Search Results

Search found 49521 results on 1981 pages for 'text size'.

facebook twitter digg google delicious technorati stumbleupon myspace wordpress linkedin gmail igoogle windows live tumblr viadeo yahoo buzz yahoo mail yahoo bookmarks favorites email print

Page 26/1981 | < Previous Page | 22 23 24 25 26 27 28 29 30 31 32 33  | Next Page >

  • How to convert Xml files to Text Files 2

    - by John
    Hi all, I have around 8000 xml files that needs to be converted into text files. The text file must contain title, description and keywords of the xml file without the tags and removing other elements and attributes as well. In other words, i need to create 8000 text files containing the title,description and keywords of the xml file. I need codings for this to be done systematically. Any help would be greatly appreciated. Thanks in advance. Hey all thank you all so so much with your replies. Here's a sample of what my xml looks like: <?xml version="1.0"?> <metadata> <identifier>43productionsNightatthegraveyard</identifier> <title>Night at the graveyard</title> <collection>opensource_movies</collection> <mediatype>movies</mediatype> <resource>movies</resource> <upload_application appid="ccPublisher" version="2.2.1"/> <uploader>[email protected]</uploader> <description>una noche en el cementerio (terror)</description> <license>http://creativecommons.org/licenses/by-nc/3.0/</license> <title>Night at the graveyard</title> <format>Video</format> <adder>[email protected]</adder> <licenseurl>http://creativecommons.org/licenses/by-nc/3.0/</licenseurl> <year>2007</year> <keywords>Night,at,the,graveyard,43,productions</keywords> <holder>43 productions</holder> <publicdate>2007-04-11 19:52:28</publicdate> </metadata> And this would be the output: una noche en el cementerio (terror) Night at the graveyard Night,at,the,graveyard,43,productions This need to be saved with the same name but in text format. Thanks all so much if any more suggestions would be much appreciated.

    Read the article

  • Writing text file on local server MVC 2.0

    - by Liado
    Hi, i'm trying to write a text file on remote server, i'm using the following code: [AcceptVerbs(HttpVerbs.Post)] public ActionResult Index(UserModels model) { if (!ModelState.IsValid) { return View("Index"); } try { using (StreamWriter w = new StreamWriter(Server.MapPath(TEXT_FILE_NAME), true)) { w.WriteLine(model.Email.ToString()); // Write the text } } catch { } the folder is still empty, can someone help? what should be the problem? Thanks

    Read the article

  • Reading a Text file in xcode

    - by Nicolaj Zefting
    First off, I'm a complete beginner. This might be a stupid question, but here it goes: I'm currently working on an App than contains Latin texts that the users can view and read. I'm using Xcode 4 with the storybord function. Theway the app is built: user selects author - then the book - then app shows the text. I am kind of confused because i need to have various text files, depending on the users choice.

    Read the article

  • Generating text file from database

    - by Goldmember
    I have a requirement to hand-code an text file from data residing in a SQL table. Just wondering if there are any best practices here. Should I write it as an XMLDocument first and transform using XSL or just use Streamwriter and skip transformation altogether? The generated text file will be in EDIFACT format, so layout is very specific.

    Read the article

  • Android how to match text with images by pointing text and images with lines

    - by Shirisha
    I am trying to create app which is match text with appropriate images by pointing with line. I want to create app exactly same which is shown in the below image: can any one please give me an idea? This is my main class: public class MatchActivity extends Activity { ArrayAdapter<String> listadapter; float x1; float y1; float x2; float y2; @Override public void onCreate(Bundle savedInstanceState) { super.onCreate(savedInstanceState); setContentView(R.layout.main); String[] s1 = { "smiley1", "smiley2", "smiley3" }; ListView lv = (ListView) findViewById(R.id.text_list); ArrayList<String> list = new ArrayList<String>(); list.addAll(Arrays.asList(s1)); listadapter = new ArrayAdapter<String>(this, R.layout.rowtext, s1); lv.setAdapter(listadapter); GridView gv = (GridView) findViewById(R.id.image_list); gv.setAdapter(new ImageAdapter(this)); lv.setOnItemClickListener(new OnItemClickListener() { public void onItemClick(AdapterView<?> arg0, View v, int arg2, long arg3){ x1=v.getX(); y1=v.getY(); Log.d("list","text positions x1:"+x1+" y1:"+y1); } }); gv.setOnItemClickListener(new OnItemClickListener() { public void onItemClick(AdapterView<?> arg0, View v, int arg2, long arg3){ DrawView draw=new DrawView(MatchActivity.this); x2=v.getX(); y2=v.getY(); draw.position1.add(x1); draw.position1.add(y1); draw.position2.add( x2); draw.position2.add(y2); Log.d("list","image positions x2:"+x2+" y2:"+y2); LinearLayout ll=LinearLayout)findViewById(R.id.draw_line); ll.addView(draw); } }); } } This is my drawing class to draw a line: public class DrawView extends View { Paint paint = new Paint(); private List<Float> position1=new ArrayList<Float>(); private List<Float> position2=new ArrayList<Float>();; public DrawView(Context context) { super(context); invalidate(); Log.d("drawview","In DrawView class position1:"+position1+" position2:"+position2) ; } @Override public void onDraw(Canvas canvas) { super.onDraw(canvas); Log.d("on draw","IN onDraw() position1:"+position1+" position2:"+position2); assert position1.size() == position2.size(); for (int i = 0; i < position1.size(); i += 2) { float x1 = position1.get(i); float y1 = position1.get(i + 1); float x2 = position2.get(i); float y2 = position2.get(i + 1); paint.setColor(Color.BLACK); paint.setStrokeWidth(3); canvas.drawLine(x1,y1, x2,y2, paint); } } } Thanks in advance .

    Read the article

  • Text extra aliased(jagged) in IE - looks terrible - but OK in FF and Chrome

    - by jon
    I am building a website - http://www.efficaxdevelopment.com As you can see when you load the page(in IE) the text on the page that isn't an image or the menu looks terrible, while in FF and Chrome the text looks fine. you can view the source on the page and the css is here http://www.efficaxdevelopment.com/styles/mainstyle.css Also, the sliding bar over the menu appears a few pixels left of where it appears in FF and IE. Any ideas?

    Read the article

  • SQL SERVER – Size of Index Table for Each Index – Solution 2

    - by pinaldave
    Earlier I had ran puzzle where I asked question regarding size of index table for each index in database over here SQL SERVER – Size of Index Table – A Puzzle to Find Index Size for Each Index on Table. I had received good amount answers and I had blogged about that here SQL SERVER – Size of Index Table for Each Index – Solution. As a comment to that blog I have received another very interesting comment and that provides near accurate answers to original question. Many thanks to Rama Mathanmohan for providing wonderful solution. SELECT OBJECT_NAME(i.OBJECT_ID) AS TableName, i.name AS IndexName, i.index_id AS IndexID, 8 * SUM(a.used_pages) AS 'Indexsize(KB)' FROM sys.indexes AS i JOIN sys.partitions AS p ON p.OBJECT_ID = i.OBJECT_ID AND p.index_id = i.index_id JOIN sys.allocation_units AS a ON a.container_id = p.partition_id GROUP BY i.OBJECT_ID,i.index_id,i.name ORDER BY OBJECT_NAME(i.OBJECT_ID),i.index_id Let me know if you have any better script for the same. Reference: Pinal Dave (http://blog.sqlauthority.com) Filed under: Pinal Dave, Readers Contribution, SQL, SQL Authority, SQL Data Storage, SQL Index, SQL Performance, SQL Query, SQL Scripts, SQL Server, SQL Tips and Tricks, T SQL, Technology

    Read the article

  • Appcelerator Titanium - auto height table views break with shortish text

    - by ceejayoz
    I posted this on the Appcelerator Titanium dev Q&A site, but maybe someone here has had this issue... KitchenSink 1.1 illustrates this issue. In table_view_api_auto_height.js, changing row: addRow(0,'This is some long text. This is some long text. This is some long text. This is some long text. This is some long text. This is some long text. This is some long text. This is some long text. This is some long text. This is some long text. This is some long text. This is some long text. This is some long text. This is some long text. This is some long text. This is some long text. This is some long text. This is some long text.'); to something like: addRow(0,'This is some long text. This is some long text.'); results in incorrect left padding on the row. See screenshot:

    Read the article

  • Increase the size of Taskbar Preview Thumbnails in Windows 7

    - by Matthew Guay
    Taskbar thumbnail previews are incredibly useful in Windows 7, but for some users they may be too small.  Here’s a tool to help you make your taskbar thumbnail previews just like you want them. A few years ago we featured a tool to increase the size of your thumbnail previews in Windows Vista, but unfortunately this application doesn’t work correctly in Windows 7.  However, there is a new tool for Windows 7 that lets you customize your taskbar thumbnail previews even more in Windows 7.  With it, you can change almost anything about your taskbar thumbnail previews.  The default taskbar thumbnails are nice, but may be too small for users with vision problems or with very high resolution monitors.  Whatever your need, this is a great tool to make the thumbnails looks and work just like you want. Let’s get started Download the Windows 7 Taskbar Thumbnail Customizer (link below), and unzip the files.  Run the Windows 7 Taskbar Thumbnail Customizer when you’re done.  Simply double-click on it; you don’t need to run it as administrator. Now, you change the size, spacing, margin, and delay time of your taskbar thumbnails.  The Delay Time setting is very handy; to speed things up, we set it to 0 so there’s no delay between when you mouse-over a taskbar icon to when you see the thumbnail.  Simply drag the slider to the size (or time in the delay settings) you want, and click Apply settings.  Windows Explorer will automatically restart, and your new taskbar thumbnails will be ready to use. Here is the default Windows 7 thumbnail preview of a video playing in Media player: And here’s the taskbar thumbnail enlarged to 380px.  Now you can really watch a video from your taskbar thumbnail. The larger taskbar thumbnails show up a little different in Internet Explorer.  It shows a larger preview of your active tab, and smaller previews of your other tabs.  Notice also that Aero peek shows the tab you’re hovering over in Internet Explorer, but the tab name in IE’s toolbar doesn’t change to the one you’re previewing.   Here we increased the width between the thumbnails, while keeping the thumbnails at their default size.  This could be useful if you have trouble selecting the correct preview, and we can imagine it would be a very useful modification on touch screens. And, if you ever take your changes too far, and want to revert to your default Windows 7 taskbar thumbnail previews, simply run the Customizer again and select Restore Defaults.  Windows Explorer will restart again, and your taskbar thumbnails will be back to their default settings.   Conclusion This tool makes it safe and easy to change the size, spacing, and more of your taskbar thumbnail previews.  And since you can always revert to the default settings, you can experiment without fear of messing up your computer.  If you’d prefer to change the settings manually without using a dedicated application, here’s a list of the registry changes you can make to accomplish this by hand. Link Download the Windows 7 Taskbar Thumbnail Customizer from The Windows Club Vista Users: Increase Size of Windows Vista Taskbar Previews Similar Articles Productive Geek Tips Bounty(Paid!) for Increasing Windows Vista Taskbar Preview SizeGet Vista Taskbar Thumbnail Previews in Windows XPVista Style Popup Previews for Firefox TabsIncrease Size of Windows Vista Taskbar PreviewsWhat is dwm.exe And Why Is It Running? TouchFreeze Alternative in AutoHotkey The Icy Undertow Desktop Windows Home Server – Backup to LAN The Clear & Clean Desktop Use This Bookmarklet to Easily Get Albums Use AutoHotkey to Assign a Hotkey to a Specific Window Latest Software Reviews Tinyhacker Random Tips DVDFab 6 Revo Uninstaller Pro Registry Mechanic 9 for Windows PC Tools Internet Security Suite 2010 Are You Blocked On Gtalk? Find out Discover Latest Android Apps On AppBrain The Ultimate Guide For YouTube Lovers Will it Blend? iPad Edition Penolo Lets You Share Sketches On Twitter Visit Woolyss.com for Old School Games, Music and Videos

    Read the article

  • Webrat says it can't find some text, but the text is actually there

    - by Jason
    I have a webpage that has a form button on it called "delete", and a cuke scenario that has the line: And I should see "delete" When I run the scenario, I get this error: expected the following element's content to include "delete" ...and it dumps the webrat page to stdout and the "delete" is, in fact, not there. So far so good. However, when I tell webrat to show me the page before the error happens: Then show me the page And I should see "delete" ...Safari fires up and shows me the page, and in Safari there's the "delete" button, totally there. Why is webrat not finding the form button? I've also had this same problem with form fields, such as text inputs that have a value in them when the page loads, but webrat says there's nothing there. Looking at it in Safari shows, again, that the field does have the right text in it. Is this a bug, or is webrat just not suitable for checking form elements? Is there a different way to do this? Thanks!

    Read the article

  • Bad FPS for smaller size (OpenGL ES with SDL)

    - by ber4444
    If you saw my other question, well, there is still a little problem: Click here to watch on youtube Basically, the frame rate is very bad on the actual device, where for some reason the animation is scaled (it looks like the left side on the video). It is quite fast on the simulator where it is not scaled (right side). For a test, I submitted this new changeset that hard-codes the smaller size (plus increases the point size for HII regions to make the dust clouds more visible), and as you see in the video, now it is slow even in the simulator (left side shows the small size, right side shows the original size -- otherwise the code is the same). I'm clueless why it's soooo slow with a smaller galaxy, in fact it should be FASTER. As for general speed optimization (which is not strictly part of my question but is closely related to it, esp. if we need a workaround to speed things up), some initial ideas: reducing the number of items drawn may affect the appearance negatively but screen resolution could be reduced there are too many glBegin(GL_POINTS)/glEnd() blocks, we could draw more than just a single star at once

    Read the article

  • Mouse pointer size problem

    - by Rasmus Pedersen
    My mouse cursor is double the normal size. Its only the default pointer that is enlarged. Variations like resize, busy and so on are the correct size. The problem persists even when I change cursor theme. If I move the cursor inside a Firefox window it changes to the correct size. My resolution is 2560x1440, its a single screen setup. Nvidia-settings reports my DPI to be: 108x107. I've tired to force that DPI in the LightDM conf, since I figured it must have something to-do with the DPI calculation. I have tried to change the cursor size through dconf but the problem still remains. I haven't seen this problem before, it arrived after the upgrade from Beta 2 to release version of Ubuntu 11.10. Anybody got any idea what the problem might be, its pretty annoying with the huge cursor.

    Read the article

  • SQL SERVER Size of Index Table for Each Index Solution 2

    Earlier I had ran puzzle where I asked question regarding size of index table for each index in database over here SQL SERVER Size of Index Table A Puzzle to Find Index Size for Each Index on Table. I had received good amount answers and I had blogged about that here SQL SERVER [...]...Did you know that DotNetSlackers also publishes .net articles written by top known .net Authors? We already have over 80 articles in several categories including Silverlight. Take a look: here.

    Read the article

  • Change input text to regular text on blur and ability to edit jQuery

    - by eknown
    I'm creating a form where I'm eliminating the use of a save button. The form is made up of input text boxes and textareas. After the user enters data into the input field, I want to trigger an onBlur function and change the input into a span that contains the information that the user entered. I also want to have the ability to edit this information, so if the user clicks on the newly created span with text, it will turn back into the input field with the current information for their editing pleasure. For reference, I'm looking to have a functionality pretty much like on editing a photo title on Flickr. If possible, I'd also like to have the textbox show "saving..." for half a second after the blur to reflect interaction with server.

    Read the article

  • SQL Azure Database Size Calculator

    - by kaleidoscope
    A neat trick on how to measure your database size in SQL Azure.  Here are the exact queries you can run to do it: Select Sum (reserved_page_count) * 8.0 / 1024 From sys.dm_db_partition_stats GO Select sys.objects.name, sum (reserved_page_count) * 8.0 / 1024 From sys.dm_db_partition_stats, sys.objects Where sys.dm_db_partition_stats.object_id = sys.objects.object_id Group by sys.objects.name The first one will give you the size of your database in MB and the second one will do the same, but break it out for each object in your database. http://www.azurejournal.com/2010/03/sql-azure-database-size-calculator/   Ritesh, D

    Read the article

  • ASP.NET Conditionally Change ButtonField text at runTime

    - by Rodney Vinyard
    ASP.NET Conditionally Change ButtonField text at runTime   <asp:ButtonField CommandName="Edit" HeaderText="" Text="Edit" ButtonType="Link" />       protected void gvRequests_RowDataBound(object sender, GridViewRowEventArgs e)     {         if (e.Row.RowType == DataControlRowType.DataRow)         {             //----------------------------------------------------             // If status = "Saved", change buttonField.LinkButton.Text to "Copy"             //----------------------------------------------------             if (e.Row.Cells[(int)gCol.Status].Text == "Saved")             {                 //----------------------------------------------------                 // no !                 //----------------------------------------------------                 //string x = e.Row.Cells[(int)gCol.EditLink].Text;                 //e.Row.Cells[(int)gCol.EditLink].Text = "Copy";                   //----------------------------------------------------                 // yes !                 //----------------------------------------------------                 LinkButton linkButton = (LinkButton)e.Row.Cells[(int)gCol.EditLink].Controls[0];                 linkButton.Text = "Copy";             }         }     }

    Read the article

  • Issue with parsed text with HTMLCleaner - spaces at the begining of text

    - by ansol90
    Im able to get text using HTMLCleaner from website. The problem is that when I set the text to a TextView it shows the beginning of the text with a big space on it. Here is the screenshot of what im talking about. I have tried android:gravity but nothing happened. Please help. Here is my Code: private class SiteParser extends AsyncTask<String, Void, String> { protected String doInBackground(String... arg) { String output = null; try { HtmlHelper hh = new HtmlHelper(new URL(arg[0])); List<TagNode> news = hh.getnewsByClass("TextoPrint"); for (Iterator<TagNode> iterator = newss.iterator(); iterator .hasNext();) { TagNode divElement = (TagNode) iterator.next(); output = divElement.getText().toString(); } } catch (Exception e) { e.printStackTrace(); } return output; } protected void onPostExecute(String output) { Bundle bundle=new Bundle(); bundle.putString("body",output); Intent mainIntent = new Intent(act, MyView.class); mainIntent.putExtras(bundle); startActivity(mainIntent); act.finish(); } } public class HtmlHelper { TagNode rootNode; public HtmlHelper(URL htmlPage) throws IOException, XPatherException { HtmlCleaner cleaner = new HtmlCleaner(); rootNode = cleaner.clean(htmlPage); } List<TagNode> getnewsByClass(String Classname){ List<TagNode> newsList = new ArrayList<TagNode>(); TagNode divElements[] = rootNode.getElementsByName("div", true); for (int i = 0; divElements != null && i < divElements.length; i++) { String classType = divElements[i].getAttributeByName("id"); if (classType != null && classType.equals(Classname)) { newsList.add(divElements[i]); } } return newsList; } }

    Read the article

  • Send SMS text messages for FREE using Java ME

    - by hinkmond
    Here's a way to get around those nasty SMS text messages charges (and maybe a way to get around the Pakistan SMS text censors too!). Use this Java ME SMS text app for your Java ME mobile phone, called JaxtrSMS: See: JaxtrSMS free Java ME SMS Here's a quote: JaxtrSMS lets you send FREE SMS and txt messages to any mobile phone in the world. Best of all, the receiver does not have to have the JaxtrSMS app. International and local SMS/texting can be expensive but with JaxtrSMS you can text anyone in the world for FREE! Great! Now, you can send 2,000 text messages from your phone every month and not worry about a huge bill. You don't send 2,000 text message in a month? Well, get it for your teenage kids then. They certainly send 2,000 text messages in a month... Hinkmond

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • knockout bind text label to dropdown value selected option text

    - by Adam Levitt
    Is there a simple way to bind the textbox of a div to change based on the text value of the selected option in a dropdown on the same page? <div data-bind="text: dropdownValue"></div> <select> <option value="1">Value1</option> <option value="2">Value2</option> </select> Please note, I don't want to put the values into the select element using javascript. I'd like to bind to the value straight from the HTML. I can also include jQuery to make it work.

    Read the article

facebook twitter digg google delicious technorati stumbleupon myspace wordpress linkedin gmail igoogle windows live tumblr viadeo yahoo buzz yahoo mail yahoo bookmarks favorites email print

< Previous Page | 22 23 24 25 26 27 28 29 30 31 32 33  | Next Page >