caused by: javax.persistence.PersistenceException: [PersistenceUnit: test] Unable to configure EntityManagerFactory at org.hibernate.ejb.Ejb3Configuration.configure(Ejb3Configuration.java:265) at org.hibernate.ejb.HibernatePersistence.createEntityManagerFactory(HibernatePersistence.java:125) at javax.persistence.Persistence.createEntityManagerFactory(Persistence.java:83) at org.springframework.orm.jpa.LocalEntityManagerFactoryBean.createNativeEntityManagerFactory(LocalEntityManagerFactoryBean.java:91) at org.springframework.orm.jpa.AbstractEntityManagerFactoryBean.afterPropertiesSet(AbstractEntityManagerFactoryBean.java:291) at org.springframework.beans.factory.support.AbstractAutowireCapableBeanFactory.invokeInitMethods(AbstractAutowireCapableBeanFactory.java:1368) at org.springframework.beans.factory.support.AbstractAutowireCapableBeanFactory.initializeBean(AbstractAutowireCapableBeanFactory.java:1334) ... 46 more Caused by: org.hibernate.AnnotationException: A Foreign key refering Reporting from Reporting has the wrong number of column. should be 2 at org.hibernate.cfg.annotations.TableBinder.bindFk(TableBinder.java:272) at org.hibernate.cfg.annotations.CollectionBinder.bindCollectionSecondPass(CollectionBinder.java:1319) at org.hibernate.cfg.annotations.CollectionBinder.bindManyToManySecondPass(CollectionBinder.java:1158) at org.hibernate.cfg.annotations.CollectionBinder.bindStarToManySecondPass(CollectionBinder.java:600) at org.hibernate.cfg.annotations.CollectionBinder$1.secondPass(CollectionBinder.java:541) at org.hibernate.cfg.CollectionSecondPass.doSecondPass(CollectionSecondPass.java:43) at org.hibernate.cfg.Configuration.secondPassCompile(Configuration.java:1140) at org.hibernate.cfg.AnnotationConfiguration.secondPassCompile(AnnotationConfiguration.java:319) at org.hibernate.cfg.Configuration.buildMappings(Configuration.java:1125) at org.hibernate.ejb.Ejb3Configuration.buildMappings(Ejb3Configuration.java:1226) at org.hibernate.ejb.EventListenerConfigurator.configure(EventListenerConfigurator.java:159) at org.hibernate.ejb.Ejb3Configuration.configure(Ejb3Configuration.java:854) at org.hibernate.ejb.Ejb3Configuration.configure(Ejb3Configuration.java:191) at org.hibernate.ejb.Ejb3Configuration.configure(Ejb3Configuration.java:253) ... 52 more

    Read the article

  • Jetty 7 + MySQL Config [java.lang.ClassNotFoundException: org.mortbay.jetty.webapp.WebAppContext]

    - by Scott Chang
    I've been trying to get a c3p0 db connection pool configured for Jetty, but I keep getting a ClassNotFoundException: 2010-03-14 19:32:12.028:WARN::Failed startup of context WebAppContext@fccada@fccada/phpMyAdmin,file:/usr/local/jetty/webapps/phpMyAdmin/,file:/usr/local/jetty/webapps/phpMyAdmin/ java.lang.ClassNotFoundException: org.mortbay.jetty.webapp.WebAppContext at java.net.URLClassLoader$1.run(URLClassLoader.java:200) at java.security.AccessController.doPrivileged(Native Method) at java.net.URLClassLoader.findClass(URLClassLoader.java:188) at java.lang.ClassLoader.loadClass(ClassLoader.java:307) at java.lang.ClassLoader.loadClass(ClassLoader.java:252) at org.eclipse.jetty.webapp.WebAppClassLoader.loadClass(WebAppClassLoader.java:313) at org.eclipse.jetty.webapp.WebAppClassLoader.loadClass(WebAppClassLoader.java:266) at org.eclipse.jetty.util.Loader.loadClass(Loader.java:90) at org.eclipse.jetty.xml.XmlConfiguration.nodeClass(XmlConfiguration.java:224) at org.eclipse.jetty.xml.XmlConfiguration.configure(XmlConfiguration.java:187) at org.eclipse.jetty.webapp.JettyWebXmlConfiguration.configure(JettyWebXmlConfiguration.java:77) at org.eclipse.jetty.webapp.WebAppContext.startContext(WebAppContext.java:975) at org.eclipse.jetty.server.handler.ContextHandler.doStart(ContextHandler.java:586) at org.eclipse.jetty.webapp.WebAppContext.doStart(WebAppContext.java:349) at org.eclipse.jetty.util.component.AbstractLifeCycle.start(AbstractLifeCycle.java:55) at org.eclipse.jetty.server.handler.HandlerCollection.doStart(HandlerCollection.java:165) at org.eclipse.jetty.server.handler.ContextHandlerCollection.doStart(ContextHandlerCollection.java:162) at org.eclipse.jetty.util.component.AbstractLifeCycle.start(AbstractLifeCycle.java:55) at org.eclipse.jetty.server.handler.HandlerCollection.doStart(HandlerCollection.java:165) at org.eclipse.jetty.util.component.AbstractLifeCycle.start(AbstractLifeCycle.java:55) at org.eclipse.jetty.server.handler.HandlerWrapper.doStart(HandlerWrapper.java:92) at org.eclipse.jetty.server.Server.doStart(Server.java:228) at org.eclipse.jetty.util.component.AbstractLifeCycle.start(AbstractLifeCycle.java:55) at org.eclipse.jetty.xml.XmlConfiguration$1.run(XmlConfiguration.java:990) at java.security.AccessController.doPrivileged(Native Method) at org.eclipse.jetty.xml.XmlConfiguration.main(XmlConfiguration.java:955) at sun.reflect.NativeMethodAccessorImpl.invoke0(Native Method) at sun.reflect.NativeMethodAccessorImpl.invoke(NativeMethodAccessorImpl.java:39) at sun.reflect.DelegatingMethodAccessorImpl.invoke(DelegatingMethodAccessorImpl.java:25) at java.lang.reflect.Method.invoke(Method.java:597) at org.eclipse.jetty.start.Main.invokeMain(Main.java:394) at org.eclipse.jetty.start.Main.start(Main.java:546) at org.eclipse.jetty.start.Main.parseCommandLine(Main.java:208) at org.eclipse.jetty.start.Main.main(Main.java:75) I'm new to Jetty and I want to ultimately get phpMyAdmin and WordPress to run on it through Quercus and a JDBC connection. Here are my web.xml and jetty-web.xml files in my WEB-INF directory. jetty-web.xml: <?xml version="1.0"?> <!DOCTYPE Configure PUBLIC "-//Mort Bay Consulting//DTD Configure//EN" "http://jetty.mortbay.org/configure.dtd"> <Configure class="org.mortbay.jetty.webapp.WebAppContext"> <New id="mysql" class="org.mortbay.jetty.plus.naming.Resource"> <Arg>jdbc/mysql</Arg> <Arg> <New class="com.mchange.v2.c3p0.ComboPooledDataSource"> <Set name="Url">jdbc:mysql://localhost:3306/mysql</Set> <Set name="User">user</Set> <Set name="Password">pw</Set> </New> </Arg> </New> </Configure> web.xml: <?xml version="1.0"?> <!DOCTYPE web-app PUBLIC "-//Sun Microsystems, Inc.//DTD Web Application 2.2//EN" "http://java.sun.com/j2ee/dtds/web-app_2_2.dtd"> <web-app> <description>Caucho Technology's PHP Implementation</description> <resource-ref> <description>My DataSource Reference</description> <res-ref-name>jdbc/mysql</res-ref-name> <res-type>javax.sql.DataSource</res-type> <res-auth>Container</res-auth> </resource-ref> <servlet> <servlet-name>Quercus Servlet</servlet-name> <servlet-class>com.caucho.quercus.servlet.QuercusServlet</servlet-class> <!-- Specifies the encoding Quercus should use to read in PHP scripts. --> <init-param> <param-name>script-encoding</param-name> <param-value>UTF-8</param-value> </init-param> <!-- Tells Quercus to use the following JDBC database and to ignore the arguments of mysql_connect(). --> <init-param> <param-name>database</param-name> <param-value>jdbc/mysql</param-value> </init-param> <init-param> <param-name>ini-file</param-name> <param-value>WEB-INF/php.ini</param-value> </init-param> </servlet> <servlet-mapping> <servlet-name>Quercus Servlet</servlet-name> <url-pattern>*.php</url-pattern> </servlet-mapping> <welcome-file-list> <welcome-file>index.php</welcome-file> </welcome-file-list> </web-app> I'm guessing that I'm missing a few jars or something. Currently I have placed the following jars in my WEB-INF/lib directory: c3p0-0.9.1.2.jar commons-dbcp-1.4.jar commons-pool-1.5.4.jar mysql-connector-java-5.1.12-bin.jar I have also tried to put these jars in JETTY-HOME/lib/ext, but to no avail... Someone please tell me what is wrong with my configuration. I'm sick of digging through Jetty's crappy documentation.

    Read the article

  • Circular reference with entity manager factory

    - by CodesLikeA_Mokey
    Every time I try and start my app, I get this error on startup: SEVERE: Exception sending context initialized event to listener instance of class org.springframework.web.context.ContextLoaderListener org.springframework.beans.factory.BeanCreationException: Error creating bean with name 'org.springframework.dao.annotation.PersistenceExceptionTranslationPostProcessor#0': Initialization of bean failed; nested exception is org.springframework.beans.factory.BeanCreationException: Error creating bean with name 'identityAccessAppConfig': Injection of autowired dependencies failed; nested exception is org.springframework.beans.factory.BeanCreationException: Could not autowire field: com.package.identityaccess.identity.UserRepository com.package.identityaccess.IdentityAccessAppConfig.userRepository; nested exception is org.springframework.beans.factory.BeanCreationException: Error creating bean with name 'userRepository': Cannot create inner bean '(inner bean)' of type [org.springframework.orm.jpa.SharedEntityManagerCreator] while setting bean property 'entityManager'; nested exception is org.springframework.beans.factory.BeanCreationException: Error creating bean with name '(inner bean)#1': Cannot resolve reference to bean 'identityAccessEntityManagerFactory' while setting constructor argument; nested exception is org.springframework.beans.factory.BeanCurrentlyInCreationException: Error creating bean with name 'identityAccessEntityManagerFactory': Requested bean is currently in creation: Is there an unresolvable circular reference? at org.springframework.beans.factory.support.AbstractAutowireCapableBeanFactory.doCreateBean(AbstractAutowireCapableBeanFactory.java:529) at org.springframework.beans.factory.support.AbstractAutowireCapableBeanFactory.createBean(AbstractAutowireCapableBeanFactory.java:458) at org.springframework.beans.factory.support.AbstractBeanFactory$1.getObject(AbstractBeanFactory.java:295) at org.springframework.beans.factory.support.DefaultSingletonBeanRegistry.getSingleton(DefaultSingletonBeanRegistry.java:223) at org.springframework.beans.factory.support.AbstractBeanFactory.doGetBean(AbstractBeanFactory.java:292) at org.springframework.beans.factory.support.AbstractBeanFactory.getBean(AbstractBeanFactory.java:198) at org.springframework.context.support.AbstractApplicationContext.registerBeanPostProcessors(AbstractApplicationContext.java:741) at org.springframework.context.support.AbstractApplicationContext.refresh(AbstractApplicationContext.java:464) at org.springframework.web.context.ContextLoader.configureAndRefreshWebApplicationContext(ContextLoader.java:389) at org.springframework.web.context.ContextLoader.initWebApplicationContext(ContextLoader.java:294) at org.springframework.web.context.ContextLoaderListener.contextInitialized(ContextLoaderListener.java:112) at org.apache.catalina.core.StandardContext.listenerStart(StandardContext.java:4797) at org.apache.catalina.core.StandardContext.startInternal(StandardContext.java:5291) at org.apache.catalina.util.LifecycleBase.start(LifecycleBase.java:150) at org.apache.catalina.core.ContainerBase$StartChild.call(ContainerBase.java:1559) at org.apache.catalina.core.ContainerBase$StartChild.call(ContainerBase.java:1549) at java.util.concurrent.FutureTask$Sync.innerRun(FutureTask.java:334) at java.util.concurrent.FutureTask.run(FutureTask.java:166) at java.util.concurrent.ThreadPoolExecutor.runWorker(ThreadPoolExecutor.java:1145) at java.util.concurrent.ThreadPoolExecutor$Worker.run(ThreadPoolExecutor.java:615) at java.lang.Thread.run(Thread.java:722) Caused by: org.springframework.beans.factory.BeanCreationException: Error creating bean with name 'identityAccessAppConfig': Injection of autowired dependencies failed; nested exception is org.springframework.beans.factory.BeanCreationException: Could not autowire field: com.package.identityaccess.identity.UserRepository com.package.identityaccess.IdentityAccessAppConfig.userRepository; nested exception is org.springframework.beans.factory.BeanCreationException: Error creating bean with name 'userRepository': Cannot create inner bean '(inner bean)' of type [org.springframework.orm.jpa.SharedEntityManagerCreator] while setting bean property 'entityManager'; nested exception is org.springframework.beans.factory.BeanCreationException: Error creating bean with name '(inner bean)#1': Cannot resolve reference to bean 'identityAccessEntityManagerFactory' while setting constructor argument; nested exception is org.springframework.beans.factory.BeanCurrentlyInCreationException: Error creating bean with name 'identityAccessEntityManagerFactory': Requested bean is currently in creation: Is there an unresolvable circular reference? at org.springframework.beans.factory.annotation.AutowiredAnnotationBeanPostProcessor.postProcessPropertyValues(AutowiredAnnotationBeanPostProcessor.java:288) at org.springframework.beans.factory.support.AbstractAutowireCapableBeanFactory.populateBean(AbstractAutowireCapableBeanFactory.java:1116) at org.springframework.beans.factory.support.AbstractAutowireCapableBeanFactory.doCreateBean(AbstractAutowireCapableBeanFactory.java:519) at org.springframework.beans.factory.support.AbstractAutowireCapableBeanFactory.createBean(AbstractAutowireCapableBeanFactory.java:458) at org.springframework.beans.factory.support.AbstractBeanFactory$1.getObject(AbstractBeanFactory.java:295) at org.springframework.beans.factory.support.DefaultSingletonBeanRegistry.getSingleton(DefaultSingletonBeanRegistry.java:223) at org.springframework.beans.factory.support.AbstractBeanFactory.doGetBean(AbstractBeanFactory.java:292) at org.springframework.beans.factory.support.AbstractBeanFactory.getBean(AbstractBeanFactory.java:194) at org.springframework.beans.factory.support.ConstructorResolver.instantiateUsingFactoryMethod(ConstructorResolver.java:353) at org.springframework.beans.factory.support.AbstractAutowireCapableBeanFactory.instantiateUsingFactoryMethod(AbstractAutowireCapableBeanFactory.java:1025) at org.springframework.beans.factory.support.AbstractAutowireCapableBeanFactory.createBeanInstance(AbstractAutowireCapableBeanFactory.java:921) at org.springframework.beans.factory.support.AbstractAutowireCapableBeanFactory.doCreateBean(AbstractAutowireCapableBeanFactory.java:487) at org.springframework.beans.factory.support.AbstractAutowireCapableBeanFactory.createBean(AbstractAutowireCapableBeanFactory.java:458) at org.springframework.beans.factory.support.AbstractBeanFactory$1.getObject(AbstractBeanFactory.java:295) at org.springframework.beans.factory.support.DefaultSingletonBeanRegistry.getSingleton(DefaultSingletonBeanRegistry.java:223) at org.springframework.beans.factory.support.AbstractBeanFactory.doGetBean(AbstractBeanFactory.java:292) at org.springframework.beans.factory.support.AbstractBeanFactory.getBean(AbstractBeanFactory.java:198) at org.springframework.beans.factory.support.DefaultListableBeanFactory.getBeansOfType(DefaultListableBeanFactory.java:438) at org.springframework.beans.factory.BeanFactoryUtils.beansOfTypeIncludingAncestors(BeanFactoryUtils.java:277) at org.springframework.dao.support.PersistenceExceptionTranslationInterceptor.detectPersistenceExceptionTranslators(PersistenceExceptionTranslationInterceptor.java:139) at org.springframework.dao.support.PersistenceExceptionTranslationInterceptor.<init>(PersistenceExceptionTranslationInterceptor.java:79) at org.springframework.dao.annotation.PersistenceExceptionTranslationAdvisor.<init>(PersistenceExceptionTranslationAdvisor.java:71) at org.springframework.dao.annotation.PersistenceExceptionTranslationPostProcessor.setBeanFactory(PersistenceExceptionTranslationPostProcessor.java:85) at org.springframework.beans.factory.support.AbstractAutowireCapableBeanFactory.invokeAwareMethods(AbstractAutowireCapableBeanFactory.java:1502) at org.springframework.beans.factory.support.AbstractAutowireCapableBeanFactory.initializeBean(AbstractAutowireCapableBeanFactory.java:1470) at org.springframework.beans.factory.support.AbstractAutowireCapableBeanFactory.doCreateBean(AbstractAutowireCapableBeanFactory.java:521) ... 20 more Caused by: org.springframework.beans.factory.BeanCreationException: Could not autowire field: com.package.identityaccess.identity.UserRepository com.package.identityaccess.IdentityAccessAppConfig.userRepository; nested exception is org.springframework.beans.factory.BeanCreationException: Error creating bean with name 'userRepository': Cannot create inner bean '(inner bean)' of type [org.springframework.orm.jpa.SharedEntityManagerCreator] while setting bean property 'entityManager'; nested exception is org.springframework.beans.factory.BeanCreationException: Error creating bean with name '(inner bean)#1': Cannot resolve reference to bean 'identityAccessEntityManagerFactory' while setting constructor argument; nested exception is org.springframework.beans.factory.BeanCurrentlyInCreationException: Error creating bean with name 'identityAccessEntityManagerFactory': Requested bean is currently in creation: Is there an unresolvable circular reference? at org.springframework.beans.factory.annotation.AutowiredAnnotationBeanPostProcessor$AutowiredFieldElement.inject(AutowiredAnnotationBeanPostProcessor.java:514) at org.springframework.beans.factory.annotation.InjectionMetadata.inject(InjectionMetadata.java:87) at org.springframework.beans.factory.annotation.AutowiredAnnotationBeanPostProcessor.postProcessPropertyValues(AutowiredAnnotationBeanPostProcessor.java:285) ... 45 more Caused by: org.springframework.beans.factory.BeanCreationException: Error creating bean with name 'userRepository': Cannot create inner bean '(inner bean)' of type [org.springframework.orm.jpa.SharedEntityManagerCreator] while setting bean property 'entityManager'; nested exception is org.springframework.beans.factory.BeanCreationException: Error creating bean with name '(inner bean)#1': Cannot resolve reference to bean 'identityAccessEntityManagerFactory' while setting constructor argument; nested exception is org.springframework.beans.factory.BeanCurrentlyInCreationException: Error creating bean with name 'identityAccessEntityManagerFactory': Requested bean is currently in creation: Is there an unresolvable circular reference? at org.springframework.beans.factory.support.BeanDefinitionValueResolver.resolveInnerBean(BeanDefinitionValueResolver.java:282) at org.springframework.beans.factory.support.BeanDefinitionValueResolver.resolveValueIfNecessary(BeanDefinitionValueResolver.java:126) at org.springframework.beans.factory.support.AbstractAutowireCapableBeanFactory.applyPropertyValues(AbstractAutowireCapableBeanFactory.java:1387) at org.springframework.beans.factory.support.AbstractAutowireCapableBeanFactory.populateBean(AbstractAutowireCapableBeanFactory.java:1128) at org.springframework.beans.factory.support.AbstractAutowireCapableBeanFactory.doCreateBean(AbstractAutowireCapableBeanFactory.java:519) at org.springframework.beans.factory.support.AbstractAutowireCapableBeanFactory.createBean(AbstractAutowireCapableBeanFactory.java:458) at org.springframework.beans.factory.support.AbstractBeanFactory$1.getObject(AbstractBeanFactory.java:295) at org.springframework.beans.factory.support.DefaultSingletonBeanRegistry.getSingleton(DefaultSingletonBeanRegistry.java:223) at org.springframework.beans.factory.support.AbstractBeanFactory.doGetBean(AbstractBeanFactory.java:292) at org.springframework.beans.factory.support.AbstractBeanFactory.getBean(AbstractBeanFactory.java:194) at org.springframework.beans.factory.support.DefaultListableBeanFactory.findAutowireCandidates(DefaultListableBeanFactory.java:912) at org.springframework.beans.factory.support.DefaultListableBeanFactory.doResolveDependency(DefaultListableBeanFactory.java:855) at org.springframework.beans.factory.support.DefaultListableBeanFactory.resolveDependency(DefaultListableBeanFactory.java:770) at org.springframework.beans.factory.annotation.AutowiredAnnotationBeanPostProcessor$AutowiredFieldElement.inject(AutowiredAnnotationBeanPostProcessor.java:486) ... 47 more Caused by: org.springframework.beans.factory.BeanCreationException: Error creating bean with name '(inner bean)#1': Cannot resolve reference to bean 'identityAccessEntityManagerFactory' while setting constructor argument; nested exception is org.springframework.beans.factory.BeanCurrentlyInCreationException: Error creating bean with name 'identityAccessEntityManagerFactory': Requested bean is currently in creation: Is there an unresolvable circular reference? at org.springframework.beans.factory.support.BeanDefinitionValueResolver.resolveReference(BeanDefinitionValueResolver.java:329) at org.springframework.beans.factory.support.BeanDefinitionValueResolver.resolveValueIfNecessary(BeanDefinitionValueResolver.java:107) at org.springframework.beans.factory.support.ConstructorResolver.resolveConstructorArguments(ConstructorResolver.java:615) at org.springframework.beans.factory.support.ConstructorResolver.instantiateUsingFactoryMethod(ConstructorResolver.java:441) at org.springframework.beans.factory.support.AbstractAutowireCapableBeanFactory.instantiateUsingFactoryMethod(AbstractAutowireCapableBeanFactory.java:1025) at org.springframework.beans.factory.support.AbstractAutowireCapableBeanFactory.createBeanInstance(AbstractAutowireCapableBeanFactory.java:921) at org.springframework.beans.factory.support.AbstractAutowireCapableBeanFactory.doCreateBean(AbstractAutowireCapableBeanFactory.java:487) at org.springframework.beans.factory.support.AbstractAutowireCapableBeanFactory.createBean(AbstractAutowireCapableBeanFactory.java:458) at org.springframework.beans.factory.support.BeanDefinitionValueResolver.resolveInnerBean(BeanDefinitionValueResolver.java:271) ... 60 more Caused by: org.springframework.beans.factory.BeanCurrentlyInCreationException: Error creating bean with name 'identityAccessEntityManagerFactory': Requested bean is currently in creation: Is there an unresolvable circular reference? at org.springframework.beans.factory.support.DefaultSingletonBeanRegistry.beforeSingletonCreation(DefaultSingletonBeanRegistry.java:327) at org.springframework.beans.factory.support.DefaultSingletonBeanRegistry.getSingleton(DefaultSingletonBeanRegistry.java:217) at org.springframework.beans.factory.support.AbstractBeanFactory.doGetBean(AbstractBeanFactory.java:292) at org.springframework.beans.factory.support.AbstractBeanFactory.getBean(AbstractBeanFactory.java:194) at org.springframework.beans.factory.support.BeanDefinitionValueResolver.resolveReference(BeanDefinitionValueResolver.java:323) I am new to configuring spring through java and have been spinning circles for days. I have my application which includes 2 separate modules. The identity-access module will handle user and access information and will have a datasource to an older database. The other module module2 will eventually have its own database. Here are the config files: application: @Configuration @EnableWebMvc @ComponentScan(basePackages = "com.package.myapp.web") @ImportResource({"classpath:com/package/appbase/appbase-context.xml"}) @Import(com.package.identityaccess.IdentityAccessAppConfig.class) public class IMSAppConfig extends WebMvcConfigurerAdapter { @Override public void addResourceHandlers(ResourceHandlerRegistry registry) { registry.addResourceHandler("/resources/**").addResourceLocations("ims/resources/"); } } identity-access: @Configuration @ComponentScan(basePackages = "com.package.identityaccess") @EnableJpaRepositories(entityManagerFactoryRef = "identityAccessEntityManagerFactory", value = "com.package.identityaccess") @EnableTransactionManagement public class IdentityAccessAppConfig { @Autowired UserRepository userRepository; @Bean public DataSource identityAccessDataSource() throws IOException, SQLException { return new SelfConfiguringBasicDataSource(System.getProperty("db_properties_path") + "/dev.oracle.properties", ""); } @Bean public Map<String, Object> identityAccessJpaProperties() { Map<String, Object> props = new HashMap<>(); props.put("eclipselink.weaving", "false"); props.put("eclipselink.target-database", OraclePlatform.class.getName()); return props; } @Bean public JpaVendorAdapter identityAccessJpaVendorAdapter() { EclipseLinkJpaVendorAdapter eclipseLinkJpaVendorAdapter = new EclipseLinkJpaVendorAdapter(); eclipseLinkJpaVendorAdapter.setDatabasePlatform(OraclePlatform.class.getName()); eclipseLinkJpaVendorAdapter.setGenerateDdl(false); eclipseLinkJpaVendorAdapter.setShowSql(true); return eclipseLinkJpaVendorAdapter; } @Bean public PlatformTransactionManager identityAccessTransactionManager() throws IOException, SQLException { JpaTransactionManager txManager = new JpaTransactionManager(); txManager.setEntityManagerFactory(identityAccessEntityManagerFactory().getObject()); return txManager; } @Bean public LocalContainerEntityManagerFactoryBean identityAccessEntityManagerFactory() throws IOException, SQLException { LocalContainerEntityManagerFactoryBean lef = new LocalContainerEntityManagerFactoryBean(); lef.setDataSource(identityAccessDataSource()); lef.setJpaPropertyMap(identityAccessJpaProperties()); lef.setJpaVendorAdapter(identityAccessJpaVendorAdapter()); lef.setPackagesToScan("com.package.identityaccess"); return lef; } @Bean public AuthenticationService authenticationService() { return new AuthenticationServiceImpl(userRepository); } } module2: @Configuration @ComponentScan(basePackages = "com.package.myapp.core") @EnableJpaRepositories("com.package.myapp.core.domain") @EnableTransactionManagement public class ModuleTwoAppConfig { @Bean public DataSource dataSource() { EmbeddedDatabaseBuilder embeddedDatabaseBuilder = new EmbeddedDatabaseBuilder(); embeddedDatabaseBuilder.setType(EmbeddedDatabaseType.HSQL); embeddedDatabaseBuilder.addScript("setup.sql"); return embeddedDatabaseBuilder.build(); } @Bean public Map<String, Object> jpaProperties() { Map<String, Object> props = new HashMap<>(); props.put("eclipselink.weaving", "false"); props.put("eclipselink.ddl-generation", "create-tables"); props.put("eclipselink.target-database", HSQLPlatform.class.getName()); return props; } @Bean public JpaVendorAdapter jpaVendorAdapter() { EclipseLinkJpaVendorAdapter eclipseLinkJpaVendorAdapter = new EclipseLinkJpaVendorAdapter(); eclipseLinkJpaVendorAdapter.setDatabasePlatform(HSQLPlatform.class.getName()); eclipseLinkJpaVendorAdapter.setGenerateDdl(true); eclipseLinkJpaVendorAdapter.setShowSql(true); return eclipseLinkJpaVendorAdapter; } @Bean public PlatformTransactionManager transactionManager() { JpaTransactionManager txManager = new JpaTransactionManager(); txManager.setEntityManagerFactory(entityManagerFactory().getObject()); return txManager; } @Bean public LocalContainerEntityManagerFactoryBean entityManagerFactory() { LocalContainerEntityManagerFactoryBean lef = new LocalContainerEntityManagerFactoryBean(); lef.setDataSource(dataSource()); lef.setJpaPropertyMap(jpaProperties()); lef.setJpaVendorAdapter(jpaVendorAdapter()); lef.setPackagesToScan("com.package.myapp.core.domain"); return lef; } } UserRepository (uses spring-data): public interface UserRepository extends JpaRepository<User, Long> { @Query("select u from User u where u.user_id = ?1") User findByUserId(String userId); } Can you see any problems with what I've done?

    Read the article

  • JPA/Hibernate Embedded id and fields

    - by RoD
    I would like to do something like that: An object ReportingFile that can be a LogRequest or a LogReport file. ( both got the same structure) An object Reporting containing for one logRequest, a list of logReport with a date. An example (not working) would be: @Entity @AssociationOverride( name="logRequest.fileName", joinColumns = { @JoinColumn(name="log_request_file_name") } ) public class Reporting { @EmbeddedId private ReportingFile logRequest; @CollectionOfElements(fetch = FetchType.EAGER) @JoinTable(name = "t_reports", schema="", joinColumns = {@JoinColumn(name = "log_report")}) @Fetch(FetchMode.SELECT) private List<ReportingFile> reports; @Column(name="generated_date",nullable=true) private Date generatedDate; [...] } @Embeddable public class ReportingFile { @Column(name="file_name",length=255) private String fileName; @Column(name="xml_content") private Clob xmlContent; [...] } In this sample, i have a the following error: 15.03.2010 16:37:59 [ERROR] org.springframework.web.context.ContextLoader Context initialization failed org.springframework.beans.factory.BeanCreationException: Error creating bean with name 'org.springframework.dao.annotation.PersistenceExceptionTranslationPostProcessor#0' defined in class path resource [config/persistenceContext.xml]: Initialization of bean failed; nested exception is org.springframework.beans.factory.BeanCreationException: Error creating bean with name 'entityManagerFactory' defined in class path resource [config/persistenceContext.xml]: Invocation of init method failed; nested exception is javax.persistence.PersistenceException: [PersistenceUnit: test] Unable to configure EntityManagerFactory at org.springframework.beans.factory.support.AbstractAutowireCapableBeanFactory.doCreateBean(AbstractAutowireCapableBeanFactory.java:480) at org.springframework.beans.factory.support.AbstractAutowireCapableBeanFactory$1.run(AbstractAutowireCapableBeanFactory.java:409) at java.security.AccessController.doPrivileged(Native Method) at org.springframework.beans.factory.support.AbstractAutowireCapableBeanFactory.createBean(AbstractAutowireCapableBeanFactory.java:380) at org.springframework.beans.factory.support.AbstractBeanFactory$1.getObject(AbstractBeanFactory.java:264) at org.springframework.beans.factory.support.DefaultSingletonBeanRegistry.getSingleton(DefaultSingletonBeanRegistry.java:221) at org.springframework.beans.factory.support.AbstractBeanFactory.doGetBean(AbstractBeanFactory.java:261) at org.springframework.beans.factory.support.AbstractBeanFactory.getBean(AbstractBeanFactory.java:185) at org.springframework.beans.factory.support.AbstractBeanFactory.getBean(AbstractBeanFactory.java:164) at org.springframework.context.support.AbstractApplicationContext.getBean(AbstractApplicationContext.java:881) at org.springframework.context.support.AbstractApplicationContext.registerBeanPostProcessors(AbstractApplicationContext.java:597) at org.springframework.context.support.AbstractApplicationContext.refresh(AbstractApplicationContext.java:366) at org.springframework.web.context.ContextLoader.createWebApplicationContext(ContextLoader.java:255) at org.springframework.web.context.ContextLoader.initWebApplicationContext(ContextLoader.java:199) at org.springframework.web.context.ContextLoaderListener.contextInitialized(ContextLoaderListener.java:45) at org.apache.catalina.core.StandardContext.listenerStart(StandardContext.java:3843) at org.apache.catalina.core.StandardContext.start(StandardContext.java:4350) at org.apache.catalina.core.ContainerBase.start(ContainerBase.java:1045) at org.apache.catalina.core.StandardHost.start(StandardHost.java:719) at org.apache.catalina.core.ContainerBase.start(ContainerBase.java:1045) at org.apache.catalina.core.StandardEngine.start(StandardEngine.java:443) at org.apache.catalina.core.StandardService.start(StandardService.java:516) at org.apache.catalina.core.StandardServer.start(StandardServer.java:710) at org.apache.catalina.startup.Catalina.start(Catalina.java:578) at sun.reflect.NativeMethodAccessorImpl.invoke0(Native Method) at sun.reflect.NativeMethodAccessorImpl.invoke(NativeMethodAccessorImpl.java:39) at sun.reflect.DelegatingMethodAccessorImpl.invoke(DelegatingMethodAccessorImpl.java:25) at java.lang.reflect.Method.invoke(Method.java:597) at org.apache.catalina.startup.Bootstrap.start(Bootstrap.java:288) at org.apache.catalina.startup.Bootstrap.main(Bootstrap.java:413) Caused by: org.springframework.beans.factory.BeanCreationException: Error creating bean with name 'entityManagerFactory' defined in class path resource [config/persistenceContext.xml]: Invocation of init method failed; nested exception is javax.persistence.PersistenceException: [PersistenceUnit: test] Unable to configure EntityManagerFactory at org.springframework.beans.factory.support.AbstractAutowireCapableBeanFactory.initializeBean(AbstractAutowireCapableBeanFactory.java:1337) at org.springframework.beans.factory.support.AbstractAutowireCapableBeanFactory.doCreateBean(AbstractAutowireCapableBeanFactory.java:473) at org.springframework.beans.factory.support.AbstractAutowireCapableBeanFactory$1.run(AbstractAutowireCapableBeanFactory.java:409) at java.security.AccessController.doPrivileged(Native Method) at org.springframework.beans.factory.support.AbstractAutowireCapableBeanFactory.createBean(AbstractAutowireCapableBeanFactory.java:380) at org.springframework.beans.factory.support.AbstractBeanFactory$1.getObject(AbstractBeanFactory.java:264) at org.springframework.beans.factory.support.DefaultSingletonBeanRegistry.getSingleton(DefaultSingletonBeanRegistry.java:221) at org.springframework.beans.factory.support.AbstractBeanFactory.doGetBean(AbstractBeanFactory.java:261) at org.springframework.beans.factory.support.AbstractBeanFactory.getBean(AbstractBeanFactory.java:185) at org.springframework.beans.factory.support.AbstractBeanFactory.getBean(AbstractBeanFactory.java:164) at org.springframework.beans.factory.support.DefaultListableBeanFactory.getBeansOfType(DefaultListableBeanFactory.java:308) at org.springframework.beans.factory.BeanFactoryUtils.beansOfTypeIncludingAncestors(BeanFactoryUtils.java:270) at org.springframework.dao.support.PersistenceExceptionTranslationInterceptor.detectPersistenceExceptionTranslators(PersistenceExceptionTranslationInterceptor.java:122) at org.springframework.dao.support.PersistenceExceptionTranslationInterceptor.<init>(PersistenceExceptionTranslationInterceptor.java:78) at org.springframework.dao.annotation.PersistenceExceptionTranslationAdvisor.<init>(PersistenceExceptionTranslationAdvisor.java:70) at org.springframework.dao.annotation.PersistenceExceptionTranslationPostProcessor.setBeanFactory(PersistenceExceptionTranslationPostProcessor.java:97) at org.springframework.beans.factory.support.AbstractAutowireCapableBeanFactory.initializeBean(AbstractAutowireCapableBeanFactory.java:1325) at org.springframework.beans.factory.support.AbstractAutowireCapableBeanFactory.doCreateBean(AbstractAutowireCapableBeanFactory.java:473) ... 29 more Caused by: javax.persistence.PersistenceException: [PersistenceUnit: test] Unable to configure EntityManagerFactory at org.hibernate.ejb.Ejb3Configuration.configure(Ejb3Configuration.java:265) at org.hibernate.ejb.HibernatePersistence.createEntityManagerFactory(HibernatePersistence.java:125) at javax.persistence.Persistence.createEntityManagerFactory(Persistence.java:83) at org.springframework.orm.jpa.LocalEntityManagerFactoryBean.createNativeEntityManagerFactory(LocalEntityManagerFactoryBean.java:91) at org.springframework.orm.jpa.AbstractEntityManagerFactoryBean.afterPropertiesSet(AbstractEntityManagerFactoryBean.java:291) at org.springframework.beans.factory.support.AbstractAutowireCapableBeanFactory.invokeInitMethods(AbstractAutowireCapableBeanFactory.java:1368) at org.springframework.beans.factory.support.AbstractAutowireCapableBeanFactory.initializeBean(AbstractAutowireCapableBeanFactory.java:1334) ... 46 more Caused by: org.hibernate.AnnotationException: A Foreign key refering Reporting from Reporting has the wrong number of column. should be 2 at org.hibernate.cfg.annotations.TableBinder.bindFk(TableBinder.java:272) at org.hibernate.cfg.annotations.CollectionBinder.bindCollectionSecondPass(CollectionBinder.java:1319) at org.hibernate.cfg.annotations.CollectionBinder.bindManyToManySecondPass(CollectionBinder.java:1158) at org.hibernate.cfg.annotations.CollectionBinder.bindStarToManySecondPass(CollectionBinder.java:600) at org.hibernate.cfg.annotations.CollectionBinder$1.secondPass(CollectionBinder.java:541) at org.hibernate.cfg.CollectionSecondPass.doSecondPass(CollectionSecondPass.java:43) at org.hibernate.cfg.Configuration.secondPassCompile(Configuration.java:1140) at org.hibernate.cfg.AnnotationConfiguration.secondPassCompile(AnnotationConfiguration.java:319) at org.hibernate.cfg.Configuration.buildMappings(Configuration.java:1125) at org.hibernate.ejb.Ejb3Configuration.buildMappings(Ejb3Configuration.java:1226) at org.hibernate.ejb.EventListenerConfigurator.configure(EventListenerConfigurator.java:159) at org.hibernate.ejb.Ejb3Configuration.configure(Ejb3Configuration.java:854) at org.hibernate.ejb.Ejb3Configuration.configure(Ejb3Configuration.java:191) at org.hibernate.ejb.Ejb3Configuration.configure(Ejb3Configuration.java:253) ... 52 more

    Read the article

  • Am I going about this the right way?

    - by Psytronic
    Hey Guys, I'm starting a WPF project, and just finished the base of the UI, it seems very convoluted though, so I'm not sure if I've gone around laying it out in the right way. I don't want to get to start developing the back-end and realise that I've done the front wrong, and make life harder for myself. Coming from a background of <DIV's and CSS to style this is a lot different, and really want to get it right from the start. Essentially it's a one week calendar (7 days, Mon-Sunday, defaulting to the current week.) Which will eventually link up to a DB and if I have an appointment for something on this day it will show it in the relevant day. I've opted for a Grid rather than ListView because of the way it will work I will not be binding the results to a collection or anything along those lines. Rather I will be filling out a Combo box within the canvas for each day (yet to be placed in the code) for each event and on selection it will show me further details. XAML: <Window x:Class="WOW_Widget.Window1" xmlns="http://schemas.microsoft.com/winfx/2006/xaml/presentation" xmlns:x="http://schemas.microsoft.com/winfx/2006/xaml" xmlns:s="clr-namespace:System;assembly=mscorlib" xmlns:Extensions="clr-namespace:WOW_Widget" DataContext="{Binding RelativeSource={RelativeSource Self}}" Title="Window1" Height="239" Width="831" <Window.Resources <LinearGradientBrush x:Key="NormalBrush" StartPoint="0,0" EndPoint="0,1" <GradientBrush.GradientStops <GradientStopCollection <GradientStop Offset="1.0" Color="White"/ <GradientStop Offset="0.0" Color="LightSlateGray"/ </GradientStopCollection </GradientBrush.GradientStops </LinearGradientBrush <LinearGradientBrush x:Key="grdDayHeader" StartPoint="0,0" EndPoint="0,1" <GradientBrush.GradientStops <GradientStopCollection <GradientStop Offset="0.0" Color="Peru" / <GradientStop Offset="1.0" Color="White" / </GradientStopCollection </GradientBrush.GradientStops </LinearGradientBrush <LinearGradientBrush x:Key="grdToday" StartPoint="0,0" EndPoint="0,1" <GradientBrush.GradientStops <GradientStopCollection <GradientStop Offset="0.0" Color="LimeGreen"/ <GradientStop Offset="1.0" Color="DarkGreen" / </GradientStopCollection </GradientBrush.GradientStops </LinearGradientBrush <Style TargetType="{x:Type GridViewColumnHeader}" <Setter Property="Background" Value="Khaki" / </Style <Style x:Key="DayHeader" TargetType="{x:Type Label}" <Setter Property="Background" Value="{StaticResource grdDayHeader}" / <Setter Property="Width" Value="111" / <Setter Property="Height" Value="25" / <Setter Property="HorizontalContentAlignment" Value="Center" / </Style <Style x:Key="DayField" <Setter Property="Canvas.Width" Value="111" / <Setter Property="Canvas.Height" Value="60" / <Setter Property="Canvas.Background" Value="White" / </Style <Style x:Key="Today" <Setter Property="Canvas.Background" Value="{StaticResource grdToday}" / </Style <Style x:Key="CalendarColSpacer" <Setter Property="Canvas.Width" Value="1" / <Setter Property="Canvas.Background" Value="Black" / </Style <Style x:Key="CalendarRowSpacer" <Setter Property="Canvas.Height" Value="1" / <Setter Property="Canvas.Background" Value="Black" / </Style </Window.Resources <Grid Background="{StaticResource NormalBrush}" <Border BorderBrush="Black" BorderThickness="1" Width="785" Height="86" Margin="12,12,12,104" <Canvas Height="86" Width="785" VerticalAlignment="Top" <Grid <Grid.ColumnDefinitions <ColumnDefinition / <ColumnDefinition / <ColumnDefinition / <ColumnDefinition / <ColumnDefinition / <ColumnDefinition / <ColumnDefinition / <ColumnDefinition / <ColumnDefinition / <ColumnDefinition / <ColumnDefinition / <ColumnDefinition / <ColumnDefinition / </Grid.ColumnDefinitions <Grid.RowDefinitions <RowDefinition / <RowDefinition / <RowDefinition / </Grid.RowDefinitions <Label Grid.Column="0" Grid.Row="0" Content="Monday" Style="{StaticResource DayHeader}" / <Canvas Grid.Column="1" Grid.RowSpan="3" Grid.Row="0" Style="{StaticResource CalendarColSpacer}" / <Label Grid.Column="2" Grid.Row="0" Content="Tuesday" Style="{StaticResource DayHeader}" / <Canvas Grid.Column="3" Grid.RowSpan="3" Grid.Row="0" Style="{StaticResource CalendarColSpacer}" / <Label Grid.Column="4" Grid.Row="0" Content="Wednesday" Style="{StaticResource DayHeader}" / <Canvas Grid.Column="5" Grid.RowSpan="3" Grid.Row="0" Style="{StaticResource CalendarColSpacer}" / <Label Grid.Column="6" Grid.Row="0" Content="Thursday" Style="{StaticResource DayHeader}" / <Canvas Grid.Column="7" Grid.RowSpan="3" Grid.Row="0" Style="{StaticResource CalendarColSpacer}" / <Label Grid.Column="8" Grid.Row="0" Content="Friday" Style="{StaticResource DayHeader}" / <Canvas Grid.Column="9" Grid.RowSpan="3" Grid.Row="0" Style="{StaticResource CalendarColSpacer}" / <Label Grid.Column="10" Grid.Row="0" Content="Saturday" Style="{StaticResource DayHeader}" / <Canvas Grid.Column="11" Grid.RowSpan="3" Grid.Row="0" Style="{StaticResource CalendarColSpacer}" / <Label Grid.Column="12" Grid.Row="0" Content="Sunday" Style="{StaticResource DayHeader}" / <Canvas Grid.Column="0" Grid.ColumnSpan="13" Grid.Row="1" Style="{StaticResource CalendarRowSpacer}" / <Canvas Grid.Column="0" Grid.Row="2" Margin="0" Style="{StaticResource DayField}" <Label Name="lblMondayDate" / </Canvas <Canvas Grid.Column="2" Grid.Row="2" Margin="0" Style="{StaticResource DayField}" <Label Name="lblTuesdayDate" / </Canvas <Canvas Grid.Column="4" Grid.Row="2" Margin="0" Style="{StaticResource DayField}" <Label Name="lblWednesdayDate" / </Canvas <Canvas Grid.Column="6" Grid.Row="2" Margin="0" Style="{StaticResource DayField}" <Label Name="lblThursdayDate" / </Canvas <Canvas Grid.Column="8" Grid.Row="2" Margin="0" Style="{StaticResource DayField}" <Label Name="lblFridayDate" / </Canvas <Canvas Grid.Column="10" Grid.Row="2" Margin="0" Style="{StaticResource DayField}" <Label Name="lblSaturdayDate" / </Canvas <Canvas Grid.Column="12" Grid.Row="2" Margin="0" Style="{StaticResource DayField}" <Label Name="lblSundayDate" / </Canvas </Grid </Canvas </Border <Canvas Height="86" HorizontalAlignment="Right" Margin="0,0,12,12" Name="canvas1" VerticalAlignment="Bottom" Width="198"</Canvas </Grid </Window CS: public partial class Window1 : Window { private DateTime today = new DateTime(); private Label[] Dates = new Label[7]; public Window1() { DateTime start = today = DateTime.Now; int day = (int)today.DayOfWeek; while (day != 1) { start = start.Subtract(new TimeSpan(1, 0, 0, 0)); day--; } InitializeComponent(); Dates[0] = lblMondayDate; Dates[1] = lblTuesdayDate; Dates[2] = lblWednesdayDate; Dates[3] = lblThursdayDate; Dates[4] = lblFridayDate; Dates[5] = lblSaturdayDate; Dates[6] = lblSundayDate; FillWeek(start); } private void FillWeek(DateTime start) { for (int d = 0; d < Dates.Length; d++) { TimeSpan td = new TimeSpan(d, 0, 0, 0); DateTime _day = start.Add(td); if (_day.Date == today.Date) { Canvas dayCanvas = (Canvas)Dates[d].Parent; dayCanvas.Style = (Style)this.Resources["Today"]; } Dates[d].Content = (int)start.Add(td).Day; } } } Thanks for any tips you guys can give Psytronic

    Read the article

  • Fading in/Fade out text in IE

    - by tau
    I had a problem and whipped up a quick solution: fade-in and fade-out a series of quotations. My solution works just as I want it in every browser except any of the IEs. The only problem with the IEs is that the text does not fade in and fade out; the text simply pops into existence. I believe I've run into a similar problem before when trying to dynamically change the filter:alpha(opacity=xx) of an element. Any help is greatly appreciated! <html> <head> <style> .fadetext{ background:green; border:1px solid red; height:50px; width:500px; } .fadetext div{ background:yellow; } </style> <script type="text/javascript"> var CI_common = { C:function(cls,elm){ if(!elm) elm = document; if(document.getElementsByClassName){ return elm.getElementsByClassName(cls); }else{ var t = []; var o = elm.getElementsByTagName("*"); var r = new RegExp("(^|\\s)" + cls + "($|\\s)"); for(var i=0;i<o.length;i++){ if(o[i].className.match(r)) t.push(o[i]); } return t; } }, eventAdd:function(obj,evt,func){ if(obj.addEventListener){ obj.addEventListener(evt,func,false); }else if(obj.attachEvent){ obj["x" + evt + func] = func; obj[evt + func] = function(){ obj["x" + evt + func](window.event); } obj.attachEvent("on" + evt,obj[evt + func]); } } } var CI_fadetext = { init:function(){ var c = CI_common.C("fadetext"); // Simply a getElementsByClassName function for(var i=0;i<c.length;i++){ c[i].style.overflow = "hidden"; var kids = c[i].getElementsByTagName("div"); for(var j=0;j<kids.length;j++){ kids[j].style.display = "none"; kids[j].style.filter = "alpha(opacity=0)"; kids[j].style.opacity = "0"; (function(obj,index,len){ obj.fadetexttimeout = setTimeout(function(){ CI_fadetext.fade(obj,true); obj.fadeininterval = setInterval(function(){ CI_fadetext.fade(obj,true); },5000*len) },5000*index); setTimeout(function(){ CI_fadetext.fade(obj,false); obj.fadeoutinterval = setInterval(function(){ CI_fadetext.fade(obj,false); },5000*len) },5000*index+4400); })(kids[j],j,kids.length); } } }, fade:function(elm,dir){ function fade(start){ start = (dir ? start + 10 : start - 10); elm.style.filter = "alpha(opacity=" + start + ")"; elm.style.opacity = start/100; document.getElementById("output").innerHTML = elm.style.filter; if(start > 100 || start <0){ elm.style.display = (dir ? "" : "none"); elm.style.filter = "alpha(opacity=" + (dir ? 100 : 0) + ")"; elm.style.opacity = (dir ? 1 : 0); }else elm.fadetexttimeout = setTimeout(function(){fade(start);},50); } if(dir){ elm.style.display = ""; fade(0); }else fade(100); } } CI_common.eventAdd(window,"load",CI_fadetext.init); // Just a window.onload level 2 event listener </script> </head> <body> <div id="output"></div> <div class="fadetext"> <div>AAAA</div> <div>BBBB</div> <div>CCCC</div> <div>DDDD</div> <div>EEEE</div> </div> </body> </html>

    Read the article

  • Login failed for user 'sa' because the account is currently locked out. The system administrator can

    - by cabhilash
    Login failed for user 'sa' because the account is currently locked out. The system administrator can unlock it. (Microsoft SQL Server, Error: 18486) SQL server has local password policies. If policy is enabled which locks down the account after X number of failed attempts then the account is automatically locked down.This error with 'sa' account is very common. sa is default administartor login available with SQL server. So there are chances that an ousider has tried to bruteforce your system. (This can cause even if a legitimate tries to access the account with wrong password.Sometimes a user would have changed the password without informing others. So the other users would try to lo) You can unlock the account with the following options (use another admin account or connect via windows authentication) Alter account & unlock ALTER LOGIN sa WITH PASSWORD='password' UNLOCK Use another account Almost everyone is aware of the sa account. This can be the potential security risk. Even if you provide strong password hackers can lock the account by providing the wrong password. ( You can provide extra security by installing firewall or changing the default port but these measures are not always practical). As a best practice you can disable the sa account and use another account with same privileges.ALTER LOGIN sa DISABLE You can edit the lock-ot options using gpedit.msc( in command prompt type gpedit.msc and press enter). Navigate to Account Lokout policy as shown in the figure The Following options are available Account lockout threshold This security setting determines the number of failed logon attempts that causes a user account to be locked out. A locked-out account cannot be used until it is reset by an administrator or until the lockout duration for the account has expired. You can set a value between 0 and 999 failed logon attempts. If you set the value to 0, the account will never be locked out. Failed password attempts against workstations or member servers that have been locked using either CTRL+ALT+DELETE or password-protected screen savers count as failed logon attempts. Account lockout duration This security setting determines the number of minutes a locked-out account remains locked out before automatically becoming unlocked. The available range is from 0 minutes through 99,999 minutes. If you set the account lockout duration to 0, the account will be locked out until an administrator explicitly unlocks it. If an account lockout threshold is defined, the account lockout duration must be greater than or equal to the reset time. Default: None, because this policy setting only has meaning when an Account lockout threshold is specified. Reset account lockout counter after This security setting determines the number of minutes that must elapse after a failed logon attempt before the failed logon attempt counter is reset to 0 bad logon attempts. The available range is 1 minute to 99,999 minutes. If an account lockout threshold is defined, this reset time must be less than or equal to the Account lockout duration. Default: None, because this policy setting only has meaning when an Account lockout threshold is specified.When creating SQL user you can set CHECK_POLICY=on which will enforce the windows password policy on the account. The following policies will be applied Define the Enforce password history policy setting so that several previous passwords are remembered. With this policy setting, users cannot use the same password when their password expires.  Define the Maximum password age policy setting so that passwords expire as often as necessary for your environment, typically, every 30 to 90 days. With this policy setting, if an attacker cracks a password, the attacker only has access to the network until the password expires.  Define the Minimum password age policy setting so that passwords cannot be changed until they are more than a certain number of days old. This policy setting works in combination with the Enforce password historypolicy setting. If a minimum password age is defined, users cannot repeatedly change their passwords to get around the Enforce password history policy setting and then use their original password. Users must wait the specified number of days to change their passwords.  Define a Minimum password length policy setting so that passwords must consist of at least a specified number of characters. Long passwords--seven or more characters--are usually stronger than short ones. With this policy setting, users cannot use blank passwords, and they have to create passwords that are a certain number of characters long.  Enable the Password must meet complexity requirements policy setting. This policy setting checks all new passwords to ensure that they meet basic strong password requirements.  Password must meet the following complexity requirement, when they are changed or created: Not contain the user's entire Account Name or entire Full Name. The Account Name and Full Name are parsed for delimiters: commas, periods, dashes or hyphens, underscores, spaces, pound signs, and tabs. If any of these delimiters are found, the Account Name or Full Name are split and all sections are verified not to be included in the password. There is no check for any character or any three characters in succession. Contain characters from three of the following five categories:  English uppercase characters (A through Z) English lowercase characters (a through z) Base 10 digits (0 through 9) Non-alphabetic characters (for example, !, $, #, %) A catch-all category of any Unicode character that does not fall under the previous four categories. This fifth category can be regionally specific.

    Read the article

  • A deadlock was detected while trying to lock variables in SSIS

    Error: 0xC001405C at SQL Log Status: A deadlock was detected while trying to lock variables "User::RowCount" for read/write access. A lock cannot be acquired after 16 attempts. The locks timed out. Have you ever considered variable locking when building your SSIS packages? I expect many people haven’t just because most of the time you never see an error like the one above. I’ll try and explain a few key concepts about variable locking and hopefully you never will see that error. First of all, what is all this variable locking all about? Put simply SSIS variables have to be locked before they can be accessed, and then of course unlocked once you have finished with them. This is baked into SSIS, presumably to reduce the risk of race conditions, but with that comes some additional overhead in that you need to be careful to avoid lock conflicts in some scenarios. The most obvious place you will come across any hint of locking (no pun intended) is the Script Task or Script Component with their ReadOnlyVariables and ReadWriteVariables properties. These two properties allow you to enter lists of variables to be used within the task, or to put it another way, these lists of variables to be locked, so that they are available within the task. During the task pre-execute phase the variables and locked, you then use them during the execute phase when you code is run, and then unlocked for you during the post-execute phase. So by entering the variable names in one of the two list, the locking is taken care of for you, and you just read and write to the Dts.Variables collection that is exposed in the task for the purpose. As you can see in the image above, the variable PackageInt is specified, which means when I write the code inside that task I don’t have to worry about locking at all, as shown below. public void Main() { // Set the variable value to something new Dts.Variables["PackageInt"].Value = 199; // Raise an event so we can play in the event handler bool fireAgain = true; Dts.Events.FireInformation(0, "Script Task Code", "This is the script task raising an event.", null, 0, ref fireAgain); Dts.TaskResult = (int)ScriptResults.Success; } As you can see as well as accessing the variable, hassle free, I also raise an event. Now consider a scenario where I have an event hander as well as shown below. Now what if my event handler uses tries to use the same variable as well? Well obviously for the point of this post, it fails with the error quoted previously. The reason why is clearly illustrated if you consider the following sequence of events. Package execution starts Script Task in Control Flow starts Script Task in Control Flow locks the PackageInt variable as specified in the ReadWriteVariables property Script Task in Control Flow executes script, and the On Information event is raised The On Information event handler starts Script Task in On Information event handler starts Script Task in On Information event handler attempts to lock the PackageInt variable (for either read or write it doesn’t matter), but will fail because the variable is already locked. The problem is caused by the event handler task trying to use a variable that is already locked by the task in Control Flow. Events are always raised synchronously, therefore the task in Control Flow that is raising the event will not regain control until the event handler has completed, so we really do have un-resolvable locking conflict, better known as a deadlock. In this scenario we can easily resolve the problem by managing the variable locking explicitly in code, so no need to specify anything for the ReadOnlyVariables and ReadWriteVariables properties. public void Main() { // Set the variable value to something new, with explicit lock control Variables lockedVariables = null; Dts.VariableDispenser.LockOneForWrite("PackageInt", ref lockedVariables); lockedVariables["PackageInt"].Value = 199; lockedVariables.Unlock(); // Raise an event so we can play in the event handler bool fireAgain = true; Dts.Events.FireInformation(0, "Script Task Code", "This is the script task raising an event.", null, 0, ref fireAgain); Dts.TaskResult = (int)ScriptResults.Success; } Now the package will execute successfully because the variable lock has already been released by the time the event is raised, so no conflict occurs. For those of you with a SQL Engine background this should all sound strangely familiar, and boils down to getting in and out as fast as you can to reduce the risk of lock contention, be that SQL pages or SSIS variables. Unfortunately we cannot always manage the locking ourselves. The Execute SQL Task is very often used in conjunction with variables, either to pass in parameter values or get results out. Either way the task will manage the locking for you, and will fail when it cannot lock the variables it requires. The scenario outlined above is clear cut deadlock scenario, both parties are waiting on each other, so it is un-resolvable. The mechanism used within SSIS isn’t actually that clever, and whilst the message says it is a deadlock, it really just means it tried a few times, and then gave up. The last part of the error message is actually the most accurate in terms of the failure, A lock cannot be acquired after 16 attempts. The locks timed out.  Now this may come across as a recommendation to always manage locking manually in the Script Task or Script Component yourself, but I think that would be an overreaction. It is more of a reminder to be aware that in high concurrency scenarios, especially when sharing variables across multiple objects, locking is important design consideration. Update – Make sure you don’t try and use explicit locking as well as leaving the variable names in the ReadOnlyVariables and ReadWriteVariables lock lists otherwise you’ll get the deadlock error, you cannot lock a variable twice!

    Read the article

  • TFS API Change WorkItem CreatedDate And ChangedDate To Historic Dates

    - by Tarun Arora
    There may be times when you need to modify the value of the fields “System.CreatedDate” and “System.ChangedDate” on a work item. Richard Hundhausen has a great blog with ample of reason why or why not you should need to set the values of these fields to historic dates. In this blog post I’ll show you, Create a PBI WorkItem linked to a Task work item by pre-setting the value of the field ‘System.ChangedDate’ to a historic date Change the value of the field ‘System.Created’ to a historic date Simulate the historic burn down of a task type work item in a sprint Explain the impact of updating values of the fields CreatedDate and ChangedDate on the Sprint burn down chart Rules of Play      1. You need to be a member of the Project Collection Service Accounts              2. You need to use ‘WorkItemStoreFlags.BypassRules’ when you instantiate the WorkItemStore service // Instanciate Work Item Store with the ByPassRules flag _wis = new WorkItemStore(_tfs, WorkItemStoreFlags.BypassRules);      3. You cannot set the ChangedDate         - Less than the changed date of previous revision         - Greater than current date Walkthrough The walkthrough contains 5 parts 00 – Required References 01 – Connect to TFS Programmatically 02 – Create a Work Item Programmatically 03 – Set the values of fields ‘System.ChangedDate’ and ‘System.CreatedDate’ to historic dates 04 – Results of our experiment Lets get started………………………………………………… 00 – Required References Microsoft.TeamFoundation.dll Microsoft.TeamFoundation.Client.dll Microsoft.TeamFoundation.Common.dll Microsoft.TeamFoundation.WorkItemTracking.Client.dll 01 – Connect to TFS Programmatically I have a in depth blog post on how to connect to TFS programmatically in case you are interested. However, the code snippet below will enable you to connect to TFS using the Team Project Picker. // Services I need access to globally private static TfsTeamProjectCollection _tfs; private static ProjectInfo _selectedTeamProject; private static WorkItemStore _wis; // Connect to TFS Using Team Project Picker public static bool ConnectToTfs() { var isSelected = false; // The user is allowed to select only one project var tfsPp = new TeamProjectPicker(TeamProjectPickerMode.SingleProject, false); tfsPp.ShowDialog(); // The TFS project collection _tfs = tfsPp.SelectedTeamProjectCollection; if (tfsPp.SelectedProjects.Any()) { // The selected Team Project _selectedTeamProject = tfsPp.SelectedProjects[0]; isSelected = true; } return isSelected; } 02 – Create a Work Item Programmatically In the below code snippet I have create a Product Backlog Item and a Task type work item and then link them together as parent and child. Note – You will have to set the ChangedDate to a historic date when you created the work item. Remember, If you try and set the ChangedDate to a value earlier than last assigned you will receive the following exception… TF26212: Team Foundation Server could not save your changes. There may be problems with the work item type definition. Try again or contact your Team Foundation Server administrator. If you notice below I have added a few seconds each time I have modified the ‘ChangedDate’ just to avoid running into the exception listed above. // Create Linked Work Items and return Ids private static List<int> CreateWorkItemsProgrammatically() { // Instantiate Work Item Store with the ByPassRules flag _wis = new WorkItemStore(_tfs, WorkItemStoreFlags.BypassRules); // List of work items to return var listOfWorkItems = new List<int>(); // Create a new Product Backlog Item var p = new WorkItem(_wis.Projects[_selectedTeamProject.Name].WorkItemTypes["Product Backlog Item"]); p.Title = "This is a new PBI"; p.Description = "Description"; p.IterationPath = string.Format("{0}\\Release 1\\Sprint 1", _selectedTeamProject.Name); p.AreaPath = _selectedTeamProject.Name; p["Effort"] = 10; // Just double checking that ByPassRules is set to true if (_wis.BypassRules) { p.Fields["System.ChangedDate"].Value = Convert.ToDateTime("2012-01-01"); } if (p.Validate().Count == 0) { p.Save(); listOfWorkItems.Add(p.Id); } else { Console.WriteLine(">> Following exception(s) encountered during work item save: "); foreach (var e in p.Validate()) { Console.WriteLine(" - '{0}' ", e); } } var t = new WorkItem(_wis.Projects[_selectedTeamProject.Name].WorkItemTypes["Task"]); t.Title = "This is a task"; t.Description = "Task Description"; t.IterationPath = string.Format("{0}\\Release 1\\Sprint 1", _selectedTeamProject.Name); t.AreaPath = _selectedTeamProject.Name; t["Remaining Work"] = 10; if (_wis.BypassRules) { t.Fields["System.ChangedDate"].Value = Convert.ToDateTime("2012-01-01"); } if (t.Validate().Count == 0) { t.Save(); listOfWorkItems.Add(t.Id); } else { Console.WriteLine(">> Following exception(s) encountered during work item save: "); foreach (var e in t.Validate()) { Console.WriteLine(" - '{0}' ", e); } } var linkTypEnd = _wis.WorkItemLinkTypes.LinkTypeEnds["Child"]; p.Links.Add(new WorkItemLink(linkTypEnd, t.Id) {ChangedDate = Convert.ToDateTime("2012-01-01").AddSeconds(20)}); if (_wis.BypassRules) { p.Fields["System.ChangedDate"].Value = Convert.ToDateTime("2012-01-01").AddSeconds(20); } if (p.Validate().Count == 0) { p.Save(); } else { Console.WriteLine(">> Following exception(s) encountered during work item save: "); foreach (var e in p.Validate()) { Console.WriteLine(" - '{0}' ", e); } } return listOfWorkItems; } 03 – Set the value of “Created Date” and Change the value of “Changed Date” to Historic Dates The CreatedDate can only be changed after a work item has been created. If you try and set the CreatedDate to a historic date at the time of creation of a work item, it will not work. // Lets do a work item effort burn down simulation by updating the ChangedDate & CreatedDate to historic Values private static void WorkItemChangeSimulation(IEnumerable<int> listOfWorkItems) { foreach (var id in listOfWorkItems) { var wi = _wis.GetWorkItem(id); switch (wi.Type.Name) { case "ProductBacklogItem": if (wi.State.ToLower() == "new") wi.State = "Approved"; // Advance the changed date by few seconds wi.Fields["System.ChangedDate"].Value = Convert.ToDateTime(wi.Fields["System.ChangedDate"].Value).AddSeconds(10); // Set the CreatedDate to Changed Date wi.Fields["System.CreatedDate"].Value = Convert.ToDateTime(wi.Fields["System.ChangedDate"].Value).AddSeconds(10); wi.Save(); break; case "Task": // Advance the changed date by few seconds wi.Fields["System.ChangedDate"].Value = Convert.ToDateTime(wi.Fields["System.ChangedDate"].Value).AddSeconds(10); // Set the CreatedDate to Changed date wi.Fields["System.CreatedDate"].Value = Convert.ToDateTime(wi.Fields["System.ChangedDate"].Value).AddSeconds(10); wi.Save(); break; } } // A mock sprint start date var sprintStart = DateTime.Today.AddDays(-5); // A mock sprint end date var sprintEnd = DateTime.Today.AddDays(5); // What is the total Sprint duration var totalSprintDuration = (sprintEnd - sprintStart).Days; // How much of the sprint have we already covered var noOfDaysIntoSprint = (DateTime.Today - sprintStart).Days; // Get the effort assigned to our tasks var totalEffortRemaining = QueryTaskTotalEfforRemaining(listOfWorkItems); // Defining how much effort to burn every day decimal dailyBurnRate = totalEffortRemaining / totalSprintDuration < 1 ? 1 : totalEffortRemaining / totalSprintDuration; // we have just created one task var totalNoOfTasks = 1; var simulation = sprintStart; var currentDate = DateTime.Today.Date; // Carry on till effort has been burned down from sprint start to today while (simulation.Date != currentDate.Date) { var dailyBurnRate1 = dailyBurnRate; // A fixed amount needs to be burned down each day while (dailyBurnRate1 > 0) { // burn down bit by bit from all unfinished task type work items foreach (var id in listOfWorkItems) { var wi = _wis.GetWorkItem(id); var isDirty = false; // Set the status to in progress if (wi.State.ToLower() == "to do") { wi.State = "In Progress"; isDirty = true; } // Ensure that there is enough effort remaining in tasks to burn down the daily burn rate if (QueryTaskTotalEfforRemaining(listOfWorkItems) > dailyBurnRate1) { // If there is less than 1 unit of effort left in the task, burn it all if (Convert.ToDecimal(wi["Remaining Work"]) <= 1) { wi["Remaining Work"] = 0; dailyBurnRate1 = dailyBurnRate1 - Convert.ToDecimal(wi["Remaining Work"]); isDirty = true; } else { // How much to burn from each task? var toBurn = (dailyBurnRate / totalNoOfTasks) < 1 ? 1 : (dailyBurnRate / totalNoOfTasks); // Check that the task has enough effort to allow burnForTask effort if (Convert.ToDecimal(wi["Remaining Work"]) >= toBurn) { wi["Remaining Work"] = Convert.ToDecimal(wi["Remaining Work"]) - toBurn; dailyBurnRate1 = dailyBurnRate1 - toBurn; isDirty = true; } else { wi["Remaining Work"] = 0; dailyBurnRate1 = dailyBurnRate1 - Convert.ToDecimal(wi["Remaining Work"]); isDirty = true; } } } else { dailyBurnRate1 = 0; } if (isDirty) { if (Convert.ToDateTime(wi.Fields["System.ChangedDate"].Value).Date == simulation.Date) { wi.Fields["System.ChangedDate"].Value = Convert.ToDateTime(wi.Fields["System.ChangedDate"].Value).AddSeconds(20); } else { wi.Fields["System.ChangedDate"].Value = simulation.AddSeconds(20); } wi.Save(); } } } // Increase date by 1 to perform daily burn down by day simulation = Convert.ToDateTime(simulation).AddDays(1); } } // Get the Total effort remaining in the current sprint private static decimal QueryTaskTotalEfforRemaining(List<int> listOfWorkItems) { var unfinishedWorkInCurrentSprint = _wis.GetQueryDefinition( new Guid(QueryAndGuid.FirstOrDefault(c => c.Key == "Unfinished Work").Value)); var parameters = new Dictionary<string, object> { { "project", _selectedTeamProject.Name } }; var q = new Query(_wis, unfinishedWorkInCurrentSprint.QueryText, parameters); var results = q.RunLinkQuery(); var wis = new List<WorkItem>(); foreach (var result in results) { var _wi = _wis.GetWorkItem(result.TargetId); if (_wi.Type.Name == "Task" && listOfWorkItems.Contains(_wi.Id)) wis.Add(_wi); } return wis.Sum(r => Convert.ToDecimal(r["Remaining Work"])); }   04 – The Results If you are still reading, the results are beautiful! Image 1 – Create work item with Changed Date pre-set to historic date Image 2 – Set the CreatedDate to historic date (Same as the ChangedDate) Image 3 – Simulate of effort burn down on a task via the TFS API   Image 4 – The history of changes on the Task. So, essentially this task has burned 1 hour per day Sprint Burn Down Chart – What’s not possible? The Sprint burn down chart is calculated from the System.AuthorizedDate and not the System.ChangedDate/System.CreatedDate. So, though you can change the System.ChangedDate and System.CreatedDate to historic dates you will not be able to synthesize the sprint burn down chart. Image 1 – By changing the Created Date and Changed Date to ‘18/Oct/2012’ you would have expected the burn down to have been impacted, but it won’t be, because the sprint burn down chart uses the value of field ‘System.AuthorizedDate’ to calculate the unfinished work points. The AsOf queries that are used to calculate the unfinished work points use the value of the field ‘System.AuthorizedDate’. Image 2 – Using the above code I burned down 1 hour effort per day over 5 days from the task work item, I would have expected the sprint burn down to show a constant burn down, instead the burn down shows the effort exhausted on the 24th itself. Simply because the burn down is calculated using the ‘System.AuthorizedDate’. Now you would ask… “Can I change the value of the field System.AuthorizedDate to a historic date” Unfortunately that’s not possible! You will run into the exception ValidationException –  “TF26194: The value for field ‘Authorized Date’ cannot be changed.” Conclusion - You need to be a member of the Project Collection Service account group in order to set the fields ‘System.ChangedDate’ and ‘System.CreatedDate’ to historic dates - You need to instantiate the WorkItemStore using the flag ByPassValidation - The System.ChangedDate needs to be set to a historic date at the time of work item creation. You cannot reset the ChangedDate to a date earlier than the existing ChangedDate and you cannot reset the ChangedDate to a date greater than the current date time. - The System.CreatedDate can only be reset after a work item has been created. You cannot set the CreatedDate at the time of work item creation. The CreatedDate cannot be greater than the current date. You can however reset the CreatedDate to a date earlier than the existing value. - You will not be able to synthesize the Sprint burn down chart by changing the value of System.ChangedDate and System.CreatedDate to historic dates, since the burn down chart uses AsOf queries to calculate the unfinished work points which internally uses the System.AuthorizedDate and NOT the System.ChangedDate & System.CreatedDate - System.AuthorizedDate cannot be set to a historic date using the TFS API Read other posts on using the TFS API here… Enjoy!

    Read the article

  • War deployment error related to classloading

    - by user563564
    hello when i am deploying my war file and run it it will give error like org.springframework.instrument.classloading.tomcat.TomcatInstrumentableClassLoader Jan 6, 2011 3:16:04 PM org.apache.catalina.startup.HostConfig deployDescriptor INFO: Deploying configuration descriptor servlet.xml Jan 6, 2011 3:16:04 PM org.apache.catalina.core.StandardContext preDeregister SEVERE: error stopping LifecycleException: Pipeline has not been started at org.apache.catalina.core.StandardPipeline.stop(StandardPipeline.java:257) at org.apache.catalina.core.StandardContext.stop(StandardContext.java:4629) at org.apache.catalina.core.StandardContext.preDeregister(StandardContext.java:5370) at org.apache.tomcat.util.modeler.BaseModelMBean.preDeregister(BaseModelMBean.java:1130) at com.sun.jmx.interceptor.DefaultMBeanServerInterceptor.preDeregisterInvoke(DefaultMBeanServerInterceptor.java:1048) at com.sun.jmx.interceptor.DefaultMBeanServerInterceptor.exclusiveUnregisterMBean(DefaultMBeanServerInterceptor.java:421) at com.sun.jmx.interceptor.DefaultMBeanServerInterceptor.unregisterMBean(DefaultMBeanServerInterceptor.java:403) at com.sun.jmx.mbeanserver.JmxMBeanServer.unregisterMBean(JmxMBeanServer.java:506) at org.apache.tomcat.util.modeler.Registry.unregisterComponent(Registry.java:575) at org.apache.catalina.core.StandardContext.start(StandardContext.java:4230) at org.apache.catalina.core.ContainerBase.addChildInternal(ContainerBase.java:791) at org.apache.catalina.core.ContainerBase.addChild(ContainerBase.java:771) at org.apache.catalina.core.StandardHost.addChild(StandardHost.java:546) at org.apache.catalina.startup.HostConfig.deployDescriptor(HostConfig.java:637) at org.apache.catalina.startup.HostConfig.deployApps(HostConfig.java:521) at org.apache.catalina.startup.HostConfig.check(HostConfig.java:1359) at sun.reflect.NativeMethodAccessorImpl.invoke0(Native Method) at sun.reflect.NativeMethodAccessorImpl.invoke(NativeMethodAccessorImpl.java:39) at sun.reflect.DelegatingMethodAccessorImpl.invoke(DelegatingMethodAccessorImpl.java:25) at java.lang.reflect.Method.invoke(Method.java:597) at org.apache.tomcat.util.modeler.BaseModelMBean.invoke(BaseModelMBean.java:297) at com.sun.jmx.interceptor.DefaultMBeanServerInterceptor.invoke(DefaultMBeanServerInterceptor.java:836) at com.sun.jmx.mbeanserver.JmxMBeanServer.invoke(JmxMBeanServer.java:761) at org.apache.catalina.manager.ManagerServlet.check(ManagerServlet.java:1500) at org.apache.catalina.manager.ManagerServlet.deploy(ManagerServlet.java:849) at org.apache.catalina.manager.ManagerServlet.doGet(ManagerServlet.java:351) at javax.servlet.http.HttpServlet.service(HttpServlet.java:617) at javax.servlet.http.HttpServlet.service(HttpServlet.java:717) at org.apache.catalina.core.ApplicationFilterChain.internalDoFilter(ApplicationFilterChain.java:290) at org.apache.catalina.core.ApplicationFilterChain.doFilter(ApplicationFilterChain.java:206) at org.netbeans.modules.web.monitor.server.MonitorFilter.doFilter(MonitorFilter.java:199) at org.apache.catalina.core.ApplicationFilterChain.internalDoFilter(ApplicationFilterChain.java:235) at org.apache.catalina.core.ApplicationFilterChain.doFilter(ApplicationFilterChain.java:206) at org.apache.catalina.core.StandardWrapperValve.invoke(StandardWrapperValve.java:233) at org.apache.catalina.core.StandardContextValve.invoke(StandardContextValve.java:191) at org.apache.catalina.authenticator.AuthenticatorBase.invoke(AuthenticatorBase.java:558) at org.apache.catalina.core.StandardHostValve.invoke(StandardHostValve.java:127) at org.apache.catalina.valves.ErrorReportValve.invoke(ErrorReportValve.java:102) at org.apache.catalina.core.StandardEngineValve.invoke(StandardEngineValve.java:109) at org.apache.catalina.connector.CoyoteAdapter.service(CoyoteAdapter.java:298) at org.apache.coyote.http11.Http11AprProcessor.process(Http11AprProcessor.java:859) at org.apache.coyote.http11.Http11AprProtocol$Http11ConnectionHandler.process(Http11AprProtocol.java:579) at org.apache.tomcat.util.net.AprEndpoint$Worker.run(AprEndpoint.java:1555) at java.lang.Thread.run(Thread.java:619) Jan 6, 2011 3:16:05 PM org.apache.catalina.loader.WebappLoader start SEVERE: LifecycleException java.lang.ClassNotFoundException: org.springframework.instrument.classloading.tomcat.TomcatInstrumentableClassLoader at java.net.URLClassLoader$1.run(URLClassLoader.java:200) at java.security.AccessController.doPrivileged(Native Method) at java.net.URLClassLoader.findClass(URLClassLoader.java:188) at java.lang.ClassLoader.loadClass(ClassLoader.java:306) at java.lang.ClassLoader.loadClass(ClassLoader.java:251) at java.lang.ClassLoader.loadClassInternal(ClassLoader.java:319) at java.lang.Class.forName0(Native Method) at java.lang.Class.forName(Class.java:169) at org.apache.catalina.loader.WebappLoader.createClassLoader(WebappLoader.java:773) at org.apache.catalina.loader.WebappLoader.start(WebappLoader.java:638) at org.apache.catalina.core.StandardContext.start(StandardContext.java:4341) at org.apache.catalina.core.ContainerBase.addChildInternal(ContainerBase.java:791) at org.apache.catalina.core.ContainerBase.addChild(ContainerBase.java:771) at org.apache.catalina.core.StandardHost.addChild(StandardHost.java:546) at org.apache.catalina.startup.HostConfig.deployDescriptor(HostConfig.java:637) at org.apache.catalina.startup.HostConfig.deployApps(HostConfig.java:521) at org.apache.catalina.startup.HostConfig.check(HostConfig.java:1359) at sun.reflect.NativeMethodAccessorImpl.invoke0(Native Method) at sun.reflect.NativeMethodAccessorImpl.invoke(NativeMethodAccessorImpl.java:39) at sun.reflect.DelegatingMethodAccessorImpl.invoke(DelegatingMethodAccessorImpl.java:25) at java.lang.reflect.Method.invoke(Method.java:597) at org.apache.tomcat.util.modeler.BaseModelMBean.invoke(BaseModelMBean.java:297) at com.sun.jmx.interceptor.DefaultMBeanServerInterceptor.invoke(DefaultMBeanServerInterceptor.java:836) at com.sun.jmx.mbeanserver.JmxMBeanServer.invoke(JmxMBeanServer.java:761) at org.apache.catalina.manager.ManagerServlet.check(ManagerServlet.java:1500) at org.apache.catalina.manager.ManagerServlet.deploy(ManagerServlet.java:849) at org.apache.catalina.manager.ManagerServlet.doGet(ManagerServlet.java:351) at javax.servlet.http.HttpServlet.service(HttpServlet.java:617) at javax.servlet.http.HttpServlet.service(HttpServlet.java:717) at org.apache.catalina.core.ApplicationFilterChain.internalDoFilter(ApplicationFilterChain.java:290) at org.apache.catalina.core.ApplicationFilterChain.doFilter(ApplicationFilterChain.java:206) at org.netbeans.modules.web.monitor.server.MonitorFilter.doFilter(MonitorFilter.java:199) at org.apache.catalina.core.ApplicationFilterChain.internalDoFilter(ApplicationFilterChain.java:235) at org.apache.catalina.core.ApplicationFilterChain.doFilter(ApplicationFilterChain.java:206) at org.apache.catalina.core.StandardWrapperValve.invoke(StandardWrapperValve.java:233) at org.apache.catalina.core.StandardContextValve.invoke(StandardContextValve.java:191) at org.apache.catalina.authenticator.AuthenticatorBase.invoke(AuthenticatorBase.java:558) at org.apache.catalina.core.StandardHostValve.invoke(StandardHostValve.java:127) at org.apache.catalina.valves.ErrorReportValve.invoke(ErrorReportValve.java:102) at org.apache.catalina.core.StandardEngineValve.invoke(StandardEngineValve.java:109) at org.apache.catalina.connector.CoyoteAdapter.service(CoyoteAdapter.java:298) at org.apache.coyote.http11.Http11AprProcessor.process(Http11AprProcessor.java:859) at org.apache.coyote.http11.Http11AprProtocol$Http11ConnectionHandler.process(Http11AprProtocol.java:579) at org.apache.tomcat.util.net.AprEndpoint$Worker.run(AprEndpoint.java:1555) at java.lang.Thread.run(Thread.java:619) Jan 6, 2011 3:16:05 PM org.apache.catalina.core.ContainerBase addChildInternal SEVERE: ContainerBase.addChild: start: LifecycleException: start: : java.lang.ClassNotFoundException: org.springframework.instrument.classloading.tomcat.TomcatInstrumentableClassLoader at org.apache.catalina.loader.WebappLoader.start(WebappLoader.java:679) at org.apache.catalina.core.StandardContext.start(StandardContext.java:4341) at org.apache.catalina.core.ContainerBase.addChildInternal(ContainerBase.java:791) at org.apache.catalina.core.ContainerBase.addChild(ContainerBase.java:771) at org.apache.catalina.core.StandardHost.addChild(StandardHost.java:546) at org.apache.catalina.startup.HostConfig.deployDescriptor(HostConfig.java:637) at org.apache.catalina.startup.HostConfig.deployApps(HostConfig.java:521) at org.apache.catalina.startup.HostConfig.check(HostConfig.java:1359) at sun.reflect.NativeMethodAccessorImpl.invoke0(Native Method) at sun.reflect.NativeMethodAccessorImpl.invoke(NativeMethodAccessorImpl.java:39) at sun.reflect.DelegatingMethodAccessorImpl.invoke(DelegatingMethodAccessorImpl.java:25) at java.lang.reflect.Method.invoke(Method.java:597) at org.apache.tomcat.util.modeler.BaseModelMBean.invoke(BaseModelMBean.java:297) at com.sun.jmx.interceptor.DefaultMBeanServerInterceptor.invoke(DefaultMBeanServerInterceptor.java:836) at com.sun.jmx.mbeanserver.JmxMBeanServer.invoke(JmxMBeanServer.java:761) at org.apache.catalina.manager.ManagerServlet.check(ManagerServlet.java:1500) at org.apache.catalina.manager.ManagerServlet.deploy(ManagerServlet.java:849) at org.apache.catalina.manager.ManagerServlet.doGet(ManagerServlet.java:351) at javax.servlet.http.HttpServlet.service(HttpServlet.java:617) at javax.servlet.http.HttpServlet.service(HttpServlet.java:717) at org.apache.catalina.core.ApplicationFilterChain.internalDoFilter(ApplicationFilterChain.java:290) at org.apache.catalina.core.ApplicationFilterChain.doFilter(ApplicationFilterChain.java:206) at org.netbeans.modules.web.monitor.server.MonitorFilter.doFilter(MonitorFilter.java:199) at org.apache.catalina.core.ApplicationFilterChain.internalDoFilter(ApplicationFilterChain.java:235) at org.apache.catalina.core.ApplicationFilterChain.doFilter(ApplicationFilterChain.java:206) at org.apache.catalina.core.StandardWrapperValve.invoke(StandardWrapperValve.java:233) at org.apache.catalina.core.StandardContextValve.invoke(StandardContextValve.java:191) at org.apache.catalina.authenticator.AuthenticatorBase.invoke(AuthenticatorBase.java:558) at org.apache.catalina.core.StandardHostValve.invoke(StandardHostValve.java:127) at org.apache.catalina.valves.ErrorReportValve.invoke(ErrorReportValve.java:102) at org.apache.catalina.core.StandardEngineValve.invoke(StandardEngineValve.java:109) at org.apache.catalina.connector.CoyoteAdapter.service(CoyoteAdapter.java:298) at org.apache.coyote.http11.Http11AprProcessor.process(Http11AprProcessor.java:859) at org.apache.coyote.http11.Http11AprProtocol$Http11ConnectionHandler.process(Http11AprProtocol.java:579) at org.apache.tomcat.util.net.AprEndpoint$Worker.run(AprEndpoint.java:1555) at java.lang.Thread.run(Thread.java:619) Jan 6, 2011 3:16:05 PM org.apache.catalina.startup.HostConfig deployDescriptor SEVERE: Error deploying configuration descriptor servlet.xml java.lang.IllegalStateException: ContainerBase.addChild: start: LifecycleException: start: : java.lang.ClassNotFoundException: org.springframework.instrument.classloading.tomcat.TomcatInstrumentableClassLoader at org.apache.catalina.core.ContainerBase.addChildInternal(ContainerBase.java:795) at org.apache.catalina.core.ContainerBase.addChild(ContainerBase.java:771) at org.apache.catalina.core.StandardHost.addChild(StandardHost.java:546) at org.apache.catalina.startup.HostConfig.deployDescriptor(HostConfig.java:637) at org.apache.catalina.startup.HostConfig.deployApps(HostConfig.java:521) at org.apache.catalina.startup.HostConfig.check(HostConfig.java:1359) at sun.reflect.NativeMethodAccessorImpl.invoke0(Native Method) at sun.reflect.NativeMethodAccessorImpl.invoke(NativeMethodAccessorImpl.java:39) at sun.reflect.DelegatingMethodAccessorImpl.invoke(DelegatingMethodAccessorImpl.java:25) at java.lang.reflect.Method.invoke(Method.java:597) at org.apache.tomcat.util.modeler.BaseModelMBean.invoke(BaseModelMBean.java:297) at com.sun.jmx.interceptor.DefaultMBeanServerInterceptor.invoke(DefaultMBeanServerInterceptor.java:836) at com.sun.jmx.mbeanserver.JmxMBeanServer.invoke(JmxMBeanServer.java:761) at org.apache.catalina.manager.ManagerServlet.check(ManagerServlet.java:1500) at org.apache.catalina.manager.ManagerServlet.deploy(ManagerServlet.java:849) at org.apache.catalina.manager.ManagerServlet.doGet(ManagerServlet.java:351) at javax.servlet.http.HttpServlet.service(HttpServlet.java:617) at javax.servlet.http.HttpServlet.service(HttpServlet.java:717) at org.apache.catalina.core.ApplicationFilterChain.internalDoFilter(ApplicationFilterChain.java:290) at org.apache.catalina.core.ApplicationFilterChain.doFilter(ApplicationFilterChain.java:206) at org.netbeans.modules.web.monitor.server.MonitorFilter.doFilter(MonitorFilter.java:199) at org.apache.catalina.core.ApplicationFilterChain.internalDoFilter(ApplicationFilterChain.java:235) at org.apache.catalina.core.ApplicationFilterChain.doFilter(ApplicationFilterChain.java:206) at org.apache.catalina.core.StandardWrapperValve.invoke(StandardWrapperValve.java:233) at org.apache.catalina.core.StandardContextValve.invoke(StandardContextValve.java:191) at org.apache.catalina.authenticator.AuthenticatorBase.invoke(AuthenticatorBase.java:558) at org.apache.catalina.core.StandardHostValve.invoke(StandardHostValve.java:127) at org.apache.catalina.valves.ErrorReportValve.invoke(ErrorReportValve.java:102) at org.apache.catalina.core.StandardEngineValve.invoke(StandardEngineValve.java:109) at org.apache.catalina.connector.CoyoteAdapter.service(CoyoteAdapter.java:298) at org.apache.coyote.http11.Http11AprProcessor.process(Http11AprProcessor.java:859) at org.apache.coyote.http11.Http11AprProtocol$Http11ConnectionHandler.process(Http11AprProtocol.java:579) at org.apache.tomcat.util.net.AprEndpoint$Worker.run(AprEndpoint.java:1555) at java.lang.Thread.run(Thread.java:619) context.xml file -- <?xml version="1.0" encoding="UTF-8"?> <Context antiJARLocking="true" path="servlet"> <Loader loaderClass="org.springframework.instrument.classloading.tomcat.TomcatInstrumentableClassLoader"/> </Context> FAIL - Failed to deploy application at context path /servlet so how can i resolve it

    Read the article

  • Launching a WPF Window in a Separate Thread, Part 1

    - by Reed
    Typically, I strongly recommend keeping the user interface within an application’s main thread, and using multiple threads to move the actual “work” into background threads.  However, there are rare times when creating a separate, dedicated thread for a Window can be beneficial.  This is even acknowledged in the MSDN samples, such as the Multiple Windows, Multiple Threads sample.  However, doing this correctly is difficult.  Even the referenced MSDN sample has major flaws, and will fail horribly in certain scenarios.  To ease this, I wrote a small class that alleviates some of the difficulties involved. The MSDN Multiple Windows, Multiple Threads Sample shows how to launch a new thread with a WPF Window, and will work in most cases.  The sample code (commented and slightly modified) works out to the following: // Create a thread Thread newWindowThread = new Thread(new ThreadStart( () => { // Create and show the Window Window1 tempWindow = new Window1(); tempWindow.Show(); // Start the Dispatcher Processing System.Windows.Threading.Dispatcher.Run(); })); // Set the apartment state newWindowThread.SetApartmentState(ApartmentState.STA); // Make the thread a background thread newWindowThread.IsBackground = true; // Start the thread newWindowThread.Start(); .csharpcode, .csharpcode pre { font-size: small; color: black; font-family: consolas, "Courier New", courier, monospace; background-color: #ffffff; /*white-space: pre;*/ } .csharpcode pre { margin: 0em; } .csharpcode .rem { color: #008000; } .csharpcode .kwrd { color: #0000ff; } .csharpcode .str { color: #006080; } .csharpcode .op { color: #0000c0; } .csharpcode .preproc { color: #cc6633; } .csharpcode .asp { background-color: #ffff00; } .csharpcode .html { color: #800000; } .csharpcode .attr { color: #ff0000; } .csharpcode .alt { background-color: #f4f4f4; width: 100%; margin: 0em; } .csharpcode .lnum { color: #606060; } This sample creates a thread, marks it as single threaded apartment state, and starts the Dispatcher on that thread. That is the minimum requirements to get a Window displaying and handling messages correctly, but, unfortunately, has some serious flaws. The first issue – the created thread will run continuously until the application shuts down, given the code in the sample.  The problem is that the ThreadStart delegate used ends with running the Dispatcher.  However, nothing ever stops the Dispatcher processing.  The thread was created as a Background thread, which prevents it from keeping the application alive, but the Dispatcher will continue to pump dispatcher frames until the application shuts down. In order to fix this, we need to call Dispatcher.InvokeShutdown after the Window is closed.  This would require modifying the above sample to subscribe to the Window’s Closed event, and, at that point, shutdown the Dispatcher: // Create a thread Thread newWindowThread = new Thread(new ThreadStart( () => { Window1 tempWindow = new Window1(); // When the window closes, shut down the dispatcher tempWindow.Closed += (s,e) => Dispatcher.CurrentDispatcher.BeginInvokeShutdown(DispatcherPriority.Background); tempWindow.Show(); // Start the Dispatcher Processing System.Windows.Threading.Dispatcher.Run(); })); // Setup and start thread as before This eliminates the first issue.  Now, when the Window is closed, the new thread’s Dispatcher will shut itself down, which in turn will cause the thread to complete. The above code will work correctly for most situations.  However, there is still a potential problem which could arise depending on the content of the Window1 class.  This is particularly nasty, as the code could easily work for most windows, but fail on others. The problem is, at the point where the Window is constructed, there is no active SynchronizationContext.  This is unlikely to be a problem in most cases, but is an absolute requirement if there is code within the constructor of Window1 which relies on a context being in place. While this sounds like an edge case, it’s fairly common.  For example, if a BackgroundWorker is started within the constructor, or a TaskScheduler is built using TaskScheduler.FromCurrentSynchronizationContext() with the expectation of synchronizing work to the UI thread, an exception will be raised at some point.  Both of these classes rely on the existence of a proper context being installed to SynchronizationContext.Current, which happens automatically, but not until Dispatcher.Run is called.  In the above case, SynchronizationContext.Current will return null during the Window’s construction, which can cause exceptions to occur or unexpected behavior. Luckily, this is fairly easy to correct.  We need to do three things, in order, prior to creating our Window: Create and initialize the Dispatcher for the new thread manually Create a synchronization context for the thread which uses the Dispatcher Install the synchronization context Creating the Dispatcher is quite simple – The Dispatcher.CurrentDispatcher property gets the current thread’s Dispatcher and “creates a new Dispatcher if one is not already associated with the thread.”  Once we have the correct Dispatcher, we can create a SynchronizationContext which uses the dispatcher by creating a DispatcherSynchronizationContext.  Finally, this synchronization context can be installed as the current thread’s context via SynchronizationContext.SetSynchronizationContext.  These three steps can easily be added to the above via a single line of code: // Create a thread Thread newWindowThread = new Thread(new ThreadStart( () => { // Create our context, and install it: SynchronizationContext.SetSynchronizationContext( new DispatcherSynchronizationContext( Dispatcher.CurrentDispatcher)); Window1 tempWindow = new Window1(); // When the window closes, shut down the dispatcher tempWindow.Closed += (s,e) => Dispatcher.CurrentDispatcher.BeginInvokeShutdown(DispatcherPriority.Background); tempWindow.Show(); // Start the Dispatcher Processing System.Windows.Threading.Dispatcher.Run(); })); // Setup and start thread as before This now forces the synchronization context to be in place before the Window is created and correctly shuts down the Dispatcher when the window closes. However, there are quite a few steps.  In my next post, I’ll show how to make this operation more reusable by creating a class with a far simpler API…

    Read the article

  • Using the BAM Interceptor with Continuation

    - by Charles Young
    Originally posted on: http://geekswithblogs.net/cyoung/archive/2014/06/02/using-the-bam-interceptor-with-continuation.aspxI’ve recently been resurrecting some code written several years ago that makes extensive use of the BAM Interceptor provided as part of BizTalk Server’s BAM event observation library.  In doing this, I noticed an issue with continuations.  Essentially, whenever I tried to configure one or more continuations for an activity, the BAM Interceptor failed to complete the activity correctly.   Careful inspection of my code confirmed that I was initializing and invoking the BAM interceptor correctly, so I was mystified.  However, I eventually found the problem.  It is a logical error in the BAM Interceptor code itself. The BAM Interceptor provides a useful mechanism for implementing dynamic tracking.  It supports configurable ‘track points’.  These are grouped into named ‘locations’.  BAM uses the term ‘step’ as a synonym for ‘location’.   Each track point defines a BAM action such as starting an activity, extracting a data item, enabling a continuation, etc.  Each step defines a collection of track points. Understanding Steps The BAM Interceptor provides an abstract model for handling configuration of steps.  It doesn’t, however, define any specific configuration mechanism (e.g., config files, SSO, etc.)  It is up to the developer to decide how to store, manage and retrieve configuration data.  At run time, this configuration is used to register track points which then drive the BAM Interceptor. The full semantics of a step are not immediately clear from Microsoft’s documentation.  They represent a point in a business activity where BAM tracking occurs.  They are named locations in the code.  What is less obvious is that they always represent either the full tracking work for a given activity or a discrete fragment of that work which commences with the start of a new activity or the continuation of an existing activity.  The BAM Interceptor enforces this by throwing an error if no ‘start new’ or ‘continue’ track point is registered for a named location. This constraint implies that each step must marked with an ‘end activity’ track point.  One of the peculiarities of BAM semantics is that when an activity is continued under a correlated ID, you must first mark the current activity as ‘ended’ in order to ensure the right housekeeping is done in the database.  If you re-start an ended activity under the same ID, you will leave the BAM import tables in an inconsistent state.  A step, therefore, always represents an entire unit of work for a given activity or continuation ID.  For activities with continuation, each unit of work is termed a ‘fragment’. Instance and Fragment State Internally, the BAM Interceptor maintains state data at two levels.  First, it represents the overall state of the activity using a ‘trace instance’ token.  This token contains the name and ID of the activity together with a couple of state flags.  The second level of state represents a ‘trace fragment’.   As we have seen, a fragment of an activity corresponds directly to the notion of a ‘step’.  It is the unit of work done at a named location, and it must be bounded by start and end, or continue and end, actions. When handling continuations, the BAM Interceptor differentiates between ‘root’ fragments and other fragments.  Very simply, a root fragment represents the start of an activity.  Other fragments represent continuations.  This is where the logic breaks down.  The BAM Interceptor loses state integrity for root fragments when continuations are defined. Initialization Microsoft’s BAM Interceptor code supports the initialization of BAM Interceptors from track point configuration data.  The process starts by populating an Activity Interceptor Configuration object with an array of track points.  These can belong to different steps (aka ‘locations’) and can be registered in any order.  Once it is populated with track points, the Activity Interceptor Configuration is used to initialise the BAM Interceptor.  The BAM Interceptor sets up a hash table of array lists.  Each step is represented by an array list, and each array list contains an ordered set of track points.  The BAM Interceptor represents track points as ‘executable’ components.  When the OnStep method of the BAM Interceptor is called for a given step, the corresponding list of track points is retrieved and each track point is executed in turn.  Each track point retrieves any required data using a call back mechanism and then serializes a BAM trace fragment object representing a specific action (e.g., start, update, enable continuation, stop, etc.).  The serialised trace fragment is then handed off to a BAM event stream (buffered or direct) which takes the appropriate action. The Root of the Problem The logic breaks down in the Activity Interceptor Configuration.  Each Activity Interceptor Configuration is initialised with an instance of a ‘trace instance’ token.  This provides the basic metadata for the activity as a whole.  It contains the activity name and ID together with state flags indicating if the activity ID is a root (i.e., not a continuation fragment) and if it is completed.  This single token is then shared by all trace actions for all steps registered with the Activity Interceptor Configuration. Each trace instance token is automatically initialised to represent a root fragment.  However, if you subsequently register a ‘continuation’ step with the Activity Interceptor Configuration, the ‘root’ flag is set to false at the point the ‘continue’ track point is registered for that step.   If you use a ‘reflector’ tool to inspect the code for the ActivityInterceptorConfiguration class, you can see the flag being set in one of the overloads of the RegisterContinue method.    This makes no sense.  The trace instance token is shared across all the track points registered with the Activity Interceptor Configuration.  The Activity Interceptor Configuration is designed to hold track points for multiple steps.  The ‘root’ flag is clearly meant to be initialised to ‘true’ for the preliminary root fragment and then subsequently set to false at the point that a continuation step is processed.  Instead, if the Activity Interceptor Configuration contains a continuation step, it is changed to ‘false’ before the root fragment is processed.  This is clearly an error in logic. The problem causes havoc when the BAM Interceptor is used with continuation.  Effectively the root step is no longer processed correctly, and the ultimate effect is that the continued activity never completes!   This has nothing to do with the root and the continuation being in the same process.  It is due to a fundamental mistake of setting the ‘root’ flag to false for a continuation before the root fragment is processed. The Workaround Fortunately, it is easy to work around the bug.  The trick is to ensure that you create a new Activity Interceptor Configuration object for each individual step.  This may mean filtering your configuration data to extract the track points for a single step or grouping the configured track points into individual steps and the creating a separate Activity Interceptor Configuration for each group.  In my case, the first approach was required.  Here is what the amended code looks like: // Because of a logic error in Microsoft's code, a separate ActivityInterceptorConfiguration must be used // for each location. The following code extracts only those track points for a given step name (location). var trackPointGroup = from ResolutionService.TrackPoint tp in bamActivity.TrackPoints                       where (string)tp.Location == bamStepName                       select tp; var bamActivityInterceptorConfig =     new Microsoft.BizTalk.Bam.EventObservation.ActivityInterceptorConfiguration(activityName); foreach (var trackPoint in trackPointGroup) {     switch (trackPoint.Type)     {         case TrackPointType.Start:             bamActivityInterceptorConfig.RegisterStartNew(trackPoint.Location, trackPoint.ExtractionInfo);             break; etc… I’m using LINQ to filter a list of track points for those entries that correspond to a given step and then registering only those track points on a new instance of the ActivityInterceptorConfiguration class.   As soon as I re-wrote the code to do this, activities with continuations started to complete correctly.

    Read the article

  • Routes on a sphere surface - Find geodesic?

    - by CaNNaDaRk
    I'm working with some friends on a browser based game where people can move on a 2D map. It's been almost 7 years and still people play this game so we are thinking of a way to give them something new. Since then the game map was a limited plane and people could move from (0, 0) to (MAX_X, MAX_Y) in quantized X and Y increments (just imagine it as a big chessboard). We believe it's time to give it another dimension so, just a couple of weeks ago, we began to wonder how the game could look with other mappings: Unlimited plane with continous movement: this could be a step forward but still i'm not convinced. Toroidal World (continous or quantized movement): sincerely I worked with torus before but this time I want something more... Spherical world with continous movement: this would be great! What we want Users browsers are given a list of coordinates like (latitude, longitude) for each object on the spherical surface map; browsers must then show this in user's screen rendering them inside a web element (canvas maybe? this is not a problem). When people click on the plane we convert the (mouseX, mouseY) to (lat, lng) and send it to the server which has to compute a route between current user's position to the clicked point. What we have We began writing a Java library with many useful maths to work with Rotation Matrices, Quaternions, Euler Angles, Translations, etc. We put it all together and created a program that generates sphere points, renders them and show them to the user inside a JPanel. We managed to catch clicks and translate them to spherical coords and to provide some other useful features like view rotation, scale, translation etc. What we have now is like a little (very little indeed) engine that simulates client and server interaction. Client side shows points on the screen and catches other interactions, server side renders the view and does other calculus like interpolating the route between current position and clicked point. Where is the problem? Obviously we want to have the shortest path to interpolate between the two route points. We use quaternions to interpolate between two points on the surface of the sphere and this seemed to work fine until i noticed that we weren't getting the shortest path on the sphere surface: We though the problem was that the route is calculated as the sum of two rotations about X and Y axis. So we changed the way we calculate the destination quaternion: We get the third angle (the first is latitude, the second is longitude, the third is the rotation about the vector which points toward our current position) which we called orientation. Now that we have the "orientation" angle we rotate Z axis and then use the result vector as the rotation axis for the destination quaternion (you can see the rotation axis in grey): What we got is the correct route (you can see it lays on a great circle), but we get to this ONLY if the starting route point is at latitude, longitude (0, 0) which means the starting vector is (sphereRadius, 0, 0). With the previous version (image 1) we don't get a good result even when startin point is 0, 0, so i think we're moving towards a solution, but the procedure we follow to get this route is a little "strange" maybe? In the following image you get a view of the problem we get when starting point is not (0, 0), as you can see starting point is not the (sphereRadius, 0, 0) vector, and as you can see the destination point (which is correctly drawn!) is not on the route. The magenta point (the one which lays on the route) is the route's ending point rotated about the center of the sphere of (-startLatitude, 0, -startLongitude). This means that if i calculate a rotation matrix and apply it to every point on the route maybe i'll get the real route, but I start to think that there's a better way to do this. Maybe I should try to get the plane through the center of the sphere and the route points, intersect it with the sphere and get the geodesic? But how? Sorry for being way too verbose and maybe for incorrect English but this thing is blowing my mind! EDIT: This code version is related to the first image: public void setRouteStart(double lat, double lng) { EulerAngles tmp = new EulerAngles ( Math.toRadians(lat), 0, -Math.toRadians(lng)); //set route start Quaternion qtStart.setInertialToObject(tmp); //do other stuff like drawing start point... } public void impostaDestinazione(double lat, double lng) { EulerAngles tmp = new AngoliEulero( Math.toRadians(lat), 0, -Math.toRadians(lng)); qtEnd.setInertialToObject(tmp); //do other stuff like drawing dest point... } public V3D interpolate(double totalTime, double t) { double _t = t/totalTime; Quaternion q = Quaternion.Slerp(qtStart, qtEnd, _t); RotationMatrix.inertialQuatToIObject(q); V3D p = matInt.inertialToObject(V3D.Xaxis.scale(sphereRadius)); //other stuff, like drawing point ... return p; } //mostly taken from a book! public static Quaternion Slerp(Quaternion q0, Quaternion q1, double t) { double cosO = q0.dot(q1); double q1w = q1.w; double q1x = q1.x; double q1y = q1.y; double q1z = q1.z; if (cosO < 0.0f) { q1w = -q1w; q1x = -q1x; q1y = -q1y; q1z = -q1z; cosO = -cosO; } double sinO = Math.sqrt(1.0f - cosO*cosO); double O = Math.atan2(sinO, cosO); double oneOverSinO = 1.0f / senoOmega; k0 = Math.sin((1.0f - t) * O) * oneOverSinO; k1 = Math.sin(t * O) * oneOverSinO; // Interpolate return new Quaternion( k0*q0.w + k1*q1w, k0*q0.x + k1*q1x, k0*q0.y + k1*q1y, k0*q0.z + k1*q1z ); } A little dump of what i get (again check image 1): Route info: Sphere radius and center: 200,000, (0.0, 0.0, 0.0) Route start: lat 0,000 °, lng 0,000 ° @v: (200,000, 0,000, 0,000), |v| = 200,000 Route end: lat 30,000 °, lng 30,000 ° @v: (150,000, 86,603, 100,000), |v| = 200,000 Qt dump: (w, x, y, z), rot. angle°, (x, y, z) rot. axis Qt start: (1,000, 0,000, -0,000, 0,000); 0,000 °; (1,000, 0,000, 0,000) Qt end: (0,933, 0,067, -0,250, 0,250); 42,181 °; (0,186, -0,695, 0,695) Route start: lat 30,000 °, lng 10,000 ° @v: (170,574, 30,077, 100,000), |v| = 200,000 Route end: lat 80,000 °, lng -50,000 ° @v: (22,324, -26,604, 196,962), |v| = 200,000 Qt dump: (w, x, y, z), rot. angle°, (x, y, z) rot. axis Qt start: (0,962, 0,023, -0,258, 0,084); 31,586 °; (0,083, -0,947, 0,309) Qt end: (0,694, -0,272, -0,583, -0,324); 92,062 °; (-0,377, -0,809, -0,450)

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

< Previous Page | 237 238 239 240 241 242 243 244 245 246 247 248  | Next Page >