Search Results

Search found 6159 results on 247 pages for 'compile'.

Page 243/247 | < Previous Page | 239 240 241 242 243 244 245 246 247  | Next Page >

• I never really understood: what is CGI?

  - by claws

  CGI is a Comman Gateway Interface. As the name says, it is a "common" gateway interface for everything. It is so trivial and naive from the name. I feel that I understood this and I felt this every time I encountered this word. But frankly, I didn't. I'm still confused. I am a PHP programmer. I did lot of web development. user (client) request for page --- webserver(-embedded PHP interpreter) ---- Server side(PHP) Script --- MySQL Server. Now say my PHP Script can fetch results from MySQL Server && MATLAB Server && Some other server. So, now PHP Script is the CGI? because its interface for the between webserver & All other servers? I don't know. Sometimes they call CGI, a technology & othertimes they call CGI a program or someother server. What exactly is CGI? Whats the big deal with /cgi-bin/*.cgi? Whats up with this? I don't know what is this cgi-bin directory on the server for. I don't know why they have *.cgi extensions. Why does Perl always comes in the way. CGI & Perl (language). I also don't know whats up with these two. Almost all the time I keep hearing these two in combination "CGI & Perl". This book is another great example CGI Programming with Perl Why not "CGI Programming with PHP/JSP/ASP". I never saw such things. CGI Programming in C this confuses me a lot. in C?? Seriously?? I don't know what to say. I"m just confused. "in C"?? This changes everything. Program needs to be compiled and executed. This entirely changes my view of web programming. When do I compile? How does the program gets executed (because it will be a machine code, so it must execute as a independent process). How does it communicate with the web server? IPC? and interfacing with all the servers (in my example MATLAB & MySQL) using socket programming? I'm lost!! They say that CGI is depreciated. Its no more in use. Is it so? What is its latest update? Once, I ran into a situation where I had to give HTTP PUT request access to web server (Apache HTTPD). Its a long back. So, as far as I remember this is what I did: Edited the configuration file of Apache HTTPD to tell webserver to pass all HTTP PUT requests to some put.php ( I had to write this PHP script) Implement put.php to handle the request (save the file to the location mentioned) People said that I wrote a CGI Script. Seriously, I didn't have clue what they were talking about. Did I really write CGI Script? I hope you understood what my confusion is. (Because I myself don't know where I'm confused). I request you guys to keep your answer as simple as possible. I really can't understand any fancy technical terminology. At least not in this case. EDIT: I found this amazing tutorial "CGI Programming Is Simple!" - CGI Tutorial Which explains the concepts in simplest possible way. I've only have one complaint about this tutorial. Just to make what ever he explained complete he should have shown the C code he used for generating response for those GET / POST requests. I've also added link to this tutorial to Wikipedia's article : http://en.wikipedia.org/wiki/Common_Gateway_Interface

  Read the article

• NHibernate mapping error SQL Server 2008 Express

  - by developer

  Hi All, I tried an example from NHibernate in Action book and when I try to run the app, it throws an exception saying "Could not compile the mapping document: HelloNHibernate.Employee.hbm.xml" Below is my code, Employee.hbm.xml <?xml version="1.0" encoding="utf-8" ?> <hibernate-mapping xmlns="urn:nhibernate-mapping-2.2" auto-import="true"> <class name="HelloNHibernate.Employee, HelloNHibernate" lazy="false" table="Employee"> <id name="id" access="field"> <generator class="native"/> </id> <property name="name" access="field" column="name"/> <many-to-one access="field" name="manager" column="manager" cascade="all"/> </class> Program.cs using System; using System.Collections.Generic; using System.Linq; using System.Text; using NHibernate; using System.Reflection; using NHibernate.Cfg; namespace HelloNHibernate { class Program { static void Main(string[] args) { CreateEmployeeAndSaveToDatabase(); UpdateTobinAndAssignPierreHenriAsManager(); LoadEmployeesFromDatabase(); Console.WriteLine("Press any key to exit..."); Console.ReadKey(); } static void CreateEmployeeAndSaveToDatabase() { Employee tobin = new Employee(); tobin.name = "Tobin Harris"; using (ISession session = OpenSession()) { using (ITransaction transaction = session.BeginTransaction()) { session.Save(tobin); transaction.Commit(); } Console.WriteLine("Saved Tobin to the database"); } } static ISession OpenSession() { if (factory == null) { Configuration c = new Configuration(); c.AddAssembly(Assembly.GetCallingAssembly()); factory = c.BuildSessionFactory(); } return factory.OpenSession(); } static void LoadEmployeesFromDatabase() { using (ISession session = OpenSession()) { IQuery query = session.CreateQuery("from Employee as emp order by emp.name asc"); IList<Employee> foundEmployees = query.List<Employee>(); Console.WriteLine("\n{0} employees found:", foundEmployees.Count); foreach (Employee employee in foundEmployees) Console.WriteLine(employee.SayHello()); } } static void UpdateTobinAndAssignPierreHenriAsManager() { using (ISession session = OpenSession()) { using (ITransaction transaction = session.BeginTransaction()) { IQuery q = session.CreateQuery("from Employee where name='Tobin Harris'"); Employee tobin = q.List<Employee>()[0]; tobin.name = "Tobin David Harris"; Employee pierreHenri = new Employee(); pierreHenri.name = "Pierre Henri Kuate"; tobin.manager = pierreHenri; transaction.Commit(); Console.WriteLine("Updated Tobin and added Pierre Henri"); } } } static ISessionFactory factory; } } Employee.cs using System; using System.Collections.Generic; using System.Linq; using System.Text; namespace HelloNHibernate { class Employee { public int id; public string name; public Employee manager; public string SayHello() { return string.Format("'Hello World!', said {0}.", name); } } } App.config <?xml version="1.0" encoding="utf-8" ?> <configuration> <configSections> <section name="hibernate-configuration" type="NHibernate.Cfg.ConfigurationSectionHandler,NHibernate"/> </configSections> <hibernate-configuration xmlns="urn:nhibernate-configuration-2.2"> <session-factory> <property name="connection.provider">NHibernate.Connection.DriverConnectionProvider</property> <property name="connection.driver_class">NHibernate.Driver.SqlClientDriver</property> <property name="connection.connection_string"> Data Source=SQLEXPRESS2008;Integrated Security=True; User ID=SQL2008;Password=;initial catalog=HelloNHibernate </property> <property name="dialect">NHibernate.Dialect.MsSql2008Dialect</property> <property name="show_sql">false</property> </session-factory> </hibernate-configuration> </configuration>

  Read the article

• Compilation problems with vector<auto_ptr<> >

  - by petersohn

  Consider the following code: #include <iostream> #include <memory> #include <vector> using namespace std; struct A { int a; A(int a_):a(a_) {} }; int main() { vector<auto_ptr<A> > as; for (int i = 0; i < 10; i++) { auto_ptr<A> a(new A(i)); as.push_back(a); } for (vector<auto_ptr<A> >::iterator it = as.begin(); it != as.end(); ++it) cout << (*it)->a << endl; } When trying to compile it, I get the following obscure compiler error from g++: g++ -O0 -g3 -Wall -c -fmessage-length=0 -MMD -MP -MF"src/proba.d" -MT"src/proba.d" -o"src/proba.o" "../src/proba.cpp" /usr/include/c++/4.1.2/ext/new_allocator.h: In member function ‘void __gnu_cxx::new_allocator<_Tp>::construct(_Tp*, const _Tp&) [with _Tp = std::auto_ptr<A>]’: /usr/include/c++/4.1.2/bits/stl_vector.h:606: instantiated from ‘void std::vector<_Tp, _Alloc>::push_back(const _Tp&) [with _Tp = std::auto_ptr<A>, _Alloc = std::allocator<std::auto_ptr<A> >]’ ../src/proba.cpp:19: instantiated from here /usr/include/c++/4.1.2/ext/new_allocator.h:104: error: passing ‘const std::auto_ptr<A>’ as ‘this’ argument of ‘std::auto_ptr<_Tp>::operator std::auto_ptr_ref<_Tp1>() [with _Tp1 = A, _Tp = A]’ discards qualifiers /usr/include/c++/4.1.2/bits/vector.tcc: In member function ‘void std::vector<_Tp, _Alloc>::_M_insert_aux(__gnu_cxx::__normal_iterator<typename std::_Vector_base<_Tp, _Alloc>::_Tp_alloc_type::pointer, std::vector<_Tp, _Alloc> >, const _Tp&) [with _Tp = std::auto_ptr<A>, _Alloc = std::allocator<std::auto_ptr<A> >]’: /usr/include/c++/4.1.2/bits/stl_vector.h:610: instantiated from ‘void std::vector<_Tp, _Alloc>::push_back(const _Tp&) [with _Tp = std::auto_ptr<A>, _Alloc = std::allocator<std::auto_ptr<A> >]’ ../src/proba.cpp:19: instantiated from here /usr/include/c++/4.1.2/bits/vector.tcc:256: error: passing ‘const std::auto_ptr<A>’ as ‘this’ argument of ‘std::auto_ptr<_Tp>::operator std::auto_ptr_ref<_Tp1>() [with _Tp1 = A, _Tp = A]’ discards qualifiers /usr/include/c++/4.1.2/bits/stl_construct.h: In function ‘void std::_Construct(_T1*, const _T2&) [with _T1 = std::auto_ptr<A>, _T2 = std::auto_ptr<A>]’: /usr/include/c++/4.1.2/bits/stl_uninitialized.h:86: instantiated from ‘_ForwardIterator std::__uninitialized_copy_aux(_InputIterator, _InputIterator, _ForwardIterator, __false_type) [with _InputIterator = __gnu_cxx::__normal_iterator<std::auto_ptr<A>*, std::vector<std::auto_ptr<A>, std::allocator<std::auto_ptr<A> > > >, _ForwardIterator = __gnu_cxx::__normal_iterator<std::auto_ptr<A>*, std::vector<std::auto_ptr<A>, std::allocator<std::auto_ptr<A> > > >]’ /usr/include/c++/4.1.2/bits/stl_uninitialized.h:113: instantiated from ‘_ForwardIterator std::uninitialized_copy(_InputIterator, _InputIterator, _ForwardIterator) [with _InputIterator = __gnu_cxx::__normal_iterator<std::auto_ptr<A>*, std::vector<std::auto_ptr<A>, std::allocator<std::auto_ptr<A> > > >, _ForwardIterator = __gnu_cxx::__normal_iterator<std::auto_ptr<A>*, std::vector<std::auto_ptr<A>, std::allocator<std::auto_ptr<A> > > >]’ /usr/include/c++/4.1.2/bits/stl_uninitialized.h:254: instantiated from ‘_ForwardIterator std::__uninitialized_copy_a(_InputIterator, _InputIterator, _ForwardIterator, std::allocator<_Tp>) [with _InputIterator = __gnu_cxx::__normal_iterator<std::auto_ptr<A>*, std::vector<std::auto_ptr<A>, std::allocator<std::auto_ptr<A> > > >, _ForwardIterator = __gnu_cxx::__normal_iterator<std::auto_ptr<A>*, std::vector<std::auto_ptr<A>, std::allocator<std::auto_ptr<A> > > >, _Tp = std::auto_ptr<A>]’ /usr/include/c++/4.1.2/bits/vector.tcc:279: instantiated from ‘void std::vector<_Tp, _Alloc>::_M_insert_aux(__gnu_cxx::__normal_iterator<typename std::_Vector_base<_Tp, _Alloc>::_Tp_alloc_type::pointer, std::vector<_Tp, _Alloc> >, const _Tp&) [with _Tp = std::auto_ptr<A>, _Alloc = std::allocator<std::auto_ptr<A> >]’ /usr/include/c++/4.1.2/bits/stl_vector.h:610: instantiated from ‘void std::vector<_Tp, _Alloc>::push_back(const _Tp&) [with _Tp = std::auto_ptr<A>, _Alloc = std::allocator<std::auto_ptr<A> >]’ ../src/proba.cpp:19: instantiated from here /usr/include/c++/4.1.2/bits/stl_construct.h:81: error: passing ‘const std::auto_ptr<A>’ as ‘this’ argument of ‘std::auto_ptr<_Tp>::operator std::auto_ptr_ref<_Tp1>() [with _Tp1 = A, _Tp = A]’ discards qualifiers make: *** [src/proba.o] Error 1 It seems to me that there is some kind of problem with consts here. Does this mean that auto_ptr can't be used in vectors?

  Read the article

• How to merge two different Makefiles?

