Search Results

Search found 1242 results on 50 pages for 'ioexception'.

Page 26/50 | < Previous Page | 22 23 24 25 26 27 28 29 30 31 32 33  | Next Page >

  • Google App Engine modifyThreadGroup problem

    - by Frank
    I'm using Google App Engine to process Paypal IPN messages, when my servlet starts I use the following lines to start another process to process massages : public class PayPal_Monitor_Servlet extends HttpServlet { PayPal_Message_To_License_File_Worker PayPal_message_to_license_file_worker; public void init(ServletConfig config) throws ServletException // Initializes the servlet. { super.init(config); PayPal_message_to_license_file_worker=new PayPal_Message_To_License_File_Worker(); } public void doGet(HttpServletRequest request,HttpServletResponse response) throws IOException { } ... } public class PayPal_Message_To_License_File_Worker implements Runnable { static Thread PayPal_Message_To_License_File_Thread; ... PayPal_Message_To_License_File_Worker() { start(); } void start() { if (PayPal_Message_To_License_File_Thread==null) { PayPal_Message_To_License_File_Thread=new Thread(this); PayPal_Message_To_License_File_Thread.setPriority(Thread.MIN_PRIORITY); PayPal_Message_To_License_File_Thread.start(); } ... } But "PayPal_Message_To_License_File_Thread=new Thread(this);" is causing the following error : javax.servlet.ServletContext log: unavailable java.security.AccessControlException: access denied (java.lang.RuntimePermission modifyThreadGroup) at java.security.AccessControlContext.checkPermission(AccessControlContext.java:355) at java.security.AccessController.checkPermission(AccessController.java:567) Why, how to fix it ? Frank

    Read the article

  • Problem with building with csc task in Ant

    - by Wing C. Chen
    I have an ant build target using csc: <target name="compile"> <echo>Starting compiling ServiceLauncher</echo> <csc optimize="true" debug="true" warnLevel="1" unsafe="false" targetType="exe" failonerror="true" incremental="false" mainClass = "ServiceLauncher.Launcher" srcdir="ServiceLauncher/Launcher/" outputfile="ServiceLauncher.exe" > <reference file="libs/log4net.dll"/> <define name="RELEASE"/> </csc> </target> When I run it, the following exception comes up: csc failed: java.io.IOException: Cannot run program "csc": CreateProcess error=2, The system cannot find the file specified However, it runs without the exception but never correctly builds the .exe file, when I manually add in an empty ServiceLauncher.exe. How can I correctly build this .Net project "ServiceLauncher"?

    Read the article

  • Why would a error get thrown inside my try-catch?

    - by George Johnston
    I'm pushing a copy of our application over to a new dev server (IIS7) and the application is blowing up on a line inside of a try-catch block. It doesn't happen locally, it actually obey's the rules of a try-catch block, go figure. Any idea why this would be happening? Shouldn't it just be failing silently? Is there something environmental I need to enable/disable? Exception Details: System.NullReferenceException: Object reference not set to an instance of an object. Line 229: Try Line 230: Here >> : _MemoryStream.Seek(6 * StartOffset, 0) Line 232: _MemoryStream.Read(_Buffer, 0, 6) Line 233: Catch ex As IOException End Try Although it doesn't matter for answering this question, I thought I would mention that it's third party code for the Geo IP lookup.

    Read the article

  • Limit Connections with semaphores

    - by Robert
    I'm trying to limit the number of connections my server will accept using semaphores, but when running, my code doesn't seem to make this restriction - am I using the semaphore correctly? eg. I have hardcoded the number of permit as 2, but I can connect an unlimited number of clients... public class EServer implements Runnable { private ServerSocket serverSocket; private int numberofConnections = 0; private Semaphore sem = new Semaphore(2); private volatile boolean keepProcessing = true; public EServer(int port) throws IOException { serverSocket = new ServerSocket(port); } @Override public void run() { while (keepProcessing) { try { sem.acquire(); Socket socket = serverSocket.accept(); process(socket, getNextConnectionNumber()); } catch (Exception e) { } finally { sem.release(); } } closeIgnoringException(serverSocket); } private synchronized int getNextConnectionNumber() { return ++numberofConnections; } // processing related methods }

