Search Results

Search found 15408 results on 617 pages for 'import module'.

Page 253/617 | < Previous Page | 249 250 251 252 253 254 255 256 257 258 259 260  | Next Page >

  • Identifying that a variable is a new-style class in Python?

    - by Dave Johansen
    I'm using Python 2.x and I'm wondering if there's a way to tell if a variable is a new-style class? I know that if it's an old-style class that I can do the following to find out. import types class oldclass: pass def test(): o = oldclass() if type(o) is types.InstanceType: print 'Is old-style' else: print 'Is NOT old-style' But I haven't been able to find anything that works for new-style classes. I found this question, but the proposed solutions don't seem to work as expected, because simple values as are identified as classes. import inspect def newclass(object): pass def test(): n = newclass() if inspect.isclass(n): print 'Is class' else: print 'Is NOT class' if inspect.isclass(type(n)): print 'Is class' else: print 'Is NOT class' if inspect.isclass(type(1)): print 'Is class' else: print 'Is NOT class' if isinstance(n, object): print 'Is class' else: print 'Is NOT class' if isinstance(1, object): print 'Is class' else: print 'Is NOT class' So is there anyway to do something like this? Or is everything in Python just a class and there's no way to get around that?

    Read the article

  • pyplot: really slow creating heatmaps

    - by cvondrick
    I have a loop that executes the body about 200 times. In each loop iteration, it does a sophisticated calculation, and then as debugging, I wish to produce a heatmap of a NxM matrix. But, generating this heatmap is unbearably slow and significantly slow downs an already slow algorithm. My code is along the lines: import numpy import matplotlib.pyplot as plt for i in range(200): matrix = complex_calculation() plt.set_cmap("gray") plt.imshow(matrix) plt.savefig("frame{0}.png".format(i)) The matrix, from numpy, is not huge --- 300 x 600 of doubles. Even if I do not save the figure and instead update an on-screen plot, it's even slower. Surely I must be abusing pyplot. (Matlab can do this, no problem.) How do I speed this up?

    Read the article

  • How can I set controls for a web page ??

    - by Rami Jarrar
    I have this login page with https, and i reach to this approach:: import ClientForm import urllib2 request = urllib2.Request("http://ritaj.birzeit.edu") response = urllib2.urlopen(request) forms = ClientForms.ParseResponseEx(response) response.close() f = forms[0] username = str(raw_input("Username: ")) password = str(raw_input("Password: ")) ## Here What To Do request2 = form.click() i get the controls of that page >>> f = forms[0] >>> [c.name for c in f.controls] ['q', 'sitesearch', 'sa', 'domains', 'form:mode', 'form:id', '__confirmed_p', '__refreshing_p', 'return_url', 'time', 'token_id', 'hash', 'username', 'password', 'persistent_p', 'formbutton:ok'] so how can i set the username and password controls of the "non-form form" f ??? and i have another problem,, how to know if its the right username and password ??

    Read the article

  • How to get progress bar to time Class exectution

    - by chrissygormley
    Hello, I am trying to use progress bar to show the progress of a script. I want it increase progress after every function in a class is executed. The code I have tried is below: import progressbar from time import sleep class hello(): def no(self): print 'hello!' def yes(self): print 'No!!!!!!' def pro(): bar = progressbar.ProgressBar(widgets=[progressbar.Bar('=', '[', ']'), ' ', progressbar.Percentage()]) for i in Yep(): bar.update(Yep.i()) sleep(0.1) bar.finish() if __name__ == "__main__": Yep = hello() pro() Does anyone know how to get this working. Thanks

    Read the article

  • Importing a spreadsheet into an asp.net program and listing the worksheets

    - by Bob Avallone
    I have to import the contents of a spreadsheet in my asp.net project. The code behind is c#. I figured out how to locate the spreadsheet on the user's computer and how to import the data from a given worksheet into a datable. The problem is I may not know the name of the worksheet ahead of time. I want to present the user with a list of available worksheets and have them pick one. That is the piece I don't know how to do. Thanks in advance. Bob Avallone

    Read the article

  • symfony/zend integration - blank screen

    - by user142176
    Hi, I need to use ZendAMF on a symfony project and I'm currently working on integrating the two. I have a frontend app with two modules, one of which is 'gateway' - the AMF gateway. In my frontend app config, I have the following in the configure function: // load symfony autoloading first parent::initialize(); // Integrate Zend Framework require_once('[MY PATH TO ZEND]\Loader.php'); spl_autoload_register(array('Zend_Loader', 'autoload')); The executeIndex function my the gateway actions.class.php looks like this // No Layout $this->setLayout(false); // Set MIME Type $this->getResponse()->setContentType('application/x-amf; charset='.sfConfig::get('sf_charset')); // Disable cause this is a non-html page sfConfig::set('sf_web_debug', false); // Create AMF Server $server = new Zend_Amf_Server(); $server->setClass('MYCLASS'); echo $server->handle(); return sfView::NONE; Now when I try to visit the url for the gateway module, or even the other module which was working perfectly fine until this attempt, I only see a blank screen, with not even the symfony dev bar loaded. Oddly enough, my symfony logs are not being updated as well, which suggests that Synfony is not even being 'reached'. So presumably the error has something to do with Zend, but I have no idea how to figure out what the error could be. One thing I do know for sure is that this is not a file path error, because if I change the path in the following line (a part of frontendConfiguration as shown above), I get a Zend_Amf_Server not found error. So the path must be correct. Also if I comment out this very same line, the second module resumes to normality, and my gateway broadcasts a blank x-amf stream. spl_autoload_register(array('Zend_Loader', 'autoload')); Does anyone have any tips on how I could attach this problem? Thanks P.S. I'm currently running an older version of Zend, which is why I am using Zend_Loader instead of Zend_autoLoader (I think). But I've tried switching to the new lib, but the error still remains. So it's not a version problem as well.

    Read the article

  • How to use less memory while running a task in Symfony 1.4?

    - by Guillaume Flandre
    I'm using Symfony 1.4 and Doctrine. So far I had no problem running tasks with Symfony. But now that I have to import a pretty big amount of data and save them in the database, I get the infamous "Fatal Error: Allowed memory size of XXXX bytes exhausted" During this import I'm only creating new objects, setting a few fields and saving them. I'm pretty sure it has something to do with the number of objects I'm creating when saving data. Unsetting those objects doesn't do anything though. Are there any best practices to limit memory usage in Symfony?

    Read the article

  • changing text color in custom UITableViewCell iphone

    - by Brodie4598
    Hello. I have a custom cell and when the user selects that cell, I would like the text in the two UILabels to change to light gray. ChecklistCell.h: #import <UIKit/UIKit.h> @interface ChecklistCell : UITableViewCell { UILabel *nameLabel; UILabel *colorLabel; BOOL selected; } @property (nonatomic, retain) IBOutlet UILabel *nameLabel; @property (nonatomic, retain) IBOutlet UILabel *colorLabel; @end ChecklistCell.m: #import "ChecklistCell.h" @implementation ChecklistCell @synthesize colorLabel,nameLabel; - (id)initWithStyle:(UITableViewCellStyle)style reuseIdentifier:(NSString *)reuseIdentifier { if ((self = [super initWithStyle:style reuseIdentifier:reuseIdentifier])) { // Initialization code } return self; } - (void)setSelected:(BOOL)selected animated:(BOOL)animated { [super setSelected:selected animated:animated]; // Configure the view for the selected state } - (void)dealloc { [nameLabel release]; [colorLabel release]; [super dealloc]; } @end

    Read the article

  • The dictionary need to add every word in SpellingMistakes and the line number but it only adds the l

    - by Will Boomsight
    modules import sys import string Importing and reading the files form the Command Prompt Document = open(sys.argv[1],"r") Document = open('Wc.txt', 'r') Document = Document.read().lower() Dictionary = open(sys.argv[2],"r") Dictionary = open('Dict.txt', 'r') Dictionary = Dictionary.read() def Format(Infile): for ch in string.punctuation: Infile = Infile.replace(ch, "") for no in string.digits: Infile = Infile.replace(no, " ") Infile = Infile.lower() return(Infile) def Corrections(Infile, DictWords): Misspelled = set([]) Infile = Infile.split() DictWords = DictWords.splitlines() for word in Infile: if word not in DictWords: Misspelled.add(word) Misspelled = sorted(Misspelled) return (Misspelled) def Linecheck(Infile,ErrorWords): Infile = Infile.split() lineno = 0 Noset = list() for line in Infile: lineno += 1 line = line.split() for word in line: if word == ErrorWords: Noset.append(lineno) sorted(Noset) return(Noset) def addkey(error,linenum): Nodict = {} for line in linenum: Nodict.setdefault(error,[]).append(linenum) return Nodict FormatDoc = Format(Document) SpellingMistakes = Corrections(FormatDoc,Dictionary) alp = str(SpellingMistakes) for word in SpellingMistakes: nSet = str(Linecheck(FormatDoc,word)) nSet = nSet.split() linelist = addkey(word, nSet) print(linelist) # # for word in Nodict.keys(): # Nodict[word].append(line) Prints each incorrect word on a new line

    Read the article

  • How to draw the "trail" in a maze solving application

    - by snow-spur
    Hello i have designed a maze and i want to draw a path between the cells as the 'person' moves from one cell to the next. So each time i move the cell a line is drawn Also i am using the graphics module The graphics module is an object oriented library Im importing from graphics import* from maze import* my circle which is my cell center = Point(15, 15) c = Circle(center, 12) c.setFill('blue') c.setOutline('yellow') c.draw(win) p1 = Point(c.getCenter().getX(), c.getCenter().getY()) this is my loop if mazez.blockedCount(cloc)> 2: mazez.addDecoration(cloc, "grey") mazez[cloc].deadend = True c.move(-25, 0) p2 = Point(getX(), getY()) line = graphics.Line(p1, p2) cloc.col = cloc.col - 1 Now it says getX not defined every time i press a key is this because of p2???

    Read the article

  • Is it possible to access variable of subclass using object of superclass in polymorphism

    - by fari
    how can i access state varibale of class keyboard with object of class kalaplayer /** * An abstract class representing a player in Kala. Extend this class * to make your own players (e.g. human players entering moves at the keyboard * or computer players with programmed strategies for making moves). */ public abstract class KalaPlayer { /** * Method by which a player selects a move. * @param gs The current game state * @return A side pit number in the range 1-6 * @throws NoMoveAvailableException if all side pits for the player are empty * (i.e. the game is over) */ public abstract int chooseMove(KalaGameState gs) throws NoMoveAvailableException; } public class KeyBoardPlayer extends KalaPlayer { /** * Method by which a player selects a move. * @param gs The current game state * @return A side pit number in the range 1-6 * @throws NoMoveAvailableException if all side pits for the player are empty * (i.e. the game is over) */ public KalaGameState state; public KeyBoardPlayer() { System.out.println("Enter the number of stones to play with: "); try { BufferedReader br = new BufferedReader(new InputStreamReader(System.in)); int key = Integer.parseInt(br.readLine()); state=new KalaGameState(key); //key=player1.state.turn; } catch(IOException e) { System.out.println(e); } } public int chooseMove(KalaGameState gs) throws NoMoveAvailableException{ return 0; } } import java.io.IOException; import java.io.BufferedReader; import java.io.InputStreamReader; public class KalaGame { KalaPlayer player1,player2; public KalaGame(KeyBoardPlayer Player1,KeyBoardPlayer Player2) { //super(0); player1=new KeyBoardPlayer(); player2 = new KeyBoardPlayer(); //player1=Player1; //player2=Player2; //player1.state ****how can i access the stae variable from Keyboard CLass using object from KalaPlayer key=player1.state.turn; } public void play() { System.out.println("Enter the number of stones to play with: "); try { BufferedReader br = new BufferedReader(new InputStreamReader(System.in)); int key = Integer.parseInt(br.readLine()); System.out.println(key); KalaGameState state=new KalaGameState(key); printGame(); } catch(IOException e) { System.out.println(e); } }

    Read the article

  • Lamp with mod_fastcgi

    - by Jonathan
    Hi! I am building a cgi application, and now I would like it to be like an application that stands and parses each connection, with this, I can have all session variables saved in memory instead of saving them to file(or anyother place) and loading them again on a new connection I am using lamp within a linux vmware but I can't seem to find how to install the module for it to work and what to change in the httpd.conf. I tried to compile the module, but I couldn't because my apache isn't a regular instalation, its a lamp already built one, and it seems that the mod needs the apache directory to be compiled. I saw some coding examples out there, so I guess is not that hard once its runing ok with Apache Can you help me with this please? Thanks, Joe

    Read the article

  • Strange problems with PHP SOAP (private variable not persist + variables passed from client not work

    - by Tamas Gal
    I have a very strange problems in a PHP Soap implementation. I have a private variable in the Server class which contains the DB name for further reference. The private variable name is "fromdb". I have a public function on the soap server where I can set this variable. $client-setFromdb. When I call it form my client works perfectly and the fromdb private variable can be set. But a second soap client call this private variable loses its value... Here is my soap server setup: ini_set('soap.wsdl_cache_enabled', 0); ini_set('session.auto_start', 0); ini_set('always_populate_raw_post_data', 1); global $config_dir; session_start(); /*if(!$HTTP_RAW_POST_DATA){ $HTTP_RAW_POST_DATA = file_get_contents('php://input'); }*/ $server = new SoapServer("{$config_dir['template']}import.wsdl"); $server-setClass('import'); $server-setPersistence(SOAP_PERSISTENCE_SESSION); $server-handle(); Problem is that I passed this to the server: $client = new SoapClient('http://import.ingatlan.net/wsdl', array('trace' = 1)); $xml=''; $xml.=''; $xml.=''; $xml.=''; $xml.='Valaki'; $xml.=''; $xml.=''; $xml.=''; $xml.=''; $tarray = array("type" = 1, "xml" = $xml); try{ $s = $client-sendXml( $tarray ); print "$s"; } catch( SOAPFault $exception){ print "--- SOAP exception :{$exception}---"; print "LAST REQUEST :"; var_dump($client-_getLastRequest()); print "---"; print "LAST RESPONSE :".$client-_getLastResponse(); } So passed an Array of informations to the server. Then I got this exception: LAST REQUEST : <?xml version="1.0" encoding="UTF-8"?> <SOAP-ENV:Envelope xmlns:SOAP-ENV="http://schemas.xmlsoap.org/soap/envelope/"><SOAP-ENV:Body><type>Array</type><xml/></SOAP-ENV:Body></SOAP-ENV:Envelope> Can you see the Array word between the type tag? Seems that the client only passed a reference or something like this. So I totaly missed :(

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • Write a program that allows the user to enter a string and then prints the letters of the String sep

    - by WM
    The output is always a String, for example H,E,L,L,O,. How could I limit the commas? I want the commas only between letters, for example H,E,L,L,O. import java.util.Scanner; import java.lang.String; public class forLoop { public static void main(String[] args) { Scanner Scan = new Scanner(System.in); System.out.print("Enter a string: "); String Str1 = Scan.next(); String newString=""; String Str2 =""; for (int i=0; i < Str1.length(); i++) { newString = Str1.charAt(i) + ","; Str2 = Str2 + newString; } System.out.print(Str2); } }

    Read the article

  • how can i see the profile field on registration page?

    - by Nitz
    Hey Guys, I have made customized user registration page. and i have made that on theme layer. But now i want to see the the fields which i have made in profile module. as i have written like this for <?php print drupal_render($form['account']['name']); ?> this code will show the user name field. which is default. now i want to see the profile fields which i have created on the profile module. So can any one tell me what i have to write in drupal_render[?]? Thanks in advance. Nitish Panchjanya Corporation

    Read the article

  • Python subprocess.Popen

    - by Albert
    I have that code: #!/usr/bin/python -u localport = 9876 import sys, re, os from subprocess import * tun = Popen(["./newtunnel", "22", str(localport)], stdout=PIPE, stderr=STDOUT) print "** Started tunnel, waiting to be ready ..." for l in tun.stdout: sys.stdout.write(l) if re.search("Waiting for connection", l): print "** Ready for SSH !" break The "./newtunnel" will not exit, it will constantly output more and more data to stdout. However, that code will not give any output and just keeps waiting in the tun.stdout. When I kill the newtunnel process externally, it flushes all the data to tun.stdout. So it seems that I can't get any data from the tun.stdout while it is still running. Why is that? How can I get the information? Note that the default bufsize for Popen is 0 (unbuffered). I can also specify bufsize=0 but that doesn't change anything.

    Read the article

  • Graphics glitch when drawing to a Cairo context obtained from a gtk.DrawingArea inside a gtk.Viewport.

    - by user410023
    I am trying to redraw the part of the DrawingArea that is visible in the Viewport in the expose-event handler. However, it seems that I am doing something wrong with the coordinates that are passed to the event handler because there is garbage at the edge of the Viewport when scrolling. Can anyone tell what I am doing wrong? Here is a small example: import pygtk pygtk.require("2.0") import gtk from numpy import array from math import pi class Circle(object): def init(self, position = [0., 0.], radius = 0., edge = (0., 0., 0.), fill = None): self.position = position self.radius = radius self.edge = edge self.fill = fill def draw(self, ctx): rect = array(ctx.clip_extents()) rect[2] -= rect[0] rect[3] -= rect[1] center = rect[2:4] / 2 ctx.arc(center[0], center[1], self.radius, 0., 2. * pi) if self.fill != None: ctx.set_source_rgb(*self.fill) ctx.fill_preserve() ctx.set_source_rgb(*self.edge) ctx.stroke() class Scene(object): class Proxy(object): directory = {} def init(self, target, layers = set()): self.target = target self.layers = layers Scene.Proxy.directory[target] = self def __init__(self, viewport): self.objects = {} self.layers = [set()] self.viewport = viewport self.signals = {} def draw(self, ctx): x = self.viewport.get_hadjustment().value y = self.viewport.get_vadjustment().value ctx.set_source_rgb(1., 1., 1.) ctx.paint() ctx.translate(x, y) for obj in self: obj.draw(ctx) def add(self, item, layer = 0): item = Scene.Proxy(item, layers = set((layer,))) assert(hasattr(item.target, "draw")) assert(isinstance(layer, int)) item.layers.add(layer) while not layer < len(self.layers): self.layers.append(set()) self.layers[layer].add(item) if not item in self.objects: self.objects[item] = set() self.objects[item].add(layer) def remove(self, item, layers = None): item = Scene.Proxy.directory[item] if layers == None: layers = self.objects[item] for layer in layers: layer.remove(item) item.layers.remove(layer) if len(item.layers) == 0: self.objects.remove(item) def __iter__(self): for layer in self.layers: for item in layer: yield item.target class App(object): def init(self): signals = { "canvas_exposed": self.update_canvas, "gtk_main_quit": gtk.main_quit } self.builder = gtk.Builder() self.builder.add_from_file("graphics_glitch.glade") self.window = self.builder.get_object("window") self.viewport = self.builder.get_object("viewport") self.canvas = self.builder.get_object("canvas") self.scene = Scene(self.viewport) signals.update(self.scene.signals) self.builder.connect_signals(signals) self.window.show() def update_canvas(self, widget, event): ctx = self.canvas.window.cairo_create() self.scene.draw(ctx) ctx.clip() if name == "main": app = App() scene = app.scene scene.add(Circle((0., 0.), 10.)) gtk.main() And the Glade file "graphics_glitch.glade": <?xml version="1.0"?> <interface> <requires lib="gtk+" version="2.16"/> <!-- interface-naming-policy project-wide --> <object class="GtkWindow" id="window"> <property name="width_request">200</property> <property name="height_request">200</property> <property name="visible">True</property> <signal name="destroy" handler="gtk_main_quit"/> <child> <object class="GtkScrolledWindow" id="scrolledwindow1"> <property name="visible">True</property> <property name="can_focus">True</property> <property name="hadjustment">h_adjust</property> <property name="vadjustment">v_adjust</property> <property name="hscrollbar_policy">automatic</property> <property name="vscrollbar_policy">automatic</property> <child> <object class="GtkViewport" id="viewport"> <property name="visible">True</property> <property name="resize_mode">queue</property> <child> <object class="GtkDrawingArea" id="canvas"> <property name="width_request">640</property> <property name="height_request">480</property> <property name="visible">True</property> <signal name="expose_event" handler="canvas_exposed"/> </object> </child> </object> </child> </object> </child> </object> <object class="GtkAdjustment" id="h_adjust"> <property name="lower">-1000</property> <property name="upper">1000</property> <property name="step_increment">1</property> <property name="page_increment">25</property> <property name="page_size">25</property> </object> <object class="GtkAdjustment" id="v_adjust"> <property name="lower">-1000</property> <property name="upper">1000</property> <property name="step_increment">1</property> <property name="page_increment">25</property> <property name="page_size">25</property> </object> </interface> Thanks! --Dan

    Read the article

  • How Long: Converting HTML to Jooma pages

    - by George
    Hello Everyone, I would really appreciate your help with finding out how long it takes a 1-3 year experenced programmer to convert a few HTML pages into joomla 1.5 dynamic pages. I know that some of it depends on how complex the pages are but i'm talking about average pages. That's my first question, my other question is how long will it take a 1-3 year experenced programmer to install all of these componants: Video module, photo gallery module, vertuemart shopping cart. I pay programmers to do this work but i have to make as sure as i can that i'm not over paying them. Thanks in advance for answering these two questions...George

    Read the article

  • python lxml problem

    - by David ???
    I'm trying to print/save a certain element's HTML from a web-page. I've retrieved the requested element's XPath from firebug. All I wish is to save this element to a file. I don't seem to succeed in doing so. (tried the XPath with and without a /text() at the end) I would appreciate any help, or past experience. 10x, David import urllib2,StringIO from lxml import etree url='http://www.tutiempo.net/en/Climate/Londres_Heathrow_Airport/12-2009/37720.htm' seite = urllib2.urlopen(url) html = seite.read() seite.close() parser = etree.HTMLParser() tree = etree.parse(StringIO.StringIO(html), parser) xpath = "/html/body/table/tbody/tr/td[2]/div/table/tbody/tr[6]/td/table/tbody/tr/td[3]/table/tbody/tr[3]/td/table/tbody/tr/td/table/tbody/tr/td/table/tbody/text()" elem = tree.xpath(xpath) print elem[0].strip().encode("utf-8")

    Read the article

  • trouble to connect with AppStore in my InAppPurchase application(iPhone)

    - by riteshkumar1905
    There is problem to connect AppStore in my application. All things run fine in Simulator.But When i go with iPhone then AppStore is not connected.. I am also enclose the code which i call on button....... import "BuyController.h" import "InAppPurchaseManager.h" import "SKProducts.h" define kInAppPurchaseProUpgradeProductId @"com.vigyaapan.iWorkOut1" @implementation BuyController (IBAction)buy:(id)sender { /* get the product description (defined in early sections)*/ //[self requestProUpgradeProductData]; { if ([SKPaymentQueue canMakePayments]) { InAppPurchaseManager *Observer = [[InAppPurchaseManager alloc] init]; [[SKPaymentQueue defaultQueue] addTransactionObserver:Observer]; //NSURL *sandboxStoreURL = [[NSURL alloc]initWithString:@"http://sandbox.itunes.apple.com/verifyReceipt"]; //[[UIApplication sharedApplication]openURL:[NSURL URLWithString:@"http://sandbox.itunes.apple.com"]]; [[UIApplication sharedApplication] openURL:[NSURL URLWithString:@"http://phobos.apple.com/WebObjects/ com.vigyaapan.iWorkOut1?id=9820091347&;amp;amp;amp;amp;mt=8"]]; //[[UIApplication sharedApplication] openURL:[NSURL URLWithString:@"http://phobos.apple.com/WebObjects/MZStore.woa/wa/viewSoftware?id=301349397&;amp;amp;amp;amp;mt=8"]]; SKPayment *payment = [SKPayment paymentWithProductIdentifier:@"com.vigyaapan.iWorkOut1"]; [[SKPaymentQueue defaultQueue] addPayment:payment]; } else { UIAlertView *alert = [[UIAlertView alloc] initWithTitle:@"MyApp" message:@"You are not authorized to purchase from AppStore" delegate:self cancelButtonTitle:@"OK" otherButtonTitles: nil]; [alert show]; [alert release]; } //return [SKPaymentQueue canMakePayments]; } SKPayment *payment = [SKPayment paymentWithProductIdentifier:kInAppPurchaseProUpgradeProductId]; [[SKPaymentQueue defaultQueue] addPayment:payment]; //[self requestProUpgradeProductData]; /* get the product description (defined in early sections)*/ } /* // The designated initializer. Override if you create the controller programmatically and want to perform customization that is not appropriate for viewDidLoad. - (id)initWithNibName:(NSString *)nibNameOrNil bundle:(NSBundle )nibBundleOrNil { if (self = [super initWithNibName:nibNameOrNil bundle:nibBundleOrNil]) { // Custom initialization } return self; }/ // Implement viewDidLoad to do additional setup after loading the view, typically from a nib. - (void)viewDidLoad { [super viewDidLoad]; } // Override to allow orientations other than the default portrait orientation. - (BOOL)shouldAutorotateToInterfaceOrientation:(UIInterfaceOrientation)interfaceOrientation { // Return YES for supported orientations return (interfaceOrientation == UIInterfaceOrientationPortrait); } (void)didReceiveMemoryWarning { // Releases the view if it doesn't have a superview. [super didReceiveMemoryWarning]; // Release any cached data, images, etc that aren't in use. } (void)viewDidUnload { // Release any retained subviews of the main view. // e.g. self.myOutlet = nil; } (void)dealloc { [super dealloc]; } @end

    Read the article

  • SQLAlchemy automatically converts str to unicode on commit

    - by Victor Stanciu
    Hello, When inserting an object into a database with SQLAlchemy, all it's properties that correspond to String() columns are automatically transformed from <type 'str'> to <type 'unicode'>. Is there a way to prevent this behavior? Here is the code: from sqlalchemy import create_engine, Table, Column, Integer, String, MetaData from sqlalchemy.orm import mapper, sessionmaker engine = create_engine('sqlite:///:memory:', echo=False) metadata = MetaData() table = Table('projects', metadata, Column('id', Integer, primary_key=True), Column('name', String(50)) ) class Project(object): def __init__(self, name): self.name = name mapper(Project, table) metadata.create_all(engine) session = sessionmaker(bind=engine)() project = Project("Lorem ipsum") print(type(project.name)) session.add(project) session.commit() print(type(project.name)) And here is the output: <type 'str'> <type 'unicode'> I know I should probably just work with unicode, but this would involve digging through some third-party code and I don't have the Python skills for that yet :)

    Read the article

  • pitchbend (varispeed) audio with iPhone SDK's AudioUnit

    - by fetzig
    hi, I'm trying to manipulate the speed (and pitch) of a sound while playing. so i played around with iphone sdk's AudioUnit. downloaded iPhoneMultichannelMixerTest and tried to add an AUComponent to the graph (in this case a formatconverter). but i get (pretty soon) following error when building: #import <AudioToolbox/AudioToolbox.h> #import <AudioUnit/AudioUnit.h> ... AUComponentDescription varispeed_desc(kAudioUnitType_FormatConverter, kAudioUnitSubType_Varispeed, kAudioUnitManufacturer_Apple); ^^ error: 'kAudioUnitSubType_Varispeed' was not declared in this scope. any ideas why? the documentation on this topic doesn't help me at all (just api doc isn't very helpful when having no clue about the concept behind). there are no examples on how to wire these effects together and manipulating there properties...so maybe i'm totally wrong, anyway any hint is great. thx for help.

    Read the article

  • Why is the destructor called when the CPython garbage collector is disabled?

    - by Frederik
    I'm trying to understand the internals of the CPython garbage collector, specifically when the destructor is called. So far, the behavior is intuitive, but the following case trips me up: Disable the GC. Create an object, then remove a reference to it. The object is destroyed and the __del__ method is called. I thought this would only happen if the garbage collector was enabled. Can someone explain why this happens? Is there a way to defer calling the destructor? import gc import unittest _destroyed = False class MyClass(object): def __del__(self): global _destroyed _destroyed = True class GarbageCollectionTest(unittest.TestCase): def testExplicitGarbageCollection(self): gc.disable() ref = MyClass() ref = None # The next test fails. # The object is automatically destroyed even with the collector turned off. self.assertFalse(_destroyed) gc.collect() self.assertTrue(_destroyed) if __name__=='__main__': unittest.main() Disclaimer: this code is not meant for production -- I've already noted that this is very implementation-specific and does not work on Jython.

    Read the article

  • Python and Plone help

    - by Grenko
    Im using the plone cms and am having trouble with a python script. I get a name error "the global name 'open' is not defined". When i put the code in a seperate python script it works fine and the information is being passed to the python script becuase i can print the query. Code is below: #Import a standard function, and get the HTML request and response objects. from Products.PythonScripts.standard import html_quote request = container.REQUEST RESPONSE = request.RESPONSE # Insert data that was passed from the form query=request.query #print query f = open("blast_query.txt","w") for i in query: f.write(i) return printed I also have a second question, can i tell python to open a file in in a certain directory for example, If the script is in a certain loaction i.e. home folder, but i want the script to open a file at home/some_directory/some_directory can it be done?

    Read the article

< Previous Page | 249 250 251 252 253 254 255 256 257 258 259 260  | Next Page >