  - by martijnn2008

  I have did some reading on "Merging Makefiles", one suggest I should leave the two Makefiles separate in different folders [1]. For me this look counter intuitive, because I have the following situation: I have 3 source files (main.cpp flexibility.cpp constraints.cpp) one of them (flexibility.cpp) is making use of the COIN-OR Linear Programming library (Clp) When installing this library on my computer it makes sample Makefiles, which I have adjust the Makefile and it currently makes a good working binary. # Copyright (C) 2006 International Business Machines and others. # All Rights Reserved. # This file is distributed under the Eclipse Public License. # $Id: Makefile.in 726 2006-04-17 04:16:00Z andreasw $ ########################################################################## # You can modify this example makefile to fit for your own program. # # Usually, you only need to change the five CHANGEME entries below. # ########################################################################## # To compile other examples, either changed the following line, or # add the argument DRIVER=problem_name to make DRIVER = main # CHANGEME: This should be the name of your executable EXE = clp # CHANGEME: Here is the name of all object files corresponding to the source # code that you wrote in order to define the problem statement OBJS = $(DRIVER).o constraints.o flexibility.o # CHANGEME: Additional libraries ADDLIBS = # CHANGEME: Additional flags for compilation (e.g., include flags) ADDINCFLAGS = # CHANGEME: Directory to the sources for the (example) problem definition # files SRCDIR = . ########################################################################## # Usually, you don't have to change anything below. Note that if you # # change certain compiler options, you might have to recompile the # # COIN package. # ########################################################################## COIN_HAS_PKGCONFIG = TRUE COIN_CXX_IS_CL = #TRUE COIN_HAS_SAMPLE = TRUE COIN_HAS_NETLIB = #TRUE # C++ Compiler command CXX = g++ # C++ Compiler options CXXFLAGS = -O3 -pipe -DNDEBUG -pedantic-errors -Wparentheses -Wreturn-type -Wcast-qual -Wall -Wpointer-arith -Wwrite-strings -Wconversion -Wno-unknown-pragmas -Wno-long-long -DCLP_BUILD # additional C++ Compiler options for linking CXXLINKFLAGS = -Wl,--rpath -Wl,/home/martijn/Downloads/COIN/coin-Clp/lib # C Compiler command CC = gcc # C Compiler options CFLAGS = -O3 -pipe -DNDEBUG -pedantic-errors -Wimplicit -Wparentheses -Wsequence-point -Wreturn-type -Wcast-qual -Wall -Wno-unknown-pragmas -Wno-long-long -DCLP_BUILD # Sample data directory ifeq ($(COIN_HAS_SAMPLE), TRUE) ifeq ($(COIN_HAS_PKGCONFIG), TRUE) CXXFLAGS += -DSAMPLEDIR=\"`PKG_CONFIG_PATH=/home/martijn/Downloads/COIN/coin-Clp/lib64/pkgconfig:/home/martijn/Downloads/COIN/coin-Clp/lib/pkgconfig:/home/martijn/Downloads/COIN/coin-Clp/share/pkgconfig: pkg-config --variable=datadir coindatasample`\" CFLAGS += -DSAMPLEDIR=\"`PKG_CONFIG_PATH=/home/martijn/Downloads/COIN/coin-Clp/lib64/pkgconfig:/home/martijn/Downloads/COIN/coin-Clp/lib/pkgconfig:/home/martijn/Downloads/COIN/coin-Clp/share/pkgconfig: pkg-config --variable=datadir coindatasample`\" else CXXFLAGS += -DSAMPLEDIR=\"\" CFLAGS += -DSAMPLEDIR=\"\" endif endif # Netlib data directory ifeq ($(COIN_HAS_NETLIB), TRUE) ifeq ($(COIN_HAS_PKGCONFIG), TRUE) CXXFLAGS += -DNETLIBDIR=\"`PKG_CONFIG_PATH=/home/martijn/Downloads/COIN/coin-Clp/lib64/pkgconfig:/home/martijn/Downloads/COIN/coin-Clp/lib/pkgconfig:/home/martijn/Downloads/COIN/coin-Clp/share/pkgconfig: pkg-config --variable=datadir coindatanetlib`\" CFLAGS += -DNETLIBDIR=\"`PKG_CONFIG_PATH=/home/martijn/Downloads/COIN/coin-Clp/lib64/pkgconfig:/home/martijn/Downloads/COIN/coin-Clp/lib/pkgconfig:/home/martijn/Downloads/COIN/coin-Clp/share/pkgconfig: pkg-config --variable=datadir coindatanetlib`\" else CXXFLAGS += -DNETLIBDIR=\"\" CFLAGS += -DNETLIBDIR=\"\" endif endif # Include directories (we use the CYGPATH_W variables to allow compilation with Windows compilers) ifeq ($(COIN_HAS_PKGCONFIG), TRUE) INCL = `PKG_CONFIG_PATH=/home/martijn/Downloads/COIN/coin-Clp/lib64/pkgconfig:/home/martijn/Downloads/COIN/coin-Clp/lib/pkgconfig:/home/martijn/Downloads/COIN/coin-Clp/share/pkgconfig: pkg-config --cflags clp` else INCL = endif INCL += $(ADDINCFLAGS) # Linker flags ifeq ($(COIN_HAS_PKGCONFIG), TRUE) LIBS = `PKG_CONFIG_PATH=/home/martijn/Downloads/COIN/coin-Clp/lib64/pkgconfig:/home/martijn/Downloads/COIN/coin-Clp/lib/pkgconfig:/home/martijn/Downloads/COIN/coin-Clp/share/pkgconfig: pkg-config --libs clp` else ifeq ($(COIN_CXX_IS_CL), TRUE) LIBS = -link -libpath:`$(CYGPATH_W) /home/martijn/Downloads/COIN/coin-Clp/lib` libClp.lib else LIBS = -L/home/martijn/Downloads/COIN/coin-Clp/lib -lClp endif endif # The following is necessary under cygwin, if native compilers are used CYGPATH_W = echo # Here we list all possible generated objects or executables to delete them CLEANFILES = clp \ main.o \ flexibility.o \ constraints.o \ all: $(EXE) .SUFFIXES: .cpp .c .o .obj $(EXE): $(OBJS) bla=;\ for file in $(OBJS); do bla="$$bla `$(CYGPATH_W) $$file`"; done; \ $(CXX) $(CXXLINKFLAGS) $(CXXFLAGS) -o $@ $$bla $(LIBS) $(ADDLIBS) clean: rm -rf $(CLEANFILES) .cpp.o: $(CXX) $(CXXFLAGS) $(INCL) -c -o $@ `test -f '$<' || echo '$(SRCDIR)/'`$< .cpp.obj: $(CXX) $(CXXFLAGS) $(INCL) -c -o $@ `if test -f '$<'; then $(CYGPATH_W) '$<'; else $(CYGPATH_W) '$(SRCDIR)/$<'; fi` .c.o: $(CC) $(CFLAGS) $(INCL) -c -o $@ `test -f '$<' || echo '$(SRCDIR)/'`$< .c.obj: $(CC) $(CFLAGS) $(INCL) -c -o $@ `if test -f '$<'; then $(CYGPATH_W) '$<'; else $(CYGPATH_W) '$(SRCDIR)/$<'; fi` The other Makefile compiles a lot of code and makes use of bison and flex. This one is also made by someone else. I am able to alter this Makefile when I want to add some code. This Makefile also makes a binary. CFLAGS=-Wall LDLIBS=-LC:/GnuWin32/lib -lfl -lm LSOURCES=lex.l YSOURCES=grammar.ypp CSOURCES=debug.cpp esta_plus.cpp heap.cpp main.cpp stjn.cpp timing.cpp tmsp.cpp token.cpp chaining.cpp flexibility.cpp exceptions.cpp HSOURCES=$(CSOURCES:.cpp=.h) includes.h OBJECTS=$(LSOURCES:.l=.o) $(YSOURCES:.ypp=.tab.o) $(CSOURCES:.cpp=.o) all: solver solver: CFLAGS+=-g -O0 -DDEBUG solver: $(OBJECTS) main.o debug.o g++ $(CFLAGS) -o $@ $^ $(LDLIBS) solver.release: CFLAGS+=-O5 solver.release: $(OBJECTS) main.o g++ $(CFLAGS) -o $@ $^ $(LDLIBS) %.o: %.cpp g++ -c $(CFLAGS) -o $@ $< lex.cpp: lex.l grammar.tab.cpp grammar.tab.hpp flex -o$@ $< %.tab.cpp %.tab.hpp: %.ypp bison --verbose -d $< ifneq ($(LSOURCES),) $(LSOURCES:.l=.cpp): $(YSOURCES:.y=.tab.h) endif -include $(OBJECTS:.o=.d) clean: rm -f $(OBJECTS) $(OBJECTS:.o=.d) $(YSOURCES:.ypp=.tab.cpp) $(YSOURCES:.ypp=.tab.hpp) $(YSOURCES:.ypp=.output) $(LSOURCES:.l=.cpp) solver solver.release 2>/dev/null .PHONY: all clean debug release Both of these Makefiles are, for me, hard to understand. I don't know what they exactly do. What I want is to merge the two of them so I get only one binary. The code compiled in the second Makefile should be the result. I want to add flexibility.cpp and constraints.cpp to the second Makefile, but when I do. I get the problem following problem: flexibility.h:4:26: fatal error: ClpSimplex.hpp: No such file or directory #include "ClpSimplex.hpp" So the compiler can't find the Clp library. I also tried to copy-paste more code from the first Makefile into the second, but it still gives me that same error. Q: Can you please help me with merging the two makefiles or pointing out a more elegant way? Q: In this case is it indeed better to merge the two Makefiles? I also tried to use cmake, but I gave upon that one quickly, because I don't know much about flex and bison.

  Read the article

• regular expression to read the string between <title> and </title>

  - by user262325

  Hello every one I hope to read the contents between and in a html string. I think it should be in objective-c @"<title([\\s\\S]*)</title>" below are the codes that rewrited for regular expression //source of NSStringCategory.h #import <Foundation/Foundation.h> #import <regex.h> @interface NSStringCategory:NSObject { regex_t preg; } -(id)initWithPattern:(NSString *)pattern options:(int)options; -(void)dealloc; -(BOOL)matchesString:(NSString *)string; -(NSString *)matchedSubstringOfString:(NSString *)string; -(NSArray *)capturedSubstringsOfString:(NSString *)string; +(NSStringCategory *)regexWithPattern:(NSString *)pattern options:(int)options; +(NSStringCategory *)regexWithPattern:(NSString *)pattern; +(NSString *)null; +(void)initialize; @end @interface NSString (NSStringCategory) -(BOOL)matchedByPattern:(NSString *)pattern options:(int)options; -(BOOL)matchedByPattern:(NSString *)pattern; -(NSString *)substringMatchedByPattern:(NSString *)pattern options:(int)options; -(NSString *)substringMatchedByPattern:(NSString *)pattern; -(NSArray *)substringsCapturedByPattern:(NSString *)pattern options:(int)options; -(NSArray *)substringsCapturedByPattern:(NSString *)pattern; -(NSString *)escapedPattern; @end and .m file #import "NSStringCategory.h" static NSString *nullstring=nil; @implementation NSStringCategory -(id)initWithPattern:(NSString *)pattern options:(int)options { if(self=[super init]) { int err=regcomp(&preg,[pattern UTF8String],options|REG_EXTENDED); if(err) { char errbuf[256]; regerror(err,&preg,errbuf,sizeof(errbuf)); [NSException raise:@"CSRegexException" format:@"Could not compile regex \"%@\": %s",pattern,errbuf]; } } return self; } -(void)dealloc { regfree(&preg); [super dealloc]; } -(BOOL)matchesString:(NSString *)string { if(regexec(&preg,[string UTF8String],0,NULL,0)==0) return YES; return NO; } -(NSString *)matchedSubstringOfString:(NSString *)string { const char *cstr=[string UTF8String]; regmatch_t match; if(regexec(&preg,cstr,1,&match,0)==0) { return [[[NSString alloc] initWithBytes:cstr+match.rm_so length:match.rm_eo-match.rm_so encoding:NSUTF8StringEncoding] autorelease]; } return nil; } -(NSArray *)capturedSubstringsOfString:(NSString *)string { const char *cstr=[string UTF8String]; int num=preg.re_nsub+1; regmatch_t *matches=calloc(sizeof(regmatch_t),num); if(regexec(&preg,cstr,num,matches,0)==0) { NSMutableArray *array=[NSMutableArray arrayWithCapacity:num]; int i; for(i=0;i<num;i++) { NSString *str; if(matches[i].rm_so==-1&&matches[i].rm_eo==-1) str=nullstring; else str=[[[NSString alloc] initWithBytes:cstr+matches[i].rm_so length:matches[i].rm_eo-matches[i].rm_so encoding:NSUTF8StringEncoding] autorelease]; [array addObject:str]; } free(matches); return [NSArray arrayWithArray:array]; } free(matches); return nil; } +(NSStringCategory *)regexWithPattern:(NSString *)pattern options:(int)options { return [[[NSStringCategory alloc] initWithPattern:pattern options:options] autorelease]; } +(NSStringCategory *)regexWithPattern:(NSString *)pattern { return [[[NSStringCategory alloc] initWithPattern:pattern options:0] autorelease]; } +(NSString *)null { return nullstring; } +(void)initialize { if(!nullstring) nullstring=[[NSString alloc] initWithString:@""]; } @end @implementation NSString (NSStringCategory) -(BOOL)matchedByPattern:(NSString *)pattern options:(int)options { NSStringCategory *re=[NSStringCategory regexWithPattern:pattern options:options|REG_NOSUB]; return [re matchesString:self]; } -(BOOL)matchedByPattern:(NSString *)pattern { return [self matchedByPattern:pattern options:0]; } -(NSString *)substringMatchedByPattern:(NSString *)pattern options:(int)options { NSStringCategory *re=[NSStringCategory regexWithPattern:pattern options:options]; return [re matchedSubstringOfString:self]; } -(NSString *)substringMatchedByPattern:(NSString *)pattern { return [self substringMatchedByPattern:pattern options:0]; } -(NSArray *)substringsCapturedByPattern:(NSString *)pattern options:(int)options { NSStringCategory *re=[NSStringCategory regexWithPattern:pattern options:options]; return [re capturedSubstringsOfString:self]; } -(NSArray *)substringsCapturedByPattern:(NSString *)pattern { return [self substringsCapturedByPattern:pattern options:0]; } -(NSString *)escapedPattern { int len=[self length]; NSMutableString *escaped=[NSMutableString stringWithCapacity:len]; for(int i=0;i<len;i++) { unichar c=[self characterAtIndex:i]; if(c=='^'||c=='.'||c=='['||c=='$'||c=='('||c==')' ||c=='|'||c=='*'||c=='+'||c=='?'||c=='{'||c=='\\') [escaped appendFormat:@"\\%C",c]; else [escaped appendFormat:@"%C",c]; } return [NSString stringWithString:escaped]; } @end I use the codes below to get the string between "" and "" NSStringCategory *a=[[NSStringCategory alloc] initWithPattern:@"<title([\s\S]*)</title>" options:0];// Unfortunately [a matchedSubstringOfString:response]] always returns nil I do not if the regular expression is wrong or any other reason. Welcome any comment Thanks interdev

  Read the article

• Compilng problems with vector<auto_ptr<> >

  - by petersohn

  Consider the following code: #include <iostream> #include <memory> #include <vector> using namespace std; struct A { int a; A(int a_):a(a_) {} }; int main() { vector<auto_ptr<A> > as; for (int i = 0; i < 10; i++) { auto_ptr<A> a(new A(i)); as.push_back(a); } for (vector<auto_ptr<A> >::iterator it = as.begin(); it != as.end(); ++it) cout << (*it)->a << endl; } When trying to compile it, I get the following obscure compiler error from g++: g++ -O0 -g3 -Wall -c -fmessage-length=0 -MMD -MP -MF"src/proba.d" -MT"src/proba.d" -o"src/proba.o" "../src/proba.cpp" /usr/include/c++/4.1.2/ext/new_allocator.h: In member function ‘void __gnu_cxx::new_allocator<_Tp>::construct(_Tp*, const _Tp&) [with _Tp = std::auto_ptr<A>]’: /usr/include/c++/4.1.2/bits/stl_vector.h:606: instantiated from ‘void std::vector<_Tp, _Alloc>::push_back(const _Tp&) [with _Tp = std::auto_ptr<A>, _Alloc = std::allocator<std::auto_ptr<A> >]’ ../src/proba.cpp:19: instantiated from here /usr/include/c++/4.1.2/ext/new_allocator.h:104: error: passing ‘const std::auto_ptr<A>’ as ‘this’ argument of ‘std::auto_ptr<_Tp>::operator std::auto_ptr_ref<_Tp1>() [with _Tp1 = A, _Tp = A]’ discards qualifiers /usr/include/c++/4.1.2/bits/vector.tcc: In member function ‘void std::vector<_Tp, _Alloc>::_M_insert_aux(__gnu_cxx::__normal_iterator<typename std::_Vector_base<_Tp, _Alloc>::_Tp_alloc_type::pointer, std::vector<_Tp, _Alloc> >, const _Tp&) [with _Tp = std::auto_ptr<A>, _Alloc = std::allocator<std::auto_ptr<A> >]’: /usr/include/c++/4.1.2/bits/stl_vector.h:610: instantiated from ‘void std::vector<_Tp, _Alloc>::push_back(const _Tp&) [with _Tp = std::auto_ptr<A>, _Alloc = std::allocator<std::auto_ptr<A> >]’ ../src/proba.cpp:19: instantiated from here /usr/include/c++/4.1.2/bits/vector.tcc:256: error: passing ‘const std::auto_ptr<A>’ as ‘this’ argument of ‘std::auto_ptr<_Tp>::operator std::auto_ptr_ref<_Tp1>() [with _Tp1 = A, _Tp = A]’ discards qualifiers /usr/include/c++/4.1.2/bits/stl_construct.h: In function ‘void std::_Construct(_T1*, const _T2&) [with _T1 = std::auto_ptr<A>, _T2 = std::auto_ptr<A>]’: /usr/include/c++/4.1.2/bits/stl_uninitialized.h:86: instantiated from ‘_ForwardIterator std::__uninitialized_copy_aux(_InputIterator, _InputIterator, _ForwardIterator, __false_type) [with _InputIterator = __gnu_cxx::__normal_iterator<std::auto_ptr<A>*, std::vector<std::auto_ptr<A>, std::allocator<std::auto_ptr<A> > > >, _ForwardIterator = __gnu_cxx::__normal_iterator<std::auto_ptr<A>*, std::vector<std::auto_ptr<A>, std::allocator<std::auto_ptr<A> > > >]’ /usr/include/c++/4.1.2/bits/stl_uninitialized.h:113: instantiated from ‘_ForwardIterator std::uninitialized_copy(_InputIterator, _InputIterator, _ForwardIterator) [with _InputIterator = __gnu_cxx::__normal_iterator<std::auto_ptr<A>*, std::vector<std::auto_ptr<A>, std::allocator<std::auto_ptr<A> > > >, _ForwardIterator = __gnu_cxx::__normal_iterator<std::auto_ptr<A>*, std::vector<std::auto_ptr<A>, std::allocator<std::auto_ptr<A> > > >]’ /usr/include/c++/4.1.2/bits/stl_uninitialized.h:254: instantiated from ‘_ForwardIterator std::__uninitialized_copy_a(_InputIterator, _InputIterator, _ForwardIterator, std::allocator<_Tp>) [with _InputIterator = __gnu_cxx::__normal_iterator<std::auto_ptr<A>*, std::vector<std::auto_ptr<A>, std::allocator<std::auto_ptr<A> > > >, _ForwardIterator = __gnu_cxx::__normal_iterator<std::auto_ptr<A>*, std::vector<std::auto_ptr<A>, std::allocator<std::auto_ptr<A> > > >, _Tp = std::auto_ptr<A>]’ /usr/include/c++/4.1.2/bits/vector.tcc:279: instantiated from ‘void std::vector<_Tp, _Alloc>::_M_insert_aux(__gnu_cxx::__normal_iterator<typename std::_Vector_base<_Tp, _Alloc>::_Tp_alloc_type::pointer, std::vector<_Tp, _Alloc> >, const _Tp&) [with _Tp = std::auto_ptr<A>, _Alloc = std::allocator<std::auto_ptr<A> >]’ /usr/include/c++/4.1.2/bits/stl_vector.h:610: instantiated from ‘void std::vector<_Tp, _Alloc>::push_back(const _Tp&) [with _Tp = std::auto_ptr<A>, _Alloc = std::allocator<std::auto_ptr<A> >]’ ../src/proba.cpp:19: instantiated from here /usr/include/c++/4.1.2/bits/stl_construct.h:81: error: passing ‘const std::auto_ptr<A>’ as ‘this’ argument of ‘std::auto_ptr<_Tp>::operator std::auto_ptr_ref<_Tp1>() [with _Tp1 = A, _Tp = A]’ discards qualifiers make: *** [src/proba.o] Error 1 It seems to me that there is some kind of problem with consts here. Does this mean that auto_ptr can't be used in vectors?

  Read the article

• XmlSerializer throws exception when serializing dynamically loaded type

  - by Dr. Sbaitso

  Hi I'm trying to use the System.Xml.Serialization.XmlSerializer to serialize a dynamically loaded (and compiled class). If I build the class in question into the main assembly, everything works as expected. But if I compile and load the class from an dynamically loaded assembly, the XmlSerializer throws an exception. What am I doing wrong? I've created the following .NET 3.5 C# application to reproduce the issue: using System; using System.Collections.Generic; using System.Xml.Serialization; using System.Text; using System.Reflection; using System.CodeDom.Compiler; using Microsoft.CSharp; public class StaticallyBuiltClass { public class Item { public string Name { get; set; } public int Value { get; set; } } private List<Item> values = new List<Item>(); public List<Item> Values { get { return values; } set { values = value; } } } static class Program { static void Main() { RunStaticTest(); RunDynamicTest(); } static void RunStaticTest() { Console.WriteLine("-------------------------------------"); Console.WriteLine(" Serializing StaticallyBuiltClass..."); Console.WriteLine("-------------------------------------"); var stat = new StaticallyBuiltClass(); Serialize(stat.GetType(), stat); Console.WriteLine(); } static void RunDynamicTest() { Console.WriteLine("-------------------------------------"); Console.WriteLine(" Serializing DynamicallyBuiltClass..."); Console.WriteLine("-------------------------------------"); CSharpCodeProvider csProvider = new CSharpCodeProvider(new Dictionary<string, string> { { "CompilerVersion", "v3.5" } }); CompilerParameters csParams = new System.CodeDom.Compiler.CompilerParameters(); csParams.GenerateInMemory = true; csParams.GenerateExecutable = false; csParams.ReferencedAssemblies.Add("System.dll"); csParams.CompilerOptions = "/target:library"; StringBuilder classDef = new StringBuilder(); classDef.AppendLine("using System;"); classDef.AppendLine("using System.Collections.Generic;"); classDef.AppendLine(""); classDef.AppendLine("public class DynamicallyBuiltClass"); classDef.AppendLine("{"); classDef.AppendLine(" public class Item"); classDef.AppendLine(" {"); classDef.AppendLine(" public string Name { get; set; }"); classDef.AppendLine(" public int Value { get; set; }"); classDef.AppendLine(" }"); classDef.AppendLine(" private List<Item> values = new List<Item>();"); classDef.AppendLine(" public List<Item> Values { get { return values; } set { values = value; } }"); classDef.AppendLine("}"); CompilerResults res = csProvider.CompileAssemblyFromSource(csParams, new string[] { classDef.ToString() }); foreach (var line in res.Output) { Console.WriteLine(line); } Assembly asm = res.CompiledAssembly; if (asm != null) { Type t = asm.GetType("DynamicallyBuiltClass"); object o = t.InvokeMember("", BindingFlags.CreateInstance, null, null, null); Serialize(t, o); } Console.WriteLine(); } static void Serialize(Type type, object o) { var serializer = new XmlSerializer(type); try { serializer.Serialize(Console.Out, o); } catch(Exception ex) { Console.WriteLine("Exception caught while serializing " + type.ToString()); Exception e = ex; while (e != null) { Console.WriteLine(e.Message); e = e.InnerException; Console.Write("Inner: "); } Console.WriteLine("null"); Console.WriteLine(); Console.WriteLine("Stack trace:"); Console.WriteLine(ex.StackTrace); } } } which generates the following output: ------------------------------------- Serializing StaticallyBuiltClass... ------------------------------------- <?xml version="1.0" encoding="IBM437"?> <StaticallyBuiltClass xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xmlns:xsd="http://www.w3.org/2001/XMLSchema"> <Values /> </StaticallyBuiltClass> ------------------------------------- Serializing DynamicallyBuiltClass... ------------------------------------- Exception caught while serializing DynamicallyBuiltClass There was an error generating the XML document. Inner: The type initializer for 'Microsoft.Xml.Serialization.GeneratedAssembly.XmlSerializationWriterDynamicallyBuiltClass' threw an exception. Inner: Object reference not set to an instance of an object. Inner: null Stack trace: at System.Xml.Serialization.XmlSerializer.Serialize(XmlWriter xmlWriter, Object o, XmlSerializerNamespaces namespaces, String encodingStyle, String id) at System.Xml.Serialization.XmlSerializer.Serialize(TextWriter textWriter, Object o, XmlSerializerNamespaces namespaces) at System.Xml.Serialization.XmlSerializer.Serialize(TextWriter textWriter, Object o) at Program.Serialize(Type type, Object o) in c:\dev\SerTest\SerTest\Program.cs:line 100 Edit: Removed some extraneous referenced assemblies

  Read the article

• Java MVC - How to divide a done text game into MVC?

  - by Zopyrus

  Been sitting here for hours now trying to figure this out, so a bit sympathy for this large question. :) The Goal: I simply want to divide my done code into MVC (Model View Controller) parts. I have the game logics done and text based - the code works fine. The Problem: Well, I want to implement this code into MVC, but where do explain for the MODEL that it should use text-based? Because the VIEW is only for the layout (graphically) correct? I am having a REALLY hard time figuring out where to begin at all. Any pointers would be so nice! Here is my game logics code: import mind.*; import javax.swing.*; import java.util.*; import java.lang.*; import java.awt.*; public class Drive { String[] mellan; boolean gameEnd, checkempty, checkempty2, enemy, enemy2; String gr,rd,tom; int digits; public Drive() { // Gamepieces in textform gr="G"; rd="R"; tom=" "; mellan = new String[7]; String[] begin = {gr,gr,gr,tom,rd,rd,rd}; String[] end = {rd,rd,rd,tom,gr,gr,gr}; //input Scanner in = new Scanner(System.in); mellan=begin; gameEnd=false; while (gameEnd == false) { for(int i=0; i<mellan.length; i++) { System.out.print(mellan[i]); } System.out.print(" Choose 0-6: "); digits = in.nextInt(); move(); checkWin(); } } void move() { //BOOLEAN for gameruls!!! checkempty = digits<6 && mellan[digits+1]==tom; checkempty2 = digits>0 && mellan[digits-1]==tom; enemy = (mellan[digits]==gr && mellan[digits+1]==rd && mellan[digits+2]==tom); enemy2 = (mellan[digits]==rd && mellan[digits-1]==gr && mellan[digits-2]==tom); if(checkempty) { mellan[digits+1]=mellan[digits]; mellan[digits]=tom; } else if (checkempty2) { mellan[digits-1]=mellan[digits]; mellan[digits]=tom; } else if (enemy) { mellan[digits+2]=mellan[digits]; mellan[digits]=tom; } else if (enemy2) { mellan[digits-2]=mellan[digits]; mellan[digits]=tom; } } void checkWin() { String[] end = {rd,rd,rd,tom,gr,gr,gr}; for (int i=0; i<mellan.length; i++){ } if (Arrays.equals(mellan,end)) { for (int j=0; j<mellan.length; j++) { System.out.print(mellan[j]); } displayWin(); } } void displayWin() { gameEnd = true; System.out.println("\nNicely Done!"); return; } // Kör Drive! public static void main(String args[]) { new Drive(); } } Here is how I defined my DriveView thus far: (just trying to make one button to work) import mind.*; import javax.swing.*; import java.util.*; import java.lang.*; import java.awt.*; import java.awt.event.*; public class DriveView extends JFrame { JButton ruta1 = new JButton("Green"); JButton ruta2 = new JButton("Green"); JButton rutatom = new JButton(""); JButton ruta6 = new JButton("Red"); private DriveModel m_model; public DriveView(DriveModel model) { m_model = model; //Layout for View JPanel myPanel = new JPanel(); myPanel.setLayout(new FlowLayout()); myPanel.add(ruta1); myPanel.add(ruta2); myPanel.add(rutatom); myPanel.add(ruta6); this.setContentPane(myPanel); this.pack(); this.setTitle("Drive"); this.setDefaultCloseOperation(JFrame.EXIT_ON_CLOSE); } void addMouseListener(ActionListener mol) { ruta2.addActionListener(mol); } } And DriveController which gives me error at compile import mind.*; import java.awt.*; import java.awt.event.*; import javax.swing.*; import java.lang.*; public class DriveController { private DriveModel m_model; private DriveView m_view; public DriveController(DriveModel model, DriveView view) { m_model = model; m_view = view; view.addMouseListener(new MouseListener()); } class MouseListener implements ActionListener { public void actionPerformed(ActionEvent e) { String mening; mening = e.getActionCommand(); if (mening.equals("Green")) { setForeground(Color.red); } } } }

  Read the article

• Custom View embed in Gallery crashes while key press

  - by tao

  Hi there, I'd like to find some stuff to replace the Tab component, so I'd make a custom View named StringView, which has the ability to display text, and to embed it into a Gallery. But it always crashes with error "NullPointerException at InputMethodManager". I have no idea about this, any help&tip&suggest are appreciate. Detail of my issue: First I'd created a class StringView extends View: public class StringView extends View { protected final Paint mPaint = new Paint(Paint.ANTI_ALIAS_FLAG); protected String mString; protected int mAscent; // Constructor public StringView(Context context, String string) { super(context); mPaint.setARGB(255, 255, 60, 10); mPaint.setTextSize(30); //mPaint.setFakeBoldText(true); mString = string; setPadding(20,15,20,15); } @Override protected void onDraw(Canvas canvas) { super.onDraw(canvas); int w = this.getPaddingLeft(); int h = this.getPaddingTop() - mAscent; canvas.drawText(mString, w, h, mPaint); } public void setString(String str) { mString = str; this.requestLayout(); this.invalidate(); } public String getString() { return mString; } @Override protected void onMeasure(int widthMeasureSpec, int heightMeasureSpec) { setMeasuredDimension(measureWidth(widthMeasureSpec), measureHeight(heightMeasureSpec)); } /** * Determines the width of this view * @param measureSpec A measureSpec packed into an int * @return The width of the view, honoring constraints from measureSpec */ private int measureWidth(int measureSpec) { int result = 0; int specMode = MeasureSpec.getMode(measureSpec); int specSize = MeasureSpec.getSize(measureSpec); if (specMode == MeasureSpec.EXACTLY) { // We were told how big to be result = specSize; } else { // Measure the text result = (int) mPaint.measureText(mString) + getPaddingLeft() + getPaddingRight(); if (specMode == MeasureSpec.AT_MOST) { // Respect AT_MOST value if that was what is called for by measureSpec result = Math.min(result, specSize); } } return result; } /** * Determines the height of this view * @param measureSpec A measureSpec packed into an int * @return The height of the view, honoring constraints from measureSpec */ private int measureHeight(int measureSpec) { int result = 0; int specMode = MeasureSpec.getMode(measureSpec); int specSize = MeasureSpec.getSize(measureSpec); mAscent = (int) mPaint.ascent(); if (specMode == MeasureSpec.EXACTLY) { // We were told how big to be result = specSize; } else { // Measure the text (beware: ascent is a negative number) result = (int) (-mAscent + mPaint.descent()) + getPaddingTop() + getPaddingBottom(); if (specMode == MeasureSpec.AT_MOST) { // Respect AT_MOST value if that was what is called for by measureSpec result = Math.min(result, specSize); } } return result; } } Second I put it in to Gallery through Adapter Gallery gallery = (Gallery) findViewById(R.id.gallery); gallery.setAdapter(new ImageAdapter(this)); ImageAdapter: public class ImageAdapter extends BaseAdapter { int mGalleryItemBackground; private Context mContext; private View[] mImages = genSerielImageViews(); public ImageAdapter(Context c) { mContext = c; TypedArray a = obtainStyledAttributes(R.styleable.Gallery); mGalleryItemBackground = a.getResourceId( R.styleable.Gallery_android_galleryItemBackground, 0); a.recycle(); } private View[] genSerielImageViews() { if (true) { int N = 6; StringView[] views = new StringView[N]; for (int i=0; i<N; i++) { views[i] = new StringView(mContext, "ITEM #" + Integer.toString(i) ); } return views; } else { int N = 6; TextView[] views = new TextView[N]; for (int i=0; i<N; i++) { views[i] = new TextView( mContext ); views[i].setText("CCTV #" + Integer.toString(i) ); } return views; } } public int getCount() { return mImages.length; } public Object getItem(int position) { return position; } public long getItemId(int position) { return position; } public View getView(int position, View convertView, ViewGroup parent) { return mImages[position]; } } Then Compile&Run, press keypad RIGHT and I got a crash, It's turns out a weird InputMethodManager error: 03-18 07:22:33.568: ERROR/AndroidRuntime(958): Uncaught handler: thread main exiting due to uncaught exception 03-18 07:22:33.648: ERROR/AndroidRuntime(958): java.lang.NullPointerException 03-18 07:22:33.648: ERROR/AndroidRuntime(958): at android.view.inputmethod.InputMethodManager.startInputInner(InputMethodManager.java:940) 03-18 07:22:33.648: ERROR/AndroidRuntime(958): at android.view.inputmethod.InputMethodManager.checkFocus(InputMethodManager.java:1114) 03-18 07:22:33.648: ERROR/AndroidRuntime(958): at android.view.ViewRoot.handleMessage(ViewRoot.java:1869) 03-18 07:22:33.648: ERROR/AndroidRuntime(958): at android.os.Handler.dispatchMessage(Handler.java:99) 03-18 07:22:33.648: ERROR/AndroidRuntime(958): at android.os.Looper.loop(Looper.java:123) 03-18 07:22:33.648: ERROR/AndroidRuntime(958): at android.app.ActivityThread.main(ActivityThread.java:4310) 03-18 07:22:33.648: ERROR/AndroidRuntime(958): at java.lang.reflect.Method.invokeNative(Native Method) 03-18 07:22:33.648: ERROR/AndroidRuntime(958): at java.lang.reflect.Method.invoke(Method.java:521) 03-18 07:22:33.648: ERROR/AndroidRuntime(958): at com.android.internal.os.ZygoteInit$MethodAndArgsCaller.run(ZygoteInit.java:860) 03-18 07:22:33.648: ERROR/AndroidRuntime(958): at com.android.internal.os.ZygoteInit.main(ZygoteInit.java:618) 03-18 07:22:33.648: ERROR/AndroidRuntime(958): at dalvik.system.NativeStart.main(Native Method) Thanks.

  Read the article

• C# Generic Arrays and math operations on it

  - by msedi

  Hello, I'm currently involved in a project where I have very large image volumes. This volumes have to processed very fast (adding, subtracting, thresholding, and so on). Additionally most of the volume are so large that they event don't fit into the memory of the system. For that reason I have created an abstract volume class (VoxelVolume) that host the volume and image data and overloads the operators so that it's possible to perform the regular mathematical operations on volumes. Thereby two more questions opened up which I will put into stackoverflow into two additional threads. Here is my first question. My volume is implemented in a way that it only can contain float array data, but most of the containing data is from an UInt16 image source. Only operations on the volume can create float array images. When I started implementing such a volume the class looked like following: public abstract class VoxelVolume<T> { ... } but then I realized that overloading the operators or return values would get more complicated. An example would be: public abstract class VoxelVolume<T> { ... public static VoxelVolume<T> Import<T>(param string[] files) { } } also adding two overloading operators would be more complicated: ... public static VoxelVolume<T> operator+(VoxelVolume<T> A, VoxelVolume<T> B) { ... } Let's assume I can overcome the problems described above, nevertheless I have different types of arrays that contain the image data. Since I have fixed my type in the volumes to float the is no problem and I can do an unsafe operation when adding the contents of two image volume arrays. I have read a few threads here and had a look around the web, but found no real good explanation of what to do when I want to add two arrays of different types in a fast way. Unfortunately every math operation on generics is not possible, since C# is not able to calculate the size of the underlying data type. Of course there might by a way around this problem by using C++/CLR, but currently everything I have done so far, runs in 32bit and 64bit without having to do a thing. Switching to C++/CLR seemed to me (pleased correct me if I'm wrong) that I'm bound to a certain platform (32bit) and I have to compile two assemblies when I let the application run on another platform (64bit). Is this true? So asked shortly: How is it possible to add two arrays of two different types in a fast way. Is it true that the developers of C# haven't thought about this. Switching to a different language (C# - C++) seems not to be an option. I realize that simply performing this operation float []A = new float[]{1,2,3}; byte []B = new byte[]{1,2,3}; float []C = A+B; is not possible and unnecessary although it would be nice if it would work. My solution I was trying was following: public static class ArrayExt { public static unsafe TResult[] Add<T1, T2, TResult>(T1 []A, T2 []B) { // Assume the length of both arrays is equal TResult[] result = new TResult[A.Length]; GCHandle h1 = GCHandle.Alloc (A, Pinned); GCHandle h2 = GCHandle.Alloc (B, Pinned); GCHandle hR = GCHandle.Alloc (C, Pinned); void *ptrA = h1.ToPointer(); void *ptrB = h2.ToPointer(); void *ptrR = hR.ToPointer(); for (int i=0; i<A.Length; i++) { *((TResult *)ptrR) = (TResult *)((T1)*ptrA + (T2)*ptrB)); } h1.Free(); h2.Free(); hR.Free(); return result; } } Please excuse if the code above is not quite correct, I wrote it without using an C# editor. Is such a solution a shown above thinkable? Please feel free to ask if I made a mistake or described some things incompletely. Thanks for your help Martin

  Read the article

• Why does calling IEnumerable<string>.Count() create an additional assembly dependency ?

  - by Gishu

  Assume this chain of dll references Tests.dll >> Automation.dll >> White.Core.dll with the following line of code in Tests.dll, where everything builds result.MissingPaths Now when I change this to result.MissingPaths.Count() I get the following build error for Tests.dll "White.UIItem is not defined in an assembly that is not referenced. You must add a reference to White.Core.dll." And I don't want to do that because it breaks my layering. Here is the type definition for result, which is in Automation.dll public class HasResult { public HasResult(IEnumerable<string> missingPaths ) { MissingPaths = missingPaths; } public IEnumerable<string> MissingPaths { get; set; } public bool AllExist { get { return !MissingPaths.Any(); } } } Down the call chain the input param to this ctor is created via (The TreeNode class is in White.Core.dll) assetPaths.Where(assetPath => !FindTreeNodeUsingCache(treeHandle, assetPath)); Why does this dependency leak when calling Count() on IEnumerable ? I then suspected that lazy evaluation was causing this (for some reason) - so I slotted in an ToArray() in the above line but didn't work. Update 2011 01 07: Curiouser and Curiouser! it won't build until I add a White.Core reference. So I add a reference and build it (in order to find the elusive dependency source). Open it up in Reflector and the only references listed are Automation, mscorlib, System.core and NUnit. So the compiler threw away the White reference as it was not needed. ILDASM also confirms that there is no White AssemblyRef entry. Any ideas on how to get to the bottom of this thing (primarily for 'now I wanna know why' reasons)? What are the chances that this is an VS2010/MSBuild bug? Update 2011 01 07 #2 As per Shimmy's suggestion, tried calling the method explcitly as an extension method Enumerable.Count(result.MissingPaths) and it stops cribbing (not sure why). However I moved some code around after that and now I'm getting the same issue at a different location using IEnumerable - this time reading and filtering lines out of a file on disk (totally unrelated to White). Seems like it's a 'symptom-fix'. var lines = File.ReadLines(aFilePath).ToArray(); once again, if I remove the ToArray() it compiles again - it seems that any method that causes the enumerable to be evaluated (ToArray, Count, ToList, etc.) causes this. Let me try and get a working tiny-app to demo this issue... Update 2011 01 07 #3 Phew! More information.. It turns out the problem is just in one source file - this file is LINQ-phobic. Any call to an Enumerable extension method has to be explicitly called out. The refactorings that I did caused a new method to be moved into this source file, which had some LINQ :) Still no clue as to why this class dislikes LINQ. using System; using System.Collections.Generic; using System.IO; using System.Linq; using G.S.OurAutomation.Constants; using G.S.OurAutomation.Framework; using NUnit.Framework; namespace G.S.AcceptanceTests { public abstract class ConfigureThingBase : OurTestFixture { .... private static IEnumerable<string> GetExpectedThingsFor(string param) { // even this won't compile - although it compiles fine in an adjoining source file in the same assembly //IEnumerable<string> s = new string[0]; //Console.WriteLine(s.Count()); // this is the line that is now causing a build failure // var expectedInfo = File.ReadLines(someCsvFilePath)) // .Where(line => !line.StartsWith("REM", StringComparison.InvariantCultureIgnoreCase)) // .Select(line => line.Replace("%PLACEHOLDER%", param)) // .ToArray(); // Unrolling the LINQ above removes the build error var expectedInfo = Enumerable.ToArray( Enumerable.Select( Enumerable.Where( File.ReadLines(someCsvFilePath)), line => !line.StartsWith("REM", StringComparison.InvariantCultureIgnoreCase)), line => line.Replace("%PLACEHOLDER%", param)));

  Read the article

• Making swap faster, easier to use and exception-safe

  - by FredOverflow

  I could not sleep last night and started thinking about std::swap. Here is the familiar C++98 version: template <typename T> void swap(T& a, T& b) { T c(a); a = b; b = c; } If a user-defined class Foo uses external ressources, this is inefficient. The common idiom is to provide a method void Foo::swap(Foo& other) and a specialization of std::swap<Foo>. Note that this does not work with class templates since you cannot partially specialize a function template, and overloading names in the std namespace is illegal. The solution is to write a template function in one's own namespace and rely on argument dependent lookup to find it. This depends critically on the client to follow the "using std::swap idiom" instead of calling std::swap directly. Very brittle. In C++0x, if Foo has a user-defined move constructor and a move assignment operator, providing a custom swap method and a std::swap<Foo> specialization has little to no performance benefit, because the C++0x version of std::swap uses efficient moves instead of copies: #include <utility> template <typename T> void swap(T& a, T& b) { T c(std::move(a)); a = std::move(b); b = std::move(c); } Not having to fiddle with swap anymore already takes a lot of burden away from the programmer. Current compilers do not generate move constructors and move assignment operators automatically yet, but as far as I know, this will change. The only problem left then is exception-safety, because in general, move operations are allowed to throw, and this opens up a whole can of worms. The question "What exactly is the state of a moved-from object?" complicates things further. Then I was thinking, what exactly are the semantics of std::swap in C++0x if everything goes fine? What is the state of the objects before and after the swap? Typically, swapping via move operations does not touch external resources, only the "flat" object representations themselves. So why not simply write a swap template that does exactly that: swap the object representations? #include <cstring> template <typename T> void swap(T& a, T& b) { unsigned char c[sizeof(T)]; memcpy( c, &a, sizeof(T)); memcpy(&a, &b, sizeof(T)); memcpy(&b, c, sizeof(T)); } This is as efficient as it gets: it simply blasts through raw memory. It does not require any intervention from the user: no special swap methods or move operations have to be defined. This means that it even works in C++98 (which does not have rvalue references, mind you). But even more importantly, we can now forget about the exception-safety issues, because memcpy never throws. I can see two potential problems with this approach: First, not all objects are meant to be swapped. If a class designer hides the copy constructor or the copy assignment operator, trying to swap objects of the class should fail at compile-time. We can simply introduce some dead code that checks whether copying and assignment are legal on the type: template <typename T> void swap(T& a, T& b) { if (false) // dead code, never executed { T c(a); // copy-constructible? a = b; // assignable? } unsigned char c[sizeof(T)]; std::memcpy( c, &a, sizeof(T)); std::memcpy(&a, &b, sizeof(T)); std::memcpy(&b, c, sizeof(T)); } Any decent compiler can trivially get rid of the dead code. (There are probably better ways to check the "swap conformance", but that is not the point. What matters is that it's possible). Second, some types might perform "unusual" actions in the copy constructor and copy assignment operator. For example, they might notify observers of their change. I deem this a minor issue, because such kinds of objects probably should not have provided copy operations in the first place. Please let me know what you think of this approach to swapping. Would it work in practice? Would you use it? Can you identify library types where this would break? Do you see additional problems? Discuss!

  Read the article

• GCC ICE -- alternative function syntax, variadic templates and tuples

  - by Marc H.

  (Related to C++0x, How do I expand a tuple into variadic template function arguments?.) The following code (see below) is taken from this discussion. The objective is to apply a function to a tuple. I simplified the template parameters and modified the code to allow for a return value of generic type. While the original code compiles fine, when I try to compile the modified code with GCC 4.4.3, g++ -std=c++0x main.cc -o main GCC reports an internal compiler error (ICE) with the following message: main.cc: In function ‘int main()’: main.cc:53: internal compiler error: in tsubst_copy, at cp/pt.c:10077 Please submit a full bug report, with preprocessed source if appropriate. See <file:///usr/share/doc/gcc-4.4/README.Bugs> for instructions. Question: Is the code correct? or is the ICE triggered by illegal code? // file: main.cc #include <tuple> // Recursive case template<unsigned int N> struct Apply_aux { template<typename F, typename T, typename... X> static auto apply(F f, const T& t, X... x) -> decltype(Apply_aux<N-1>::apply(f, t, std::get<N-1>(t), x...)) { return Apply_aux<N-1>::apply(f, t, std::get<N-1>(t), x...); } }; // Terminal case template<> struct Apply_aux<0> { template<typename F, typename T, typename... X> static auto apply(F f, const T&, X... x) -> decltype(f(x...)) { return f(x...); } }; // Actual apply function template<typename F, typename T> auto apply(F f, const T& t) -> decltype(Apply_aux<std::tuple_size<T>::value>::apply(f, t)) { return Apply_aux<std::tuple_size<T>::value>::apply(f, t); } // Testing #include <string> #include <iostream> int f(int p1, double p2, std::string p3) { std::cout << "int=" << p1 << ", double=" << p2 << ", string=" << p3 << std::endl; return 1; } int g(int p1, std::string p2) { std::cout << "int=" << p1 << ", string=" << p2 << std::endl; return 2; } int main() { std::tuple<int, double, char const*> tup(1, 2.0, "xxx"); std::cout << apply(f, tup) << std::endl; std::cout << apply(g, std::make_tuple(4, "yyy")) << std::endl; } Remark: If I hardcode the return type in the recursive case (see code), then everything is fine. That is, substituting this snippet for the recursive case does not trigger the ICE: // Recursive case (hardcoded return type) template<unsigned int N> struct Apply_aux { template<typename F, typename T, typename... X> static int apply(F f, const T& t, X... x) { return Apply_aux<N-1>::apply(f, t, std::get<N-1>(t), x...); } }; Alas, this is an incomplete solution to the original problem.

  Read the article

• Problem measuring N times the execution time of a code block

  - by Nazgulled

  EDIT: I just found my problem after writing this long post explaining every little detail... If someone can give me a good answer on what I'm doing wrong and how can I get the execution time in seconds (using a float with 5 decimal places or so), I'll mark that as accepted. Hint: The problem was on how I interpreted the clock_getttime() man page. Hi, Let's say I have a function named myOperation that I need to measure the execution time of. To measure it, I'm using clock_gettime() as it was recommend here in one of the comments. My teacher recommends us to measure it N times so we can get an average, standard deviation and median for the final report. He also recommends us to execute myOperation M times instead of just one. If myOperation is a very fast operation, measuring it M times allow us to get a sense of the "real time" it takes; cause the clock being used might not have the required precision to measure such operation. So, execution myOperation only one time or M times really depends if the operation itself takes long enough for the clock precision we are using. I'm having trouble dealing with that M times execution. Increasing M decreases (a lot) the final average value. Which doesn't make sense to me. It's like this, on average you take 3 to 5 seconds to travel from point A to B. But then you go from A to B and back to A 5 times (which makes it 10 times, cause A to B is the same as B to A) and you measure that. Than you divide by 10, the average you get is supposed to be the same average you take traveling from point A to B, which is 3 to 5 seconds. This is what I want my code to do, but it's not working. If I keep increasing the number of times I go from A to B and back A, the average will be lower and lower each time, it makes no sense to me. Enough theory, here's my code: #include <stdio.h> #include <time.h> #define MEASUREMENTS 1 #define OPERATIONS 1 typedef struct timespec TimeClock; TimeClock diffTimeClock(TimeClock start, TimeClock end) { TimeClock aux; if((end.tv_nsec - start.tv_nsec) < 0) { aux.tv_sec = end.tv_sec - start.tv_sec - 1; aux.tv_nsec = 1E9 + end.tv_nsec - start.tv_nsec; } else { aux.tv_sec = end.tv_sec - start.tv_sec; aux.tv_nsec = end.tv_nsec - start.tv_nsec; } return aux; } int main(void) { TimeClock sTime, eTime, dTime; int i, j; for(i = 0; i < MEASUREMENTS; i++) { printf(" » MEASURE %02d\n", i+1); clock_gettime(CLOCK_REALTIME, &sTime); for(j = 0; j < OPERATIONS; j++) { myOperation(); } clock_gettime(CLOCK_REALTIME, &eTime); dTime = diffTimeClock(sTime, eTime); printf(" - NSEC (TOTAL): %ld\n", dTime.tv_nsec); printf(" - NSEC (OP): %ld\n\n", dTime.tv_nsec / OPERATIONS); } return 0; } Notes: The above diffTimeClock function is from this blog post. I replaced my real operation with myOperation() because it doesn't make any sense to post my real functions as I would have to post long blocks of code, you can easily code a myOperation() with whatever you like to compile the code if you wish. As you can see, OPERATIONS = 1 and the results are: » MEASURE 01 - NSEC (TOTAL): 27456580 - NSEC (OP): 27456580 For OPERATIONS = 100 the results are: » MEASURE 01 - NSEC (TOTAL): 218929736 - NSEC (OP): 2189297 For OPERATIONS = 1000 the results are: » MEASURE 01 - NSEC (TOTAL): 862834890 - NSEC (OP): 862834 For OPERATIONS = 10000 the results are: » MEASURE 01 - NSEC (TOTAL): 574133641 - NSEC (OP): 57413 Now, I'm not a math wiz, far from it actually, but this doesn't make any sense to me whatsoever. I've already talked about this with a friend that's on this project with me and he also can't understand the differences. I don't understand why the value is getting lower and lower when I increase OPERATIONS. The operation itself should take the same time (on average of course, not the exact same time), no matter how many times I execute it. You could tell me that that actually depends on the operation itself, the data being read and that some data could already be in the cache and bla bla, but I don't think that's the problem. In my case, myOperation is reading 5000 lines of text from an CSV file, separating the values by ; and inserting those values into a data structure. For each iteration, I'm destroying the data structure and initializing it again. Now that I think of it, I also that think that there's a problem measuring time with clock_gettime(), maybe I'm not using it right. I mean, look at the last example, where OPERATIONS = 10000. The total time it took was 574133641ns, which would be roughly 0,5s; that's impossible, it took a couple of minutes as I couldn't stand looking at the screen waiting and went to eat something.

  Read the article

• Hibernate error: cannot resolve table

  - by Roman

  I'm trying to make work the example from hibernate reference. I've got simple table Pupil with id, name and age fields. I've created correct (as I think) java-class for it according to all java-beans rules. I've created configuration file - hibernate.cfg.xml, just like in the example from reference. I've created hibernate mapping for one class Pupil, and here is the error occured. <hibernate-mapping> <class name="Pupil" table="pupils"> ... </class> </hibernate-mapping> table="pupils" is red in my IDE and I see message "cannot resolve table pupils". I've also founded very strange note in reference which says that most users fail with the same problem trying to run the example. Ah.. I'm very angry with this example.. IMHO if authors know that there is such problem they should add some information about it. But, how should I fix it? I don't want to deal with Ant here and with other instruments used in example. I'm using MySql 5.0, but I think it doesn't matter. UPD: source code Pupil.java - my persistent class package domain; public class Pupil { private Integer id; private String name; private Integer age; protected Pupil () { } public Pupil (String name, int age) { this.age = age; this.name = name; } public Integer getId () { return id; } public void setId (Integer id) { this.id = id; } public String getName () { return name; } public void setName (String name) { this.name = name; } public Integer getAge () { return age; } public void setAge (Integer age) { this.age = age; } public String toString () { return "Pupil [ name = " + name + ", age = " + age + " ]"; } } Pupil.hbm.xml is mapping for this class <?xml version="1.0"?> <!DOCTYPE hibernate-mapping PUBLIC "-//Hibernate/Hibernate Mapping DTD 3.0//EN" "http://hibernate.sourceforge.net/hibernate-mapping-3.0.dtd"> <hibernate-mapping package="domain" > <class name="Pupil" table="pupils"> <id name="id"> <generator class="native" /> </id> <property name="name" not-null="true"/> <property name="age"/> </class> </hibernate-mapping> hibernate.cfg.xml - configuration for hibernate <hibernate-configuration> <session-factory> <!-- Database connection settings --> <property name="connection.driver_class">com.mysql.jdbc.Driver</property> <property name="connection.url">jdbc:mysql://localhost/hbm_test</property> <property name="connection.username">root</property> <property name="connection.password">root</property> <property name="connection.pool_size">1</property> <property name="dialect">org.hibernate.dialect.MySQL5Dialect</property> <property name="current_session_context_class">thread</property> <property name="show_sql">true</property> <mapping resource="domain/Pupil.hbm.xml"/> </session-factory> </hibernate-configuration> HibernateUtils.java package utils; import org.hibernate.SessionFactory; import org.hibernate.HibernateException; import org.hibernate.cfg.Configuration; public class HibernateUtils { private static final SessionFactory sessionFactory; static { try { sessionFactory = new Configuration ().configure ().buildSessionFactory (); } catch (HibernateException he) { System.err.println (he); throw new ExceptionInInitializerError (he); } } public static SessionFactory getSessionFactory () { return sessionFactory; } } Runner.java - class for testing hibernate import org.hibernate.Session; import java.util.*; import utils.HibernateUtils; import domain.Pupil; public class Runner { public static void main (String[] args) { Session s = HibernateUtils.getSessionFactory ().getCurrentSession (); s.beginTransaction (); List pups = s.createQuery ("from Pupil").list (); for (Object obj : pups) { System.out.println (obj); } s.getTransaction ().commit (); HibernateUtils.getSessionFactory ().close (); } } My libs: antlr-2.7.6.jar, asm.jar, asm-attrs.jar, cglib-2.1.3.jar, commons-collections-2.1.1.jar, commons-logging-1.0.4.jar, dom4j-1.6.1.jar, hibernate3.jar, jta.jar, log4j-1.2.11.jar, mysql-connector-java-5.1.7-bin.jar Compile error: cannot resolve table pupils

  Read the article

• When building a web Application project, TFS 2008 Builds two spearate projects in the _PublishedFold

  - by Steve Johnson

  Hi all, I am trying to a perform build automation on one of web application projects built using VS 2008. The _PublishedWebSites contains two folders: Web and Deploy. I just want the TFS 2008 to generate only the Deploy Folder and Not the Web Folder. Here is my TFSBuild.proj File <Project ToolsVersion="3.5" DefaultTargets="Compile" xmlns="http://schemas.microsoft.com/developer/msbuild/2003"> <Import Project="$(MSBuildExtensionsPath)\Microsoft\VisualStudio\TeamBuild\Microsoft.TeamFoundation.Build.targets" /> <Import Project="$(MSBuildExtensionsPath)\Microsoft\WebDeployment\v9.0\Microsoft.WebDeployment.targets" /> <ItemGroup> <SolutionToBuild Include="$(BuildProjectFolderPath)/../../Development/Main/MySoftware.sln"> <Targets></Targets> <Properties></Properties> </SolutionToBuild> </ItemGroup> <ItemGroup> <ConfigurationToBuild Include="Release|AnyCPU"> <FlavorToBuild>Release</FlavorToBuild> <PlatformToBuild>Any CPU</PlatformToBuild> </ConfigurationToBuild> </ItemGroup> <!--<ItemGroup> <SolutionToBuild Include="$(BuildProjectFolderPath)/../../Development/Main/MySoftware.sln"> <Targets></Targets> <Properties></Properties> </SolutionToBuild> </ItemGroup> <ItemGroup> <ConfigurationToBuild Include="Release|x64"> <FlavorToBuild>Release</FlavorToBuild> <PlatformToBuild>x64</PlatformToBuild> </ConfigurationToBuild> </ItemGroup>--> <ItemGroup> <AdditionalReferencePath Include="C:\3PR" /> </ItemGroup> <Target Name="GetCopyToOutputDirectoryItems" Outputs="@(AllItemsFullPathWithTargetPath)" DependsOnTargets="AssignTargetPaths;_SplitProjectReferencesByFileExistence"> <!-- Get items from child projects first. --> <MSBuild Projects="@(_MSBuildProjectReferenceExistent)" Targets="GetCopyToOutputDirectoryItems" Properties="%(_MSBuildProjectReferenceExistent.SetConfiguration); %(_MSBuildProjectReferenceExistent.SetPlatform)" Condition="'@(_MSBuildProjectReferenceExistent)'!=''"> <Output TaskParameter="TargetOutputs" ItemName="_AllChildProjectItemsWithTargetPathNotFiltered"/> </MSBuild> <!-- Remove duplicates. --> <RemoveDuplicates Inputs="@(_AllChildProjectItemsWithTargetPathNotFiltered)"> <Output TaskParameter="Filtered" ItemName="_AllChildProjectItemsWithTargetPath"/> </RemoveDuplicates> <!-- Target outputs must be full paths because they will be consumed by a different project. --> <CreateItem Include="@(_AllChildProjectItemsWithTargetPath->'%(FullPath)')" Exclude= "$(BuildProjectFolderPath)/../../Development/Main/Web/Bin*.pdb; *.refresh; *.vshost.exe; *.manifest; *.compiled; $(BuildProjectFolderPath)/../../Development/Main/Web/Auth/MySoftware.dll; $(BuildProjectFolderPath)/../../Development/Main/Web/BinApp_Web_*.dll;" Condition="'%(_AllChildProjectItemsWithTargetPath.CopyToOutputDirectory)'=='Always' or '%(_AllChildProjectItemsWithTargetPath.CopyToOutputDirectory)'=='PreserveNewest'" > <Output TaskParameter="Include" ItemName="AllItemsFullPathWithTargetPath"/> <Output TaskParameter="Include" ItemName="_SourceItemsToCopyToOutputDirectoryAlways" Condition="'%(_AllChildProjectItemsWithTargetPath.CopyToOutputDirectory)'=='Always'"/> <Output TaskParameter="Include" ItemName="_SourceItemsToCopyToOutputDirectory" Condition="'%(_AllChildProjectItemsWithTargetPath.CopyToOutputDirectory)'=='PreserveNewest'"/> </CreateItem> </Target> <!-- To modify your build process, add your task inside one of the targets below and uncomment it. Other similar extension points exist, see Microsoft.WebDeployment.targets. <Target Name="BeforeBuild"> </Target> <Target Name="BeforeMerge"> </Target> <Target Name="AfterMerge"> </Target> <Target Name="AfterBuild"> </Target> --> </Project> I want to build everything that the builtin Deploy project is doing for me. But i dont want the generated Web Project as it conatains App_Web_xxxx.dll assemblies instead of a single compiled assembly. Please help. Thanks

  Read the article

• Convert Decimal to ASCII

  - by Dan Snyder

  I'm having difficulty using reinterpret_cast. Before I show you my code I'll let you know what I'm trying to do. I'm trying to get a filename from a vector full of data being used by a MIPS I processor I designed. Basically what I do is compile a binary from a test program for my processor, dump all the hex's from the binary into a vector in my c++ program, convert all of those hex's to decimal integers and store them in a DataMemory vector which is the data memory unit for my processor. I also have instruction memory. So When my processor runs a SYSCALL instruction such as "Open File" my C++ operating system emulator receives a pointer to the beginning of the filename in my data memory. So keep in mind that data memory is full of ints, strings, globals, locals, all sorts of stuff. When I'm told where the filename starts I do the following: Convert the whole decimal integer element that is being pointed to to its ASCII character representation, and then search from left to right to see if the string terminates, if not then just load each character consecutively into a "filename" string. Do this until termination of the string in memory and then store filename in a table. My difficulty is generating filename from my memory. Here is an example of what I'm trying to do: C++ Syntax (Toggle Plain Text) 1.Index Vector NewVector ASCII filename 2.0 240faef0 128123792 'abc7' 'a' 3.0 240faef0 128123792 'abc7' 'ab' 4.0 240faef0 128123792 'abc7' 'abc' 5.0 240faef0 128123792 'abc7' 'abc7' 6.1 1234567a 243225 'k2s0' 'abc7k' 7.1 1234567a 243225 'k2s0' 'abc7k2' 8.1 1234567a 243225 'k2s0' 'abc7k2s' 9. //EXIT LOOP// 10.1 1234567a 243225 'k2s0' 'abc7k2s' Index Vector NewVector ASCII filename 0 240faef0 128123792 'abc7' 'a' 0 240faef0 128123792 'abc7' 'ab' 0 240faef0 128123792 'abc7' 'abc' 0 240faef0 128123792 'abc7' 'abc7' 1 1234567a 243225 'k2s0' 'abc7k' 1 1234567a 243225 'k2s0' 'abc7k2' 1 1234567a 243225 'k2s0' 'abc7k2s' //EXIT LOOP// 1 1234567a 243225 'k2s0' 'abc7k2s' Here is the code that I've written so far to get filename (I'm just applying this to element 1000 of my DataMemory vector to test functionality. 1000 is arbitrary.): C++ Syntax (Toggle Plain Text) 1.int i = 0; 2.int step = 1000;//top->a0; 3.string filename; 4.char *temp = reinterpret_cast<char*>( DataMemory[1000] );//convert to char 5.cout << "a0:" << top->a0 << endl;//pointer supplied 6.cout << "Data:" << DataMemory[top->a0] << endl;//my vector at pointed to location 7.cout << "Data(1000):" << DataMemory[1000] << endl;//the element I'm testing 8.cout << "Characters:" << &temp << endl;//my temporary char array 9. 10.while(&temp[i]!=0) 11.{ 12. filename+=temp[i];//add most recent non-terminated character to string 13. i++; 14. if(i==4)//when 4 chatacters have been added.. 15. { 16. i=0; 17. step+=1;//restart loop at the next element in DataMemory 18. temp = reinterpret_cast<char*>( DataMemory[step] ); 19. } 20. } 21. cout << "Filename:" << filename << endl; int i = 0; int step = 1000;//top-a0; string filename; char *temp = reinterpret_cast( DataMemory[1000] );//convert to char cout << "a0:" << top-a0 << endl;//pointer supplied cout << "Data:" << DataMemory[top-a0] << endl;//my vector at pointed to location cout << "Data(1000):" << DataMemory[1000] << endl;//the element I'm testing cout << "Characters:" << &temp << endl;//my temporary char array while(&temp[i]!=0) { filename+=temp[i];//add most recent non-terminated character to string i++; if(i==3)//when 4 chatacters have been added.. { i=0; step+=1;//restart loop at the next element in DataMemory temp = reinterpret_cast( DataMemory[step] ); } } cout << "Filename:" << filename << endl; So the issue is that when I do the conversion of my decimal element to a char array I assume that 8 hex #'s will give me 4 characters. Why isn't this this case? Here is my output: C++ Syntax (Toggle Plain Text) 1.a0:0 2.Data:0 3.Data(1000):4428576 4.Characters:0x7fff5fbff128 5.Segmentation fault

  Read the article

• Unknown error in Producer/Consumer program, believe it to be an infinite loop.

  - by ray2k

  Hello, I am writing a program that is solving the producer/consumer problem, specifically the bounded-buffer version(i believe they mean the same thing). The producer will be generating x number of random numbers, where x is a command line parameter to my program. At the current moment, I believe my program is entering an infinite loop, but I'm not sure why it is occurring. I believe I am executing the semaphores correctly. You compile it like this: gcc -o prodcon prodcon.cpp -lpthread -lrt Then to run, ./prodcon 100(the number of randum nums to produce) This is my code. typedef int buffer_item; #include <stdlib.h> #include <stdio.h> #include <pthread.h> #include <semaphore.h> #include <unistd.h> #define BUFF_SIZE 10 #define RAND_DIVISOR 100000000 #define TRUE 1 //two threads void *Producer(void *param); void *Consumer(void *param); int insert_item(buffer_item item); int remove_item(buffer_item *item); int returnRandom(); //the global semaphores sem_t empty, full, mutex; //the buffer buffer_item buf[BUFF_SIZE]; //buffer counter int counter; //number of random numbers to produce int numRand; int main(int argc, char** argv) { /* thread ids and attributes */ pthread_t pid, cid; pthread_attr_t attr; pthread_attr_init(&attr); pthread_attr_setscope(&attr, PTHREAD_SCOPE_SYSTEM); numRand = atoi(argv[1]); sem_init(&empty,0,BUFF_SIZE); sem_init(&full,0,0); sem_init(&mutex,0,0); printf("main started\n"); pthread_create(&pid, &attr, Producer, NULL); pthread_create(&cid, &attr, Consumer, NULL); printf("main gets here"); pthread_join(pid, NULL); pthread_join(cid, NULL); printf("main done\n"); return 0; } //generates a randum number between 1 and 100 int returnRandom() { int num; srand(time(NULL)); num = rand() % 100 + 1; return num; } //begin producing items void *Producer(void *param) { buffer_item item; int i; for(i = 0; i < numRand; i++) { //sleep for a random period of time int rNum = rand() / RAND_DIVISOR; sleep(rNum); //generate a random number item = returnRandom(); //acquire the empty lock sem_wait(&empty); //acquire the mutex lock sem_wait(&mutex); if(insert_item(item)) { fprintf(stderr, " Producer report error condition\n"); } else { printf("producer produced %d\n", item); } /* release the mutex lock */ sem_post(&mutex); /* signal full */ sem_post(&full); } return NULL; } /* Consumer Thread */ void *Consumer(void *param) { buffer_item item; int i; for(i = 0; i < numRand; i++) { /* sleep for a random period of time */ int rNum = rand() / RAND_DIVISOR; sleep(rNum); /* aquire the full lock */ sem_wait(&full); /* aquire the mutex lock */ sem_wait(&mutex); if(remove_item(&item)) { fprintf(stderr, "Consumer report error condition\n"); } else { printf("consumer consumed %d\n", item); } /* release the mutex lock */ sem_post(&mutex); /* signal empty */ sem_post(&empty); } return NULL; } /* Add an item to the buffer */ int insert_item(buffer_item item) { /* When the buffer is not full add the item and increment the counter*/ if(counter < BUFF_SIZE) { buf[counter] = item; counter++; return 0; } else { /* Error the buffer is full */ return -1; } } /* Remove an item from the buffer */ int remove_item(buffer_item *item) { /* When the buffer is not empty remove the item and decrement the counter */ if(counter > 0) { *item = buf[(counter-1)]; counter--; return 0; } else { /* Error buffer empty */ return -1; } }

  Read the article

• Completing install of ruby 1.9.3 with Ruby for for Mac OS X 10.7.5 Leopard, Xcode 4.5.2 -- problems with rvm pkg install openssl

  - by user1848361

  First, many thanks in advance for any help. I'm a complete novice with programming and I'm trying to get started with this Ruby on Rails tutorial (http://ruby.railstutorial.org/ruby-on-rails-tutorial-book?version=3.2) I have been trying figure this out for about 7 hours now and since I don't have any hair left to pull out I'm turning to these hallowed pages. I have searched for solutions here again and again. System: Mac OS X 10.7.5 Leopard, Xcode 4.5.2 I installed homebrew and have updated it multiple times I used homebrew to install rvm and have updated it multiple times I installed git The standard ruby on the system (checking with $ ruby -v) is 1.8.7 My problem is that every time I try to use rvm to install a new version of Ruby ($ rvm install 1.9.3) I get the following error: Ruby (and needed base gems) for your selection will be installed shortly. Before it happens, please read and execute the instructions below. Please use a separate terminal to execute any additional commands. Notes for Mac OS X 10.7.5, Xcode 4.5.2. For JRuby: Install the JDK. See http://developer.apple.com/java/download/ # Current Java version "1.6.0_26" For IronRuby: Install Mono >= 2.6 For Ruby 1.9.3: Install libksba # If using Homebrew, 'brew install libksba' For Opal: Install Nodejs with NPM. See http://nodejs.org/download/ To use an RVM installed Ruby as default, instead of the system ruby: rvm install 1.8.7 # installs patch 357: closest supported version rvm system ; rvm gemset export system.gems ; rvm 1.8.7 ; rvm gemset import system.gems # migrate your gems rvm alias create default 1.8.7 And reopen your terminal windows. Xcode and gcc: : I have performed $ brew install libksba and when I try to do it again it tells me that libksba is installed already. When I type "$ rvm requirements" I get: Notes for Mac OS X 10.7.5, Xcode 4.5.2. For JRuby: Install the JDK. See http://developer.apple.com/java/download/ # Current Java version "1.6.0_26" For IronRuby: Install Mono >= 2.6 For Ruby 1.9.3: Install libksba # If using Homebrew, 'brew install libksba' For Opal: Install Nodejs with NPM. See http://nodejs.org/download/ To use an RVM installed Ruby as default, instead of the system ruby: rvm install 1.8.7 # installs patch 357: closest supported version rvm system ; rvm gemset export system.gems ; rvm 1.8.7 ; rvm gemset import system.gems # migrate your gems rvm alias create default 1.8.7 And reopen your terminal windows. Xcode and gcc: Right now Ruby requires gcc to compile, but Xcode 4.2 and later no longer ship with gcc. Instead they ship with llvm-gcc (to which gcc is a symlink) and clang, neither of which are supported for building Ruby. Xcode 4.1 was the last version to ship gcc, which was /usr/bin/gcc-4.2. Xcode 4.1 and earlier: - Ruby will build fine. Xcode 4.2 and later (including Command Line Tools for Xcode): - If you have gcc-4.2 (and friends) from an earlier Xcode version, Ruby will build fine. - If you don't have gcc-4.2, you have two options to get it: * Install apple-gcc42 from Homebrew * Install osx-gcc-installer Homebrew: If you are using Homebrew, you can install the apple-gcc42 and required libraries from homebrew/dupes: brew update brew tap homebrew/dupes brew install autoconf automake apple-gcc42 rvm pkg install openssl Xcode 4.2+ install or/and Command Line Tools for Xcode is required to provide make and other tools. osx-gcc-installer: If you don't use Homebrew, you can download and install osx-gcc-installer: https://github.com/kennethreitz/osx-gcc-installer. Warning: Installing osx-gcc-installer on top of a recent Xcode is known to cause problems, so you must uninstall Xcode before installing osx-gcc-installer. Afterwards you may install Xcode 4.2+ or Command Line Tools for Xcode if you desire. ** NOTE: Currently, Node.js is having issues building with osx-gcc-installer. The only fix is to install Xcode over osx-gcc-installer. So I assume I have to do something with brew update brew tap homebrew/dupes brew install autoconf automake apple-gcc42 rvm pkg install openssl Everything seemed to work fine until "$ rvm pkg install openssl", which returns: Fetching openssl-1.0.1c.tar.gz to /Users/thierinvestmentservices/.rvm/archives Extracting openssl to /Users/thierinvestmentservices/.rvm/src/openssl-1.0.1c Configuring openssl in /Users/thierinvestmentservices/.rvm/src/openssl-1.0.1c. Compiling openssl in /Users/thierinvestmentservices/.rvm/src/openssl-1.0.1c. Error running 'make', please read /Users/thierinvestmentservices/.rvm/log/openssl/make.log Please note that it's required to reinstall all rubies: rvm reinstall all --force Updating openssl certificates Error running 'update_openssl_certs', please read /Users/thierinvestmentservices/.rvm/log/openssl.certs.log Johns-MacBook-Pro:~ thierinvestmentservices$ rvm pkg install openssl Fetching openssl-1.0.1c.tar.gz to /Users/thierinvestmentservices/.rvm/archives Extracting openssl to /Users/thierinvestmentservices/.rvm/src/openssl-1.0.1c Configuring openssl in /Users/thierinvestmentservices/.rvm/src/openssl-1.0.1c. Compiling openssl in /Users/thierinvestmentservices/.rvm/src/openssl-1.0.1c. Error running 'make', please read /Users/thierinvestmentservices/.rvm/log/openssl/make.log Please note that it's required to reinstall all rubies: rvm reinstall all --force Updating openssl certificates Error running 'update_openssl_certs', please read /Users/thierinvestmentservices/.rvm/log/openssl.certs.log make.log reads "[2012-11-23 13:15:28] make /Users/thierinvestmentservices/.rvm/scripts/functions/utility: line 116: make: command not found" and openssl.certs.log reads "[2012-11-23 14:04:04] update_openssl_certs update_openssl_certs () { ( chpwd_functions="" builtin cd $rvm_usr_path/ssl && command curl -O http://curl.haxx.se/ca/cacert.pem && mv cacert.pem cert.pem ) } current path: /Users/thierinvestmentservices command(1): update_openssl_certs /Users/thierinvestmentservices/.rvm/scripts/functions/pkg: line 205: cd: /Users/thierinvestmentservices/.rvm/usr/ssl: No such file or directory" At this point the letters might as well be wingdings I have no idea what is going on. I have tried to install rvm make with something I saw on one forum post but I got a bunch of warnings. If anyone has any suggestions I would be deeply grateful, I am completely in over my head,

  Read the article

• When building a web application project, TFS 2008 builds two separate projects in _PublishedFolder.

  - by Steve Johnson

  I am trying to perform build automation on one of my web application projects built using VS 2008. The _PublishedWebSites contains two folders: Web and Deploy. I want TFS 2008 to generate only the deploy folder and not the web folder. Here is my TFSBuild.proj file: <Project ToolsVersion="3.5" DefaultTargets="Compile" xmlns="http://schemas.microsoft.com/developer/msbuild/2003"> <Import Project="$(MSBuildExtensionsPath)\Microsoft\VisualStudio\TeamBuild\Microsoft.TeamFoundation.Build.targets" /> <Import Project="$(MSBuildExtensionsPath)\Microsoft\WebDeployment\v9.0\Microsoft.WebDeployment.targets" /> <ItemGroup> <SolutionToBuild Include="$(BuildProjectFolderPath)/../../Development/Main/MySoftware.sln"> <Targets></Targets> <Properties></Properties> </SolutionToBuild> </ItemGroup> <ItemGroup> <ConfigurationToBuild Include="Release|AnyCPU"> <FlavorToBuild>Release</FlavorToBuild> <PlatformToBuild>Any CPU</PlatformToBuild> </ConfigurationToBuild> </ItemGroup> <!--<ItemGroup> <SolutionToBuild Include="$(BuildProjectFolderPath)/../../Development/Main/MySoftware.sln"> <Targets></Targets> <Properties></Properties> </SolutionToBuild> </ItemGroup> <ItemGroup> <ConfigurationToBuild Include="Release|x64"> <FlavorToBuild>Release</FlavorToBuild> <PlatformToBuild>x64</PlatformToBuild> </ConfigurationToBuild> </ItemGroup>--> <ItemGroup> <AdditionalReferencePath Include="C:\3PR" /> </ItemGroup> <Target Name="GetCopyToOutputDirectoryItems" Outputs="@(AllItemsFullPathWithTargetPath)" DependsOnTargets="AssignTargetPaths;_SplitProjectReferencesByFileExistence"> <!-- Get items from child projects first. --> <MSBuild Projects="@(_MSBuildProjectReferenceExistent)" Targets="GetCopyToOutputDirectoryItems" Properties="%(_MSBuildProjectReferenceExistent.SetConfiguration); %(_MSBuildProjectReferenceExistent.SetPlatform)" Condition="'@(_MSBuildProjectReferenceExistent)'!=''"> <Output TaskParameter="TargetOutputs" ItemName="_AllChildProjectItemsWithTargetPathNotFiltered"/> </MSBuild> <!-- Remove duplicates. --> <RemoveDuplicates Inputs="@(_AllChildProjectItemsWithTargetPathNotFiltered)"> <Output TaskParameter="Filtered" ItemName="_AllChildProjectItemsWithTargetPath"/> </RemoveDuplicates> <!-- Target outputs must be full paths because they will be consumed by a different project. --> <CreateItem Include="@(_AllChildProjectItemsWithTargetPath->'%(FullPath)')" Exclude= "$(BuildProjectFolderPath)/../../Development/Main/Web/Bin*.pdb; *.refresh; *.vshost.exe; *.manifest; *.compiled; $(BuildProjectFolderPath)/../../Development/Main/Web/Auth/MySoftware.dll; $(BuildProjectFolderPath)/../../Development/Main/Web/BinApp_Web_*.dll;" Condition="'%(_AllChildProjectItemsWithTargetPath.CopyToOutputDirectory)'=='Always' or '%(_AllChildProjectItemsWithTargetPath.CopyToOutputDirectory)'=='PreserveNewest'" > <Output TaskParameter="Include" ItemName="AllItemsFullPathWithTargetPath"/> <Output TaskParameter="Include" ItemName="_SourceItemsToCopyToOutputDirectoryAlways" Condition="'%(_AllChildProjectItemsWithTargetPath.CopyToOutputDirectory)'=='Always'"/> <Output TaskParameter="Include" ItemName="_SourceItemsToCopyToOutputDirectory" Condition="'%(_AllChildProjectItemsWithTargetPath.CopyToOutputDirectory)'=='PreserveNewest'"/> </CreateItem> </Target> <!-- To modify your build process, add your task inside one of the targets below and uncomment it. Other similar extension points exist, see Microsoft.WebDeployment.targets. <Target Name="BeforeBuild"> </Target> <Target Name="BeforeMerge"> </Target> <Target Name="AfterMerge"> </Target> <Target Name="AfterBuild"> </Target> --> </Project> I want to build everything that the builtin Deploy project is doing for me. But I don't want the generated web project as it contains App_Web_xxxx.dll assemblies instead of a single compiled assembly. How can I do this?

  Read the article

• Parse a text file into multiple text file

  - by Vijay Kumar Singh

  I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

  Read the article

• What's wrong with Bundler working with RubyGems to push a Git repo to Heroku?

  - by stanigator

  I've made sure that all the files are in the root of the repository as recommended in this discussion. However, as I follow the instructions in this section of the book, I can't get through the section without the problems. What do you think is happening with my system that's causing the error? I have no clue at the moment of what the problem means despite reading the following in the log. Thanks in advance for your help! stanley@ubuntu:~/rails_sample/first_app$ git push heroku master Warning: Permanently added the RSA host key for IP address '50.19.85.156' to the list of known hosts. Counting objects: 96, done. Compressing objects: 100% (79/79), done. Writing objects: 100% (96/96), 28.81 KiB, done. Total 96 (delta 22), reused 0 (delta 0) -----> Heroku receiving push -----> Ruby/Rails app detected -----> Installing dependencies using Bundler version 1.2.0.pre Running: bundle install --without development:test --path vendor/bundle --binstubs bin/ --deployment Fetching gem metadata from https://rubygems.org/....... Installing rake (0.9.2.2) Installing i18n (0.6.0) Installing multi_json (1.3.5) Installing activesupport (3.2.3) Installing builder (3.0.0) Installing activemodel (3.2.3) Installing erubis (2.7.0) Installing journey (1.0.3) Installing rack (1.4.1) Installing rack-cache (1.2) Installing rack-test (0.6.1) Installing hike (1.2.1) Installing tilt (1.3.3) Installing sprockets (2.1.3) Installing actionpack (3.2.3) Installing mime-types (1.18) Installing polyglot (0.3.3) Installing treetop (1.4.10) Installing mail (2.4.4) Installing actionmailer (3.2.3) Installing arel (3.0.2) Installing tzinfo (0.3.33) Installing activerecord (3.2.3) Installing activeresource (3.2.3) Installing coffee-script-source (1.3.3) Installing execjs (1.3.2) Installing coffee-script (2.2.0) Installing rack-ssl (1.3.2) Installing json (1.7.3) with native extensions Installing rdoc (3.12) Installing thor (0.14.6) Installing railties (3.2.3) Installing coffee-rails (3.2.2) Installing jquery-rails (2.0.2) Using bundler (1.2.0.pre) Installing rails (3.2.3) Installing sass (3.1.18) Installing sass-rails (3.2.5) Installing sqlite3 (1.3.6) with native extensions Gem::Installer::ExtensionBuildError: ERROR: Failed to build gem native extension. /usr/local/bin/ruby extconf.rb checking for sqlite3.h... no sqlite3.h is missing. Try 'port install sqlite3 +universal' or 'yum install sqlite-devel' and check your shared library search path (the location where your sqlite3 shared library is located). *** extconf.rb failed *** Could not create Makefile due to some reason, probably lack of necessary libraries and/or headers. Check the mkmf.log file for more details. You may need configuration options. Provided configuration options: --with-opt-dir --without-opt-dir --with-opt-include --without-opt-include=${opt-dir}/include --with-opt-lib --without-opt-lib=${opt-dir}/lib --with-make-prog --without-make-prog --srcdir=. --curdir --ruby=/usr/local/bin/ruby --with-sqlite3-dir --without-sqlite3-dir --with-sqlite3-include --without-sqlite3-include=${sqlite3-dir}/include --with-sqlite3-lib --without-sqlite3-lib=${sqlite3-dir}/lib --enable-local --disable-local Gem files will remain installed in /tmp/build_3tplrxvj7qa81/vendor/bundle/ruby/1.9.1/gems/sqlite3-1.3.6 for inspection. Results logged to /tmp/build_3tplrxvj7qa81/vendor/bundle/ruby/1.9.1/gems/sqlite3-1.3.6/ext/sqlite3/gem_make.out An error occurred while installing sqlite3 (1.3.6), and Bundler cannot continue. Make sure that `gem install sqlite3 -v '1.3.6'` succeeds before bundling. ! ! Failed to install gems via Bundler. ! ! Heroku push rejected, failed to compile Ruby/rails app To [email protected]:growing-mountain-2788.git ! [remote rejected] master -> master (pre-receive hook declined) error: failed to push some refs to '[email protected]:growing-mountain-2788.git' ------Gemfile------------------------ As requested, here's the auto-generated gemfile: source 'https://rubygems.org' gem 'rails', '3.2.3' # Bundle edge Rails instead: # gem 'rails', :git => 'git://github.com/rails/rails.git' gem 'sqlite3' gem 'json' # Gems used only for assets and not required # in production environments by default. group :assets do gem 'sass-rails', '~> 3.2.3' gem 'coffee-rails', '~> 3.2.1' # See https://github.com/sstephenson/execjs#readme for more supported runtimes # gem 'therubyracer', :platform => :ruby gem 'uglifier', '>= 1.0.3' end gem 'jquery-rails' # To use ActiveModel has_secure_password # gem 'bcrypt-ruby', '~> 3.0.0' # To use Jbuilder templates for JSON # gem 'jbuilder' # Use unicorn as the app server # gem 'unicorn' # Deploy with Capistrano # gem 'capistrano' # To use debugger # gem 'ruby-debug'

  Read the article

• Silverlight/Web Service Serializing Interface for use Client Side

  - by Steve Brouillard

  I have a Silverlight solution that references a third-party web service. This web service generates XML, which is then processed into objects for use in Silverlight binding. At one point we the processing of XML to objects was done client-side, but we ran into performance issues and decided to move this processing to the proxies in the hosting web project to improve performance (which it did). This is obviously a gross over-simplification, but should work. My basic project structure looks like this. Solution Solution.Web - Holds the web page that hosts Silverlight as well as proxies that access web services and processes as required and obviously the references to those web services). Solution.Infrastructure - Holds references to the proxy web services in the .Web project, all genned code from serialized objects from those proxies and code around those objects that need to be client-side. Solution.Book - The particular project that uses the objects in question after processed down into Infrastructure. I've defined the following Interface and Class in the Web project. They represent the type of objects that the XML from the original third-party gets transformed into and since this is the only project in the Silverlight app that is actually server-side, that was the place to define and use them. //Doesn't get much simpler than this. public interface INavigable { string Description { get; set; } } //Very simple class too public class IndexEntry : INavigable { public List<IndexCM> CMItems { get; set; } public string CPTCode { get; set; } public string DefinitionOfAbbreviations { get; set; } public string Description { get; set; } public string EtiologyCode { get; set; } public bool HighScore { get; set; } public IndexToTabularCommandArguments IndexToTabularCommandArgument { get; set; } public bool IsExpanded { get; set; } public string ManifestationCode { get; set; } public string MorphologyCode { get; set; } public List<TextItem> NonEssentialModifiersAndQualifyingText { get; set; } public string OtherItalics { get; set; } public IndexEntry Parent { get; set; } public int Score { get; set; } public string SeeAlsoReference { get; set; } public string SeeReference { get; set; } public List<IndexEntry> SubEntries { get; set; } public int Words { get; set; } } Again; both of these items are defined in the Web project. Notice that IndexEntry implments INavigable. When the code for IndexEntry is auto-genned in the Infrastructure project, the definition of the class does not include the implmentation of INavigable. After discovering this, I thought "no problem, I'll create another partial class file reiterating the implmentation". Unfortunately (I'm guessing because it isn't being serialized), that interface isn't recognized in the Infrastructure project, so I can't simply do that. Here's where it gets really weird. The BOOK project CAN see the INavigable interface. In fact I use it in Book, though Book has no reference to the Web Service in the Web project where the thing is define, though Infrastructure does. Just as a test, I linked to the INavigable source file from indside the Infrastructure project. That allowed me to reference it in that project and compile, but causes havoc in the Book project, because now there's a conflick between the one define in Infrastructure and the one defined in the Web project's web service. This is behavior I would expect. So, to try and sum up a bit. Web project has a web service that process data from a third-party service and has a class and interface defined in it. The class implements the interface. The Infrastructure project references the web service in the Web Project and the Book project references the Infrastructure project. The implmentation of the interface in the class does NOT serialize down, so the auto-genned code in INfrastructure does not show this relationship, breaking code further down-stream. The Book project, whihc is further down-stream CAN see the interface as defined in the Web Project, even though its only reference is through the Infrastructure project; whihc CAN'T see it. Am I simple missing something easy here? Can I apply an attribute to either the Interface definition or to the its implmentation in the class to ensure its visibility downstream? Anything else I can do here? I know this is a bit convoluted and anyone still with me here, thanks for your patience and any advice you might have. Cheers, Steve

  Read the article

• Array subscript is not an integer

  - by Dimitri

  Hello folks, following this previous question Malloc Memory Corruption in C, now i have another problem. I have the same code. Now I am trying to multiply the values contained in the arrays A * vc and store in res. Then A is set to zero and i do a second multiplication with res and vc and i store the values in A. (A and Q are square matrices and mc and vc are N lines two columns matrices or arrays). Here is my code : int jacobi_gpu(double A[], double Q[], double tol, long int dim){ int nrot, p, q, k, tid; double c, s; double *mc, *vc, *res; int i,kc; double vc1, vc2; mc = (double *)malloc(2 * dim * sizeof(double)); vc = (double *)malloc(2 * dim * sizeof(double)); vc = (double *)malloc(dim * dim * sizeof(double)); if( mc == NULL || vc == NULL){ fprintf(stderr, "pb allocation matricre\n"); exit(1); } nrot = 0; for(k = 0; k < dim - 1; k++){ eye(mc, dim); eye(vc, dim); for(tid = 0; tid < floor(dim /2); tid++){ p = (tid + k)%(dim - 1); if(tid != 0) q = (dim - tid + k - 1)%(dim - 1); else q = dim - 1; printf("p = %d | q = %d\n", p, q); if(fabs(A[p + q*dim]) > tol){ nrot++; symschur2(A, dim, p, q, &c, &s); mc[2*tid] = p; vc[2 * tid] = c; mc[2*tid + 1] = q; vc[2*tid + 1] = -s; mc[2*tid + 2*(dim - 2*tid) - 2] = p; vc[2*tid + 2*(dim - 2*tid) - 2 ] = s; mc[2*tid + 2*(dim - 2*tid) - 1] = q; vc[2 * tid + 2*(dim - 2*tid) - 1 ] = c; } } for( i = 0; i< dim; i++){ for(kc=0; kc < dim; kc++){ if( kc < floor(dim/2)) { vc1 = vc[2*kc + i*dim]; vc2 = vc[2*kc + 2*(dim - 2*kc) - 2]; }else { vc1 = vc[2*kc+1 + i*dim]; vc2 = vc[2*kc - 2*(dim - 2*kc) - 1]; } res[kc + i*dim] = A[mc[2*kc] + i*dim]*vc1 + A[mc[2*kc + 1] + i*dim]*vc2; } } zero(A, dim); for( i = 0; i< dim; i++){ for(kc=0; kc < dim; k++){ if( k < floor(dim/2)){ vc1 = vc[2*kc + i*dim]; vc2 = vc[2*kc + 2*(dim - 2*kc) - 2]; }else { vc1 = vc[2*kc+1 + i*dim]; vc2 = vc[2*kc - 2*(dim - 2*kc) - 1]; } A[kc + i*dim] = res[mc[2*kc] + i*dim]*vc1 + res[mc[2*kc + 1] + i*dim]*vc2; } } affiche(mc,dim,2,"Matrice creuse"); affiche(vc,dim,2,"Valeur creuse"); } free(mc); free(vc); free(res); return nrot; } When i try to compile, i have this error : jacobi_gpu.c: In function ‘jacobi_gpu’: jacobi_gpu.c:103: error: array subscript is not an integer jacobi_gpu.c:103: error: array subscript is not an integer jacobi_gpu.c:118: error: array subscript is not an integer jacobi_gpu.c:118: error: array subscript is not an integer make: *** [jacobi_gpu.o] Erreur 1 The corresponding lines are where I store the results in res and A : res[kc + i*dim] = A[mc[2*kc] + i*dim]*vc1 + A[mc[2*kc + 1] + i*dim]*vc2; and A[kc + i*dim] = res[mc[2*kc] + i*dim]*vc1 + res[mc[2*kc + 1] + i*dim]*vc2; Can someone explain me what is this error and how can i correct it? Thanks for your help. ;)

  Read the article

• Problem with GCC calling static templates functions in templated parent class.

  - by Adisak

  I have some code that compiles and runs on MSVC++ but will not compile on GCC. I have made a test snippet that follows. My goal was to move the static method from BFSMask to BFSMaskSized. Can someone explain what is going on with the errors (esp. the weird 'operator<' error)? Thank you. In the case of both #defines are 0, then the code compiles on GCC. #define DOESNT_COMPILE_WITH_GCC 0 #define FUNCTION_IN_PARENT 0 I get errors if I change either #define to 1. Here are the errors I see. #define DOESNT_COMPILE_WITH_GCC 0 #define FUNCTION_IN_PARENT 1 Test.cpp: In static member function 'static typename Snapper::BFSMask<T>::T_Parent::T_SINT Snapper::BFSMask<T>::Create_NEZ(TCMP)': Test.cpp(492): error: 'CreateMaskFromHighBitSized' was not declared in this scope #define DOESNT_COMPILE_WITH_GCC 1 #define FUNCTION_IN_PARENT 0 Test.cpp: In static member function 'static typename Snapper::BFSMask<T>::T_Parent::T_SINT Snapper::BFSMask<T>::Create_NEZ(TCMP) [with TCMP = int, T = int]': Test.cpp(500): instantiated from 'TVAL Snapper::BFWrappedInc(TVAL, TVAL, TVAL) [with TVAL = int]' Test.cpp(508): instantiated from here Test.cpp(490): error: invalid operands of types '<unresolved overloaded function type>' and 'unsigned int' to binary 'operator<' #define DOESNT_COMPILE_WITH_GCC 1 #define FUNCTION_IN_PARENT 1 Test.cpp: In static member function 'static typename Snapper::BFSMask<T>::T_Parent::T_SINT Snapper::BFSMask<T>::Create_NEZ(TCMP) [with TCMP = int, T = int]': Test.cpp(500): instantiated from 'TVAL Snapper::BFWrappedInc(TVAL, TVAL, TVAL) [with TVAL = int]' Test.cpp(508): instantiated from here Test.cpp(490): error: invalid operands of types '<unresolved overloaded function type>' and 'unsigned int' to binary 'operator<' Here is the code namespace Snapper { #define DOESNT_COMPILE_WITH_GCC 0 #define FUNCTION_IN_PARENT 0 // MASK TYPES // NEZ - Not Equal to Zero #define BFSMASK_NEZ(A) ( ( A ) | ( 0 - A ) ) #define BFSELECT_MASK(MASK,VTRUE,VFALSE) ( ((MASK)&(VTRUE)) | ((~(MASK))&(VFALSE)) ) template<typename TVAL> TVAL BFSelect_MASK(TVAL MASK,TVAL VTRUE,TVAL VFALSE) { return(BFSELECT_MASK(MASK,VTRUE,VFALSE)); } //----------------------------------------------------------------------------- // Branch Free Helpers template<int BYTESIZE> struct BFSMaskBase {}; template<> struct BFSMaskBase<2> { typedef UINT16 T_UINT; typedef SINT16 T_SINT; }; template<> struct BFSMaskBase<4> { typedef UINT32 T_UINT; typedef SINT32 T_SINT; }; template<int BYTESIZE> struct BFSMaskSized : public BFSMaskBase<BYTESIZE> { static const int SizeBytes = BYTESIZE; static const int SizeBits = SizeBytes*8; static const int MaskShift = SizeBits-1; typedef typename BFSMaskBase<BYTESIZE>::T_UINT T_UINT; typedef typename BFSMaskBase<BYTESIZE>::T_SINT T_SINT; #if FUNCTION_IN_PARENT template<int N> static T_SINT CreateMaskFromHighBitSized(typename BFSMaskBase<N>::T_SINT inmask); #endif }; template<typename T> struct BFSMask : public BFSMaskSized<sizeof(T)> { // BFSMask = -1 (all bits set) typedef BFSMask<T> T_This; // "Import" the Parent Class typedef BFSMaskSized<sizeof(T)> T_Parent; typedef typename T_Parent::T_SINT T_SINT; #if FUNCTION_IN_PARENT typedef T_Parent T_MaskGen; #else typedef T_This T_MaskGen; template<int N> static T_SINT CreateMaskFromHighBitSized(typename BFSMaskSized<N>::T_SINT inmask); #endif template<typename TCMP> static T_SINT Create_NEZ(TCMP A) { //ReDefineType(const typename BFSMask<TCMP>::T_SINT,SA,A); //const typename BFSMask<TCMP>::T_SINT cmpmask = BFSMASK_NEZ(SA); const typename BFSMask<TCMP>::T_SINT cmpmask = BFSMASK_NEZ(A); #if DOESNT_COMPILE_WITH_GCC return(T_MaskGen::CreateMaskFromHighBitSized<sizeof(TCMP)>(cmpmask)); #else return(CreateMaskFromHighBitSized<sizeof(TCMP)>(cmpmask)); #endif } }; template<typename TVAL> TVAL BFWrappedInc(TVAL x,TVAL minval,TVAL maxval) { const TVAL diff = maxval-x; const TVAL mask = BFSMask<TVAL>::Create_NEZ(diff); const TVAL incx = x + 1; return(BFSelect_MASK(mask,incx,minval)); } SINT32 currentsnap = 0; SINT32 SetSnapshot() { currentsnap=BFWrappedInc<SINT32>(currentsnap,0,20); return(currentsnap); } }

  Read the article

< Previous Page | 239 240 241 242 243 244 245 246 247  | Next Page >