    Read the article

  • Multiple schema validation in Java

    - by user279554
    Hi, I am trying to do multiple schema validation in Java. I don't understand where I am doing wrong. Any help will be appreciated. abc.xsd <?xml version="1.0" encoding="UTF-8"?> <xsd:schema xmlns:xsd="http://www.w3.org/2001/XMLSchema" xmlns:xn="project-xml-r4j_another.xsd"> <xsd:import namespace="project-xml-r4j_another.xsd"/> <xsd:element name="abc" type="abc"> </xsd:element> <xsd:complexType name="abc"> <xsd:sequence> <xsd:element name="test" type="test" minOccurs="0" maxOccurs="1"> </xsd:element> <!--<xsd:element name="proj" type="xn:proj"/>--> </xsd:sequence> <xsd:attribute name="id" type="xsd:ID" use="required"/> </xsd:complexType> <xsd:complexType name="test"> <xsd:attribute name="id" type="xsd:ID" use="required"></xsd:attribute> <xsd:attribute name="value" use="required"> <xsd:simpleType> <xsd:restriction base="xsd:string"> <xsd:maxLength value="100" /> </xsd:restriction> </xsd:simpleType> </xsd:attribute> </xsd:complexType> </xsd:schema> project-xml-r4j_another.xsd <?xml version="1.0" encoding="UTF-8"?> <xsd:schema xmlns:xsd="http://www.w3.org/2001/XMLSchema" targetNamespace="project-xml-r4j_another.xsd" xmlns="project-xml-r4j_another.xsd" elementFormDefault="qualified" attributeFormDefault="unqualified"> <xsd:element name="proj" type="proj"> <xsd:annotation> <xsd:documentation> The project is the root tag of a project-xml. </xsd:documentation> </xsd:annotation> </xsd:element> <xsd:complexType name="proj"> <xsd:attribute name="id" type="xsd:ID" use="required"/> </xsd:complexType> </xsd:schema> Test case package test; import java.io.File; import java.io.IOException; import javax.xml.XMLConstants; import javax.xml.transform.Source; import javax.xml.transform.stream.StreamSource; import javax.xml.validation.Schema; import javax.xml.validation.SchemaFactory; import javax.xml.validation.Validator; import org.apache.log4j.Logger; import org.junit.Test; import org.xml.sax.SAXException; import org.xml.sax.SAXParseException; import org.xml.sax.helpers.DefaultHandler; import com.ericsson.ccrtool.core.project.projectxml.InvalidProjectXmlException; public class TestSchema { private static final Logger logger = Logger.getLogger(TestSchema.class); static final String W3C_XML_SCHEMA = XMLConstants.W3C_XML_SCHEMA_NS_URI; @Test public void test() { System.out.println("TestSchema.test()"); try { SchemaFactory schemaFactory = SchemaFactory.newInstance(W3C_XML_SCHEMA); // create a grammar object. Source [] source = { new StreamSource(new File("C:\\jaydeep\\Ericsson\\R5B\\abc.xsd")), new StreamSource(new File("C:\\jaydeep\\Ericsson\\R5B\\project-xml-r4j.xsd"))}; Schema schemaGrammar = schemaFactory.newSchema(source); Validator schemaValidator = schemaGrammar.newValidator(); schemaValidator.setErrorHandler(new MessageHandler()); // validate xml instance against the grammar. schemaValidator.validate(new StreamSource("C:\\jaydeep\\Ericsson\\R5B\\project_tmmk17cells_xnaveen_project-xml.xml")); } catch (SAXException e) { throw new InvalidProjectXmlException("Project-xml validation failed, Exception: " + e.getMessage(), e); } catch (IOException e) { throw new InvalidProjectXmlException("Project-xml validation failed, Exception: " + e.getMessage(), e); } } class MessageHandler extends DefaultHandler { private String errMessage = ""; @Override public void warning(SAXParseException e) { logger.info("Warning Line " + e.getLineNumber() + ": " + e.getMessage()); } @Override public void error(SAXParseException e) { errMessage = new String("Error Line " + e.getLineNumber() + ": " + e.getMessage()); logger.info(errMessage); throw new InvalidProjectXmlException("Project-xml validation failed, Exception: " + errMessage); } @Override public void fatalError(SAXParseException e) { errMessage = new String("Error Line " + e.getLineNumber() + ": " + e.getMessage()); logger.info(errMessage); throw new InvalidProjectXmlException("Project-xml validation failed, Exception: " + errMessage); } } } Thanks, Jaydeep

    Read the article

  • The system cannot find the path specified with FileWriter

    - by Nazgulled
    Hi, I have this code: private static void saveMetricsToCSV(String fileName, double[] metrics) { try { FileWriter fWriter = new FileWriter( System.getProperty("user.dir") + "\\output\\" + fileTimestamp + "_" + fileDBSize + "-" + fileName + ".csv" ); BufferedWriter csvFile = new BufferedWriter(fWriter); for(int i = 0; i < 4; i++) { for(int j = 0; j < 5; j++) { csvFile.write(String.format("%,10f;", metrics[i+j])); } csvFile.write(System.getProperty("line.separator")); } csvFile.close(); } catch(IOException e) { System.out.println(e.getMessage()); } } But I get this error: C:\Users\Nazgulled\Documents\Workspace\Só Amigos\output\1274715228419_5000-List-ImportDatabase.csv (The system cannot find the path specified) Any idea why? I'm using NetBeans on Windows 7 if it matters...

    Read the article

  • Set Icon in Button LWUIT Java ME

    - by Muhamad Burhanudin
    Please help me, to set icon button : /* * To change this template, choose Tools | Templates * and open the template in the editor. */ package tajwed; import javax.microedition.midlet.*; import com.sun.lwuit.*; import com.sun.lwuit.animations.*; import com.sun.lwuit.events.*; import com.sun.lwuit.layouts.BoxLayout; import com.sun.lwuit.plaf.*; import java.io.IOException; import java.util.Hashtable; /** * @author Muhamad BUrhanudin */ public class tajwedMidlet extends MIDlet implements ActionListener{ Form mHomeForm; Form mAwayForm; Form mMenuTajwid; Command mExitCommand; Button btMenu; Button btNunSukun, btMimSukun, btNunTasjid; Button btLamtarif, btIdgham, btMaad, btRaa; Button btHelp; Button btExit; Command mBackCommand; public void startApp() { Display.init(this); installTheme(); createUI(); mHomeForm.show(); } public void pauseApp() { } public void destroyApp(boolean unconditional) { } public void actionPerformed(ActionEvent ae) { mAwayForm.setTransitionInAnimator( Transition3D.createCube(400, false)); mMenuTajwid.setTransitionInAnimator( Transition3D.createCube(400, false)); mMenuTajwid.setTransitionOutAnimator( Transition3D.createCube(400, true)); mAwayForm.setTransitionOutAnimator( Transition3D.createCube(400, true)); if ((ae.getSource()==btMenu)|| (ae.getSource()==btHelp)) { //mAwayForm.show(); if(ae.getSource()== btMenu) { mMenuTajwid.show(); } } else if (ae.getSource() == mBackCommand) { mHomeForm.show(); } else if ((ae.getCommand() == mExitCommand) || (ae.getSource()== btExit)) notifyDestroyed(); } private void installTheme() { UIManager uim = UIManager.getInstance(); Hashtable ht = new Hashtable(); ht.put("sel#" + Style.BG_COLOR, "ffffff"); ht.put(Style.BG_COLOR, "d5fff9"); ht.put(Style.FG_COLOR, "000000"); uim.setThemeProps(ht); } private void createUI() { // Set up screen for transitions. mAwayForm = new Form("Away"); mAwayForm.addComponent(new Label("Choose Back to return to the home screen.")); mMenuTajwid = new Form("MENU DASAR TAJWID"); // mMenuTajwid mMenuTajwid.setLayout(new BoxLayout(BoxLayout.Y_AXIS)); btNunSukun = new Button("Hukum Nun Sukun & Tanwin"); btNunSukun.addActionListener(this); mMenuTajwid.addComponent(btNunSukun); btMimSukun = new Button("Hukum Mim Sukun"); btMimSukun.addActionListener(this); mMenuTajwid.addComponent(btMimSukun); btNunTasjid = new Button("Hukum Nun Tasydid & Min Tasydid"); btNunTasjid.addActionListener(this); mMenuTajwid.addComponent(btNunTasjid); btLamtarif = new Button("Hukum Laam Ta'rief"); btLamtarif.addActionListener(this); mMenuTajwid.addComponent(btLamtarif); btIdgham = new Button("Idgham"); btIdgham.addActionListener(this); mMenuTajwid.addComponent(btIdgham); btMaad = new Button("Maad"); btMaad.addActionListener(this); mMenuTajwid.addComponent(btMaad); btRaa = new Button("Raa'"); btRaa.addActionListener(this); mMenuTajwid.addComponent(btRaa); mBackCommand = new Command("Back"); mMenuTajwid.addCommand(mBackCommand); mMenuTajwid.addCommandListener(this); // Use setCommandListener() with LWUIT 1.3 or earlier. // Set up main screen. mHomeForm = new Form("Java Mobile Learning"); mHomeForm.setLayout(new BoxLayout(BoxLayout.Y_AXIS)); btMenu = new Button("TAJWID LEARNING"); btMenu.addActionListener(this); mHomeForm.addComponent(btMenu); try { btHelp = new Button("HELP",Image.createImage("/help.ico")); btHelp.addActionListener(this); mHomeForm.addComponent(btHelp); } catch(IOException e) { } btExit = new Button("EXIT"); btExit.addActionListener(this); mHomeForm.addComponent(btExit); mExitCommand = new Command("Keluar"); mHomeForm.addCommand(mExitCommand); mHomeForm.addCommandListener(this); // Use setCommandListener() with LWUIT 1.3 or earlier. } }

    Read the article

  • Server returned HTTP response code: 500 for URL

    - by user617162
    java.io.IOException: Server returned HTTP response code: 500 for URL: http://ww .huadt.com.cn/zh-cn/i/l/@357671030745308@V500@0000@AUTOLOW@1@11d590f7$GPRMC,065 48.000,A,3959.8587,N,11617.2447,E,0.00,55.32,210311,,,A*56@@ at sun.net.www.protocol.http.HttpURLConnection.getInputStream(Unknown S urce) at hdt.SendCmdToP.Sendplatform(SendCmdToP.java:67) at hdt.SendCmdToP.process(SendCmdToP.java:198) at hdt.SendCmdToP.run(SendCmdToP.java:131) java.lang.NullPointerException at hdt.SendCmdToP.Sendplatform(SendCmdToP.java:91) at hdt.SendCmdToP.process(SendCmdToP.java:198) at hdt.SendCmdToP.run(SendCmdToP.java:131) Appeared pointer, and 500 wrong with the closure of the abnormal, a firewall relationship? If not is it code problems? Please help everybody see how to solve the problem. thanks?

    Read the article

  • Using a Filter to serve a specific page?

    - by user246114
    Hi, I am using a class which implements Filter for my jsp stuff. It looks like this: public class MyFilter implements Filter { public void doFilter(ServletRequest request, ServletResponse response, FilterChain chain) throws IOException, ServletException { request.getRequestDispatcher("mypage.jsp").forward(request, response); } } So the target, "mypage.jsp", is just sitting in my top-level directory. The filter works fine if I'm entering urls like: http://www.mysite.com/foo http://www.mysite.com/boo but if I enter a trailing slash, I'll get a 404: http://www.mysite.com/foo/ http://www.mysite.com/boo/ HTTP ERROR: 404 /foo/mypage.jsp RequestURI=/foo/mypage.jsp it seems if I enter the trailing slash, then the filter thinks I want it to look for mypage.jsp in subfolder foo or boo, but I really always want it to just find it at: http://www.mysite.com/mypage.jsp how can I do that? Thank you

    Read the article

  • Extract page from PDF using iText and clojure

    - by KobbyPemson
    I am trying to extract a single page from a pdf with clojure by translating the splitPDF method I found here http://viralpatel.net/blogs/itext-tutorial-merge-split-pdf-files-using-itext-jar/ I keep getting this error IOException Stream Closed java.io.FileOutputStream.writeBytes (:-2) This prevents me from opening the document while the repl is still open. Once I close the repl I'm able to access the document. Why do I get the error? How do I fix it ? How can I make it more clojurey? (import '(com.itextpdf.text Document) '(com.itextpdf.text.pdf PdfReader PdfWriter PdfContentByte PdfImportedPage BaseFont) '(java.io File FileInputStream FileOutputStream InputStream OutputStream)) (defn extract-page [src dest pagenum] (with-open [ d (Document.) os (FileOutputStream. dest)] (let [ srcpdf (->> src FileInputStream. PdfReader.) destpdf (PdfWriter/getInstance d os)] (doto d (.open ) (.newPage )) (.addTemplate (.getDirectContent destpdf) (.getImportedPage destpdf srcpdf pagenum) 0 0))))

    Read the article

  • StackExchange API key

    - by user21289
    I am working on a project with the StackExchange API, the problem is at a moment I have this Exception on eclipse console: java.io.IOException: Server returned HTTP response code: 400 for URL: https://api.stackexchange.com/2.1/questions?order=desc&sort=votes&tagged=OSM&site=stackoverflow at sun.net.www.protocol.http.HttpURLConnection.getInputStream(Unknown Source) at sun.net.www.protocol.https.HttpsURLConnectionImpl.getInputStream(Unknown Source) atbr.inf.pucrio.sog.StackOverflowAcessor.getQuestionsIds(StackOverflowAcessor.java:41) After verifying on the browser with the same link, I have this error message: {"error_id":502,"error_name":"throttle_violation","error_message":"too many requests from this IP, more requests available in 74089 seconds"} I am wondering if this is dur to the limited numbers of the queries per day, if it is the case, how can I do to have the key? if it is not, how can I do to resolve the problem?

    Read the article

  • Android file-creation fails.

    - by Alxandr
    I use the following code to create a folder "mymir" and a file ".nomedia" (in the mymir-folder) on the sdcard of an android unit. However, somehow it fails with the exception that the folder the ".nomedia"-file is to be placed in dosn't exist. Here's the code: private String EnsureRootDir() throws IOException { File sdcard = Environment.getExternalStorageDirectory(); File mymirFolder = new File(sdcard.getAbsolutePath() + "/mymir/"); if(!mymirFolder.exists()) { File noMedia = new File(mymirFolder.getAbsolutePath() + "/.nomedia"); noMedia.mkdirs(); noMedia.createNewFile(); } return mymirFolder.getAbsolutePath(); }

    Read the article

  • envets is not displayed on my fullcalendar

    - by ChangJiu
    Hi BalusC! I have used your method at above in my servelt. [CalendarMap] public void doGet(HttpServletRequest request, HttpServletResponse response) throws ServletException, IOException { Map map = new HashMap(); map.put("id", 115); map.put("title", "changjiu"); map.put("start", new SimpleDateFormat("yyyy-MM-15").format(new Date())); map.put("url", "http://yahoo.com/"); // Convert to JSON string. String json = new Gson().toJson(map); // Write JSON string. response.setContentType("application/json"); response.setCharacterEncoding("UTF-8"); response.getWriter().write(json); } I want to display it my fullcalendar as follow. $(document).ready(function() { $('#calendar').fullCalendar({ eventSources: [ "CalendarMap" ] }); }); but it's not worked! Can you help me? thank you!

    Read the article

  • ajax parameter to send correctly a variable to a specified url

    - by kawtousse
    I am trying to send data to a servlet from a js file but the servlet never received the parameter. so this is what I have: function showProject(prj) { xmlhttp=GetXmlHttpObject(); if (xmlhttp==null) { alert ("Browser does not support HTTP Request"); return; } var url="ServletxmlGenerator"; idprj = prj.options[prj.selectedIndex].value; //alert(idprj); url=url+"?idprj="+idprj; xmlhttp.onreadystatechange=stateChanged; xmlhttp.open("GET",url,true); xmlhttp.send(null); } and to capture th request it is with: public void doGet(HttpServletRequest request, HttpServletResponse response) throws ServletException, IOException { String projectcode=request.getParameter("idprj"); System.out.println("++++projectCode:=" +projectcode); the output is like: ++++projectCode:=null Can any one explain it to me it seems to be correct but i didnot find the error.Thinks

    Read the article

  • Which .NET class does represent the main CONTROLLER class for WebForms ?

    - by Renato Gama
    Hey guys, lately I was studying a bit of Java, when I was taught about a way to implement a controller class, whose resposibility is to redirect the request to an Action, which perfoms a specified work. That was the way I learnt; @Override protected void service(HttpServletRequest req, HttpServletResponse res) throws ServletException, IOException { try { String clazz = req.getRequestURI().replaceAll(req.getContextPath() + "/", "").replaceAll(".java", ""); ((Action)Class.forName("com.myProject.actions." + clazz).newInstance()).execute(req, res); } catch (Exception e) { e.printStackTrace(); } } I know that WebForms also works with HANDLERS, which are kind of actions. For example, each .aspx page inherits from a Page object which is a handler for that specified page. What I couldn't figure out is, which class does get request first and translate it to the specified action (page handler)? Is it a WebForms feature(implementation) or its a IIS resposibility? So, which class represent the main controller for WebForms? Thank you very much.

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • Sending the files (At least 11 files) from folder through web service to android app.

    - by Shashank_Itmaster
    Hello All, I stuck in middle of this situation,Please help me out. My question is that I want to send files (Total 11 PDF Files) to android app using web service. I tried it with below code.Main Class from which web service is created public class MultipleFilesImpl implements MultipleFiles { public FileData[] sendPDFs() { FileData fileData = null; // List<FileData> filesDetails = new ArrayList<FileData>(); File fileFolder = new File( "C:/eclipse/workspace/AIPWebService/src/pdfs/"); // File fileTwo = new File( // "C:/eclipse/workspace/AIPWebService/src/simple.pdf"); File sendFiles[] = fileFolder.listFiles(); // sendFiles[0] = fileOne; // sendFiles[1] = fileTwo; DataHandler handler = null; char[] readLine = null; byte[] data = null; int offset = 0; int numRead = 0; InputStream stream = null; FileOutputStream outputStream = null; FileData[] filesData = null; try { System.out.println("Web Service Called Successfully"); for (int i = 0; i < sendFiles.length; i++) { handler = new DataHandler(new FileDataSource(sendFiles[i])); fileData = new FileData(); data = new byte[(int) sendFiles[i].length()]; stream = handler.getInputStream(); while (offset < data.length && (numRead = stream.read(data, offset, data.length - offset)) >= 0) { offset += numRead; } readLine = Base64Coder.encode(data); offset = 0; numRead = 0; System.out.println("'Reading File............................"); System.out.println("\n"); System.out.println(readLine); System.out.println("Data Reading Successful"); fileData.setFileName(sendFiles[i].getName()); fileData.setFileData(String.valueOf(readLine)); readLine = null; System.out.println("Data from bean " + fileData.getFileData()); outputStream = new FileOutputStream("D:/" + sendFiles[i].getName()); outputStream.write(Base64Coder.decode(fileData.getFileData())); outputStream.flush(); outputStream.close(); stream.close(); // FileData fileDetails = new FileData(); // fileDetails = fileData; // filesDetails.add(fileData); filesData = new FileData[(int) sendFiles[i].length()]; } // return fileData; } catch (FileNotFoundException e) { e.printStackTrace(); } catch (IOException e) { e.printStackTrace(); } catch (Exception e) { e.printStackTrace(); } return filesData; } } Also The Interface MultipleFiles:- public interface MultipleFiles extends Remote { public FileData[] sendPDFs() throws FileNotFoundException, IOException, Exception; } Here I am sending an array of bean "File Data",having properties viz. FileData & FileName. FileData- contains file data in encoded. FileName- encoded file name. The Bean:- (FileData) public class FileData { private String fileName; private String fileData; public String getFileName() { return fileName; } public void setFileName(String fileName) { this.fileName = fileName; } public String getFileData() { return fileData; } public void setFileData(String string) { this.fileData = string; } } The android DDMS gives out of memory exception when tried below code & when i tried to send two files then only first file is created. public class PDFActivity extends Activity { private final String METHOD_NAME = "sendPDFs"; private final String NAMESPACE = "http://webservice.uks.com/"; private final String SOAP_ACTION = NAMESPACE + METHOD_NAME; private final String URL = "http://192.168.1.123:8080/AIPWebService/services/MultipleFilesImpl"; /** Called when the activity is first created. */ @Override public void onCreate(Bundle savedInstanceState) { super.onCreate(savedInstanceState); setContentView(R.layout.main); TextView textViewOne = (TextView) findViewById(R.id.textViewOne); try { SoapObject soapObject = new SoapObject(NAMESPACE, METHOD_NAME); SoapSerializationEnvelope envelope = new SoapSerializationEnvelope( SoapEnvelope.VER11); envelope.setOutputSoapObject(soapObject); textViewOne.setText("Web Service Started"); AndroidHttpTransport httpTransport = new AndroidHttpTransport(URL); httpTransport.call(SOAP_ACTION, envelope); // SoapObject result = (SoapObject) envelope.getResponse(); Object result = envelope.getResponse(); Log.i("Result", result.toString()); // String fileName = result.getProperty("fileName").toString(); // String fileData = result.getProperty("fileData").toString(); // Log.i("File Name", fileName); // Log.i("File Data", fileData); // File pdfFile = new File(fileName); // FileOutputStream outputStream = // openFileOutput(pdfFile.toString(), // MODE_PRIVATE); // outputStream.write(Base64Coder.decode(fileData)); Log.i("File", "File Created"); // textViewTwo.setText(result); // Object result = envelope.getResponse(); // FileOutputStream outputStream = openFileOutput(name, mode) } catch (Exception e) { e.printStackTrace(); } } } Please help with some explanation or changes in my code. Thanks in Advance.

    Read the article

  • Blackberry Development, java.lang.outofmemoryerror

    - by Nikesh Yadav
    Hi Forum, I am new to Blackberry development (I am using Eclipse with Blackberry plug-in), I am trying to read a text file, which I placed in the "src" folder of my Blackberry project and this text file just contain a word "Test". when I run the program, I gets "UncaughtException: java.lang.outofmemoryerror". Here is the code I am using, where "speech.txt" is the file I am trying to read and is placed in the "src" folder - public class SpeechMain extends MainScreen { public SpeechMain() { try { Class myClass = this.getClass(); InputStream is = null; is = myClass.getResourceAsStream("speech.txt"); InputStreamReader isr = new InputStreamReader(is); char c; while ((c = (char)isr.read()) != -1) { add(new LabelField("" + c)); } } catch (IOException e) { // TODO Auto-generated catch block e.printStackTrace(); add(new LabelField(e.getMessage())); } } } Thanks in advance. Thanks, Nikesh

    Read the article

  • Why does Java Logging API create so many files?

    - by rgksugan
    I am using java logging api to log errors in my exception. I am writing these errors to a log file. When i run my program i find a lot of files created.There are around 50 files created. Is there any mistake in my code or is it normal? Here goes the code try { logger = Logger.getLogger(Reciever.class.getName()); fileHandler = new FileHandler("Applicationlog.log", true); logger.addHandler(fileHandler); logger.setLevel(Level.ALL); SimpleFormatter formatter = new SimpleFormatter(); fileHandler.setFormatter(formatter); } catch (IOException ex) { logger.log(Level.SEVERE, null, ex); } catch (SecurityException ex) { logger.log(Level.SEVERE, null, ex); }

    Read the article

  • Problem with "scopes" of variables in try catch blocks in Java

    - by devoured elysium
    Could anyone explain me why in the last lines, br is not recognized as variable? I've even tried putting br in the try clause, setting it as final, etc. Does this have anything to do with Java not support closures? I am 99% confident similar code would work in C#. private void loadCommands(String fileName) { try { final BufferedReader br = new BufferedReader(new FileReader(fileName)); while (br.ready()) { actionList.add(CommandFactory.GetCommandFromText(this, br.readLine())); } } catch (FileNotFoundException e) { e.printStackTrace(); } catch (IOException e) { e.printStackTrace(); } finally { if (br != null) br.close(); //<-- This gives error. It doesn't // know the br variable. } } Thanks

    Read the article

  • PIG doesn't read my custom InputFormat

    - by Simon Guo
    I have a custom MyInputFormat that suppose to deal with record boundary problem for multi-lined inputs. But when I put the MyInputFormat into my UDF load function. As follow: public class EccUDFLogLoader extends LoadFunc { @Override public InputFormat getInputFormat() { System.out.println("I am in getInputFormat function"); return new MyInputFormat(); } } public class MyInputFormat extends TextInputFormat { public RecordReader createRecordReader(InputSplit inputSplit, JobConf jobConf) throws IOException { System.out.prinln("I am in createRecordReader"); //MyRecordReader suppose to handle record boundary return new MyRecordReader((FileSplit)inputSplit, jobConf); } } For each mapper, it print out I am in getInputFormat function but not I am in createRecordReader. I am wondering if anyone can provide a hint on how to hoop up my costome MyInputFormat to PIG's UDF loader? Much Thanks. I am using PIG on Amazon EMR.

    Read the article

  • Are there any reasons to make all fields and variables final?

    - by Roman
    In my current project I noticed that all class fields and variable inside methods are declared with final modifier whenever it's possible. Just like here: private final XMLStreamWriter _xmlStreamWriter; private final Marshaller _marshaller; private final OutputStream _documentStream; private final OutputStream _stylesStream; private final XMLStreamWriter _stylesStreamWriter; private final StyleMerger _styleMerger; public DocumentWriter(PhysicalPackage physicalPackage) throws IOException { final Package pkg = new Package(physicalPackage); final Part wordDocumentPart = pkg.createPart( "/word/document.xml", "application/vnd.openxmlformats-officedocument.wordprocessingml.document.main+xml", "http://schemas.openxmlformats.org/officeDocument/2006/relationships/officeDocument"); // styles.xml final Pair<Part, String> wordStylesPart = wordDocumentPart.createRelatedPart(...); ... } Are there any reasons to do so? p.s. As I know project is not supposed to be multithreaded (at least I've heard nothing about it).

    Read the article

  • Tomcat: recommandations for logging

    - by WizardOfOdds
    I've read several questions here concerning Tomcat and logging but I still really don't understand the "bigger picture", hence my question: How and where are my Webapps supposed to do their logging? By default on my setup Tomcat 6.0.20 logs go in the following file/appender: ./apache-tomcat-6.0.20/logs/catalina.out Am I suppose to have my webapps also log to this file/appender? Let say my case is trivially simple and I've got just one servlet: import ... // What do I import here in order to be able to log? public class SOServlet extends HttpServlet { public void doGet( final HttpServletRequest request, final HttpServletResponse response ) throws IOException, ServletException { ... // I want to log here, what do I write? What are the gotchas knowing that there are more than one webapp running on the same Tomcat? (apparently from reading the various questions there are many gotchas). What about the .war, do I need to put log4j/sl4f/commons-logging/whatever in my .war?

    Read the article

  • richfaces keepAlive not working

    - by Jurgen H
    I have a mediaOutput tag which, in its createContent attribute, requires the backing bean to be in a certain state. A list of values, which is filled in an init method, must be available. I therefore added a keepAlive tag for the whole backing bean. I now indeed see the backingBean in stead of some (richfaces) proxy bean, but the filled list is null again. How to make this possible? I checked that the init method was called and that the list is filled in in the init method. <a4j:keepAlive beanName="myBean" /> <a4j:mediaOutput createContent="#{myBean.writeChart}" ... /> The backing bean public class MyBean implements Serializable { public List list; public void init(ActionEvent event) { // call some resource to fill the list list = service.getItems(); } public void writeChart(final OutputStream out, final Object data) throws IOException { // list is null } // getters & setters }

    Read the article

  • Error while applying overlay on a location on a Google map in Android

    - by Hiccup
    This is my Activity for getting Location: public class LocationActivity extends MapActivity{ Bundle bundle = new Bundle(); MapView mapView; MapController mc; GeoPoint p; ArrayList <String> address = new ArrayList<String>(); List<Address> addresses; private LocationManager locationManager; double lat, lng; /** Called when the activity is first created. */ @Override public void onCreate(Bundle savedInstanceState) { super.onCreate(savedInstanceState); setContentView(R.layout.map); mapView = (MapView) findViewById(R.id.mapView1); mapView.displayZoomControls(true); mc = mapView.getController(); LocationManager lm = (LocationManager)getSystemService(Context.LOCATION_SERVICE); Criteria criteria = new Criteria(); // criteria.setAccuracy(Criteria.ACCURACY_FINE); criteria.setAltitudeRequired(false); criteria.setBearingRequired(false); criteria.setCostAllowed(true); String strLocationProvider = lm.getBestProvider(criteria, true); //Location location = lm.getLastKnownLocation(strLocationProvider); Location location = lm.getLastKnownLocation(LocationManager.NETWORK_PROVIDER); lat = (double) location.getLatitude(); lng = (double) location.getLongitude(); p = new GeoPoint( (int) (lat * 1E6), (int) (lng * 1E6)); mc.animateTo(p); mc.setZoom(17); MapOverlay mapOverlay = new MapOverlay(); List<Overlay> listOfOverlays = mapView.getOverlays(); listOfOverlays.clear(); listOfOverlays.add(mapOverlay); Geocoder gcd = new Geocoder(this, Locale.getDefault()); try { addresses = gcd.getFromLocation(lat,lng,1); if (addresses.size() > 0 && addresses != null) { address.add(addresses.get(0).getFeatureName()); address.add(addresses.get(0).getAdminArea()); address.add(addresses.get(0).getCountryName()); bundle.putStringArrayList("id1", address); } bundle.putDouble("lat", lat); bundle.putDouble("lon", lng); } catch (IOException e) { // TODO Auto-generated catch block e.printStackTrace(); } } class MapOverlay extends com.google.android.maps.Overlay { @Override public boolean draw(Canvas canvas, MapView mapView, boolean shadow, long when) { super.draw(canvas, mapView, shadow); //---translate the GeoPoint to screen pixels--- Point screenPts = new Point(); mapView.getProjection().toPixels(p, screenPts); //---add the marker--- Bitmap bmp = BitmapFactory.decodeResource( getResources(), R.drawable.logo); canvas.drawBitmap(bmp, screenPts.x, screenPts.y-50, null); return true; } @Override public boolean onTouchEvent(MotionEvent event, MapView mapView) { //---when user lifts his finger--- if (event.getAction() == 1) { Bundle bundle = new Bundle(); ArrayList <String> address = new ArrayList<String>(); GeoPoint p = mapView.getProjection().fromPixels( (int) event.getX(), (int) event.getY()); Geocoder geoCoder = new Geocoder( getBaseContext(), Locale.getDefault()); try { List<Address> addresses = geoCoder.getFromLocation( p.getLatitudeE6() / 1E6, p.getLongitudeE6() / 1E6, 1); addOverLay(); MapOverlay mapOverlay = new MapOverlay(); Bitmap bmp = BitmapFactory.decodeResource( getResources(), R.drawable.crumbs_logo); List<Overlay> listOfOverlays = mapView.getOverlays(); listOfOverlays.clear(); listOfOverlays.add(mapOverlay); String add = ""; if (addresses.size() > 0) { address.add(addresses.get(0).getFeatureName()); address.add(addresses.get(0).getLocality()); address.add(addresses.get(0).getAdminArea()); address.add(addresses.get(0).getCountryName()); bundle.putStringArrayList("id1", address); for(int i = 0; i <= addresses.size();i++) add += addresses.get(0).getAddressLine(i) + "\n"; } bundle.putDouble("lat", p.getLatitudeE6() / 1E6); bundle.putDouble("lon", p.getLongitudeE6() / 1E6); Toast.makeText(getBaseContext(), add, Toast.LENGTH_SHORT).show(); } catch (IOException e) { e.printStackTrace(); } return true; } else return false; } } public void onClick_mapButton(View v) { Intent intent = this.getIntent(); this.setResult(RESULT_OK, intent); intent.putExtras(bundle); finish(); } public void addOverLay() { MapOverlay mapOverlay = new MapOverlay(); List<Overlay> listOfOverlays = mapView.getOverlays(); listOfOverlays.clear(); listOfOverlays.add(mapOverlay); } @Override protected boolean isRouteDisplayed() { // TODO Auto-generated method stub return false; } public void FindLocation() { LocationManager locationManager = (LocationManager) this .getSystemService(Context.LOCATION_SERVICE); LocationListener locationListener = new LocationListener() { public void onLocationChanged(Location location) { // updateLocation(location); Toast.makeText( LocationActivity.this, String.valueOf(lat) + "\n" + String.valueOf(lng), 5000) .show(); } public void onStatusChanged(String provider, int status, Bundle extras) { } public void onProviderEnabled(String provider) { } public void onProviderDisabled(String provider) { } }; locationManager.requestLocationUpdates( LocationManager.NETWORK_PROVIDER, 0, 0, locationListener); } } I face two problems here. One is that when I click (do a tap) on any location, the overlay is not changing to that place. Also, the app crashes when I am on the MapView page and I click on back button. What might be the error?

    Read the article

< Previous Page | 22 23 24 25 26 27 28 29 30 31 32 33  | Next Page >