Search Results

Search found 10060 results on 403 pages for 'column'.

Page 260/403 | < Previous Page | 256 257 258 259 260 261 262 263 264 265 266 267  | Next Page >

  • why need select privileges on *.* to use view?

    - by profy
    I have a problem using view with MySQL server 5.0 (5.0.92) I cannot use view with a user granted like that : GRANT USAGE ON *.* TO 'testuser'@'' IDENTIFIED BY PASSWORD '**********'; GRANT ALL PRIVILEGES ON `testuser`.* TO 'testuser'@''; I can create view, but when I try to select in, I have this messages : ERROR 1356 (HY000): View 'testuser.v' references invalid table(s) or column(s) or function(s) or definer/invoker of view lack rights to use them I need to "GRANT SELECT ON . TO 'testuser'@''" to make select working on the view. Why ? Do you know a solution to use VIEW's without the select privileges on . ? Thanks a lots for your answers.

    Read the article

  • How to configure Notepad++ (Scintilla) to write below EOF after EOL [on hold]

    - by Piotr Piaseczny
    Is it possible to configure scintilla to "brake" EOL/EOF while writing ? Now, if I want to begin writing in a column after EOL, I use ALT+left mouse button and start typing after click. No idea how to begin writing below EOF. Pressing Enter key many times is the only method now. Other explanation: If You open a new document, doesnt matter what kind of (php/txt etc) all You have is just one line. If You want to write in line 5 - must press Enter 5 times. Every other editor I know (IDE in Builder C++/MultiEdit) "ignore" eof and you can write anywhere in document. Because of php/html I've found notepad++ as a best editor but I'd like to "brake" limitations of (probably) scintilla

    Read the article

  • Excel - Disable AutoFormatting on Import

    - by Philip Wales
    How can I stop Microsoft Excel from auto formatting data when imported from a text file? Specifically, I want it to treat all of the values as text. I am auditing insurance data in excel before it is uploaded to the new database. The files come to me as tab delimited text files. When loaded, Excel auto-formats the data causing leading 0's on Zip Codes, Routing Numbers and other codes, to be chopped off. I don't have the patience to reformat all of the columns as text and guess how many zeros need to be replaced. Nor do I want to click through the import wizard an specify that each column is text. Ideally I just want to turn off Excel's Auto-Formatting completely, and just edit every cell as it were plain text. I don't do any formula's or charts, just grid plain text editing.

    Read the article

  • Real RAM latency

    - by user32569
    Hi, very quick question. When I look for RAM timing, I got 2 different explanations on what is CAS latency. First states, its the time after command to read has been issued from CPU and data are send to data bus. Second says its time betwen column in memory layout has been activated. So, where is the truth? I mean, when I want to know total RAM latenci, in case 1, ot would be just CAS times one clock time. In second case, it would be CAS+other things like RAstoCAS and so times one clock time. Thanks.

    Read the article

  • check two conditions in two different columns in excel and count the matches

    - by user1727103
    I've trying to create a Error Log to help me analyse my mistakes. So for simplicity, lets assume I have two columns "Type of Question" - with values SC,RC,CR and another column that indicates whether I got this question "right/wrong".Let's assume this is my table: Question No. | Right/Wrong | Question Type | Right | SC | Right | RC | Wrong | SC | Wrong | CR | Right | RC (Pardon my formatting skills). And I want an output table like this Type of Question | Right | Wrong | Total SC | 1 | 1 | 2 RC | 2 | 0 | 2 CR | 0 | 1 | 1 So basically what I want to do is check Column3 for SC using =COUNTIF(C1:C5,"SC"), and return the total number of SC questions, and then outta the SC , I need to find out which are Right.If I know the right and the total I can get the wrong. I have never written a macro so a formula based answer would suffice.

    Read the article

  • Excel Help: Fill Tool - Drag to the side (across columns) but increase the formula by Row Number.

    - by B-Ballerl
    There are answers out there to this question, but all of them have been under explianed so hence to difficult to coprehend and use them to my advantage. I want to do the seemingly simple (but not) task of Draging a Formula (Filling a series) across Column's while increasing the formula row number relativley. For Example to drag this formula: | =A1 | =A2 | =A3 Some other notes, Transposing by copy paste has proven too difficult for the amount of data. Offset and Indirect has been used by other people to do this but I don't get how they work at all so when I attempt to use them I don't know how to format it to my range. Here's a example photo Idealy we want the dragged section to continue on to fill the formula.

    Read the article

  • How to stop Excel Treating US dates as UK dates?

    - by deworde
    I'm in the UK, I've got a problem where I've got a list of dates supplied in US format. Excel seems to treat the ones that are valid in both formats as UK dates, (e.g. 03/01/2012 becomes 3rd of January rather that 1st March), and treat the ones that aren't valid UK dates (e.g. 03/13/2012) as basic text. I assume this choice is something to do with my regional settings. What I want is the system to recognise that this column of text is supplied in US date format, and convert it into the underlying date representation for calculations. How do I do this?

    Read the article

  • How to set the relevance of emails in Outlook?

    - by Grastveit
    Mails in outlook have a relevance-field that can be displayed as a column in the inbox. How do one set it? Edit: More precisely, how are the values of custom e-mail-fields changed through the outlook 2007 gui? Here relevance and a custom field 'Score' is shown in my inbox, but all emails have blank values. The context-menu of emails give access to "Message Options...". I was hoping the custom fields would be available there.

    Read the article

  • PostgreSQL, update existing rows with pg_restore

    - by woky
    Hello. I need to sync two PostgreSQL databases (some tables from development db to production db) sometimes. So I came up with this script: [...] pg_dump -a -F tar -t table1 -t table2 -U user1 dbname1 | \ pg_restore -a -U user2 -d dbname2 [...] The problem is that this works just for newly added rows. When I edit non-PK column I get constraint error and row isn't updated. For each dumped row I need to check if it exists in destination database (by PK) and if so delete it before INSERT/COPY. Thanks for your advice. (Previously posted on stackoverflow.com, but IMHO this is better place for this question).

    Read the article

  • excel autocomplete combo-box with on-selection event

    - by IttayD
    Hi, I have an excel sheet for groceries. One column is the name, another is whether to buy it or not (checkbox) and another is the amount. I'd like to have a widget in the top row so that I start typing an item's name and it shows a list of matching items that I can select from, or if I continue to type and there's only one item, completes its name. When the last item is selected, other widgets show the amount, which I can edit and clicking 'check' will check the item in the list. I know this is kind of very specific, but am hoping someone can at least get me started. Thank you, Ittay

    Read the article

  • mysql -e option with variable data - Pass the variable value to insert sql statement in shell script

    - by Ahn
    The following shell script is not inserting the data to the table. How to pass the variable value to insert sql statement in a shell script. id=0 while true do id=`expr $id + 1`; mysql -u root -ptest --socket=/data/mysql1/mysql.sock -e 'insert into mytest1.mytable2(id,name) values (' $id ',"testing");' echo $id >> id.txt done I have modified the script as below and tried, and still having the issue id=0 while true do id=`expr $id + 1`; # mysql -u root -ptest --socket=/data/mysql1/mysql.sock1 -e 'insert into mytest1.mytable1(name) values ("amma");' mysql -u root -ptest --socket=/data/mysql1/mysql.sock -e 'insert into mytest1.mytable2(id,name) values ( $id ,"testing");' echo $id >> id.txt done error : ]$ ./insert ERROR 1054 (42S22) at line 1: Unknown column '$id' in 'field list'

    Read the article

  • Finding throuput of CPU and Hardrive on Solaris

    - by Jim
    How do I find the throughput of a CPU and the hard disk on an OpenSolaris machine? Using mpstat or iostat? I'm having a hard time identifying the throughput if it is given at all in the commands output. For example, in mpstat there is very little explanation as to what the columns mean. I've been using the syscl column divided by time interval to find the throughput but to be honest I have no idea what a system call truly is. I'm trying to to analyze a hardrive and CPU while writing a file to the hardisk and when at rest.

    Read the article

  • How does the "Full Control" permission differ from manually giving all other permissions?

    - by Lord Torgamus
    On Windows Server 2003, and some other versions of Windows, the Properties > Security tab of a folder's or file's context menu provides "Allow" and "Deny" options for "Full Control," "Modify," "Read" and other permissions (graphic provided). After clicking "Full Control," all boxes in the column — except for "Special Permissions" — get automatically checked. What's the difference between checking "Full Control" and just checking all the other boxes individually? Are there hidden/advanced permissions toggled by "Full Control" that aren't listed in the main permissions window? Is "Full Control" just a convenience shortcut?

    Read the article

  • Set an Excel cell's color based on multiple other cells' colors

    - by Lord Torgamus
    I have an Excel 2007 spreadsheet for a list of products and a bunch of factors to rate each one on, and I'm using Conditional Formatting to set the color of the cells in the individual attribute columns. It looks something like this: I want to fill in the rating column for each item with a color, based on the color ratings of its individual attributes. Examples of ways to determine this: the color of the category in which the item scored worst the statistical mode of the category colors the average of the category ratings, where each color is assigned a numerical value How can I implement any or all of the above rules? (I'm really just asking for a quick overview of the relevant Excel feature; I don't need step-by-step instructions for each rule.)

    Read the article

  • Dangers of the pyton eval() statement

    - by LukeP
    I am creating a game. Specifically it is a pokemon battle simulator. I have an sqlite database of moves in which a row looks something like: name | type | Power | Accuracy | PP | Description However, there are some special moves. For said special moves, their damage (and other attributes not shown above, like status effects) may be dependant on certian factors. Rather than create a huge if/else in one of my classes covering the formulas for every one of these moves. I'd rather include another column in the DB that contains a formula in string form, like 'self.health/2'(simplified example). I could then just plug that into eval. I always see people saying to stay away from eval, but from what I can tell, this would be considered an acceptable use, as the dangers of eval only come into play when accepting user input. Am I correct in this assumption, or is there somthing i'm not seeing.

    Read the article

  • Is it possible to use images in an Excel IF statement?

    - by dunc
    Quite a simple one here, but I guess the answer will be a resounding no! I have a few symbols, basic clip-art, which I'd like to display depending on certain information. At the moment, I'm using this statement to display Y or N: =IF(B2>0,VLOOKUP(B2,'Student Data'!$A$2:$L$36,8),"") It's a simple lookup which checks another worksheet to see if someone has entered "Y" or "N" into the relevant column. What I'm wondering is this: would it be possible to display these clip-art images (I have them in .PNG format) instead of simple text? I.e. IF VALUE_OF_CELL=7, DISPLAY IMAGE1. Thanks in advance,

    Read the article

  • In Excel, how to group data by date, and then do operations on the data?

    - by Bicou
    Hi, I have Excel 2003. My data is like this: 01/10/2010 0.99 02/10/2010 1.49 02/10/2010 0.99 02/10/2010 0.99 02/10/2010 0.99 03/10/2010 1.49 03/10/2010 1.49 03/10/2010 0.99 etc. In fact it is a list of sales every day. I want to have something like this: 01/10/2010 0.99 02/10/2010 4.46 03/10/2010 3.97 I want to group by date, and sum the column B. I'd like to see the evolution of the sales over time, and display a nice graph about that. I have managed to create pivot tables that almost do the job: they list the number of 0.99 and 1.49 each day, but I can't find a way to simply sum everything and group by date. Thanks for reading.

    Read the article

  • How do I combine data from multiple rows in excel to one cell?

    - by Steve
    I have a list of product skus in one column in excel. I have thousands of these skus that need to be combined in one cell separated by commas with no spaces. There are too many rows of data to use the concatenate function. Not sure how to get this done. Here's an example of what I'm working with but with 6,000+ more rows. I'm using Excel 2003. A 140-12 1074-156 903-78 876-65 349-09 986-43 237-12 342-11 450-187 677-133

    Read the article

  • Vim Misbehaving

    - by zchtodd
    I'm not sure what changed, but lately Vim has been driving me nuts. Whenever I try to do a column mode insert, vim takes my current character and adds to the last character I inserted. For example, the first time I do a block comment by inserting # on multiple lines, it works fine. The next time, however, I end up with ## inserted on every line, and the problem just compounds from there. To do this, I'm hitting Ctrl-V, down or up arrow, Shift-I, #, and then Esc. This worked for months, but now it seems to be pasting extra stuff in. I've tried disabling all .vimrc files, but the behavior remains the same. Any ideas?

    Read the article

  • Convert text to table

    - by Quattro
    I would like convert text into a table. Here is a link to the text http://www.tcdb.org/public/tcdb Short example: >gnl|TC-DB|A0CIB0|1.A.17.3.1 Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1 MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI >gnl|TC-DB|A0CS82|9.B.82.1.5 Chromosome undetermined scaffold_26, whole genome shotgun sequence - Paramecium tetraurelia. MIIEEQIEEKMIYKAIHRVKVNYQKKIDRYILYKKSRWFFNLLLMLLYAYRIQNIGGFYI VTYIYCVYQLQLLIDYFTPLGLPPVNLEDEEEDDDQFQNDFSELPTTLSNKNELNDKEFR PLLRTTSEFKVWQKSVFSVIFAYFCTYIPIWDIPVYWPFLFCYFFVIVGMSIRKYIKHMK KYGYTILDFTKKK I wanted to have columns for example delimited with pipe | or ; |>gnl|TC-DB|A0CIB0|1.A.17.3.1| Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1| MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI I am working with Windows and I don't know how to do it I just know every row starts with > I want to substitute the first whitespace in a row with a delimiter like | or ; after the first regular expression new line in a row, I want also a delimiter everything between the regular expression first new line and > should go into a new column (it's a sequence of a protein)

    Read the article

  • Emacs org-mode: how to avoid duplicate lines in agenda, when items is scheduled AND has deadline

    - by Martin
    Many of my TODO items in Emacs org-mode have a DEADLINE defined in the future (e. g. Friday) and are at the same time SCHEDULED today so that I already know I have to start working on this task. Then, this task will appear twice in my agenda. That's not nice but not necessarily a problem yet, but if then the task has assigned a time estimate for its duration and I go to column view with C-C C-X C-C to see how much time my tasks today will need, the time estimate for this task is counted twice, so e. g. if the time effort estimate is 2 hours, I'll have 4 hours in my daily agenda, as the item appears as well as scheduled today (or in the past) as also with its deadline in 3 days. How can I avoid counting an item twice?

    Read the article

  • How can i lock images to a cell in excel 2010

    - by Jamie
    Ok, so i am using microsoft excel 2010 and have a set up currently where i have 2 views expanded and deflated using the Group or +/- function. My problem is that ui have images on the workbook too. The images are over the cells which are to be "hidden" when the - button is pressed and i would like the images to disappear with them. This is not curently happening instead they are moving to the next visible cell. I have included an example below incase i wasn't clear. I wish to hide Columns M:AU and the images are in various cells suchas N5 and O5. When i colapse (hide) the column range all of the images move to "AV5" the next row along that isn't hidden. This means the workbooks is looking messy when colapsed which is the oposite of what i was trying to do. Can anyone advise on a way around this?

    Read the article

  • Formula in table header cells

    - by Cylindric
    I have a table in Excel 2007 that I want to summarise, in a similar fashion to a Pivot Table, but for various reasons I can't use a pivot table. I like the "Format as table" features of sort and filter buttons, automatic formatting etc, so have used that to create a simple table: A B C N +-----------+------------+------------+-------+------------+ 1 | | 01/01/2010 | 01/02/2010 | ... | 01/12/2010 | +-----------+------------+------------+-------+------------+ 2 | CategoryA | 15 | 545 | | 634 | 3 | CategoryB | 32 | 332 | | 231 | 4 | CategoryC | 5 | 234 | | 644 | | ... | | | | | 27 | CategoryZ | 2 | 123 | | 64 | +-----------+------------+------------+-------+------------+ The numbers are retrieved from a "back-end" pivot table using GETPIVOTDATA(). All that works fine. Now, the problem is that I can't seem to use formulas for my column headings in these new "smart" tables - they are converted to text or just broken. For example if in B1 I put NOW(), I don't get the date, I get 00/01/1900. Is there any way of getting a formula to work in the auto tables? Or do I have to use standard tables and manually alternate-colour my rows etc?

    Read the article

  • Cant Add Columns to a AD Task pad except for the top level of the domain

    - by Darktux
    We are working on Active Directory taskpads application for user management in our organization and facing stange issue. When we create a taskpad, and when we are at top level of the domain, i can click view - Add/Remove Columns and add "Pre Windows Name" (and lots of other properties) to the taskpad as columns, but when i just go 1 level down , i can only see "Operating System" and "Service Pack" ; why is it happening , isnt "Domain Admins" supposed to god access to all the things in AD domain , atleast of objects they own? It is important to have "Pre Windows 2000" Name as a column begause with out that our "Shell Command" task wont show up in taskpads, since its bound to parameter "Col<9" (which is pre qindows name). Please do let me know if any additions questions to clarify my problem.

    Read the article

  • Excel - Dynamic row reference based on the row I paste a formula into?

    - by michaelmichael
    I have a simple, oft-used formula that I paste as plain text into spreadsheets I receive. It looks something like this: =IF(D8="FOO", "BAR", "BAZ") It looks in D8 for the word "FOO". If it finds it it will show "BAR". If it doesn't it will show "BAZ" It works great. The problem is I have to paste this formula as plain text into many spreadsheets. It should ALWAYS look in column D for "FOO", however I don't always want it to look in row 8. I'd like it to look at whatever row I'm pasting it into. For example, if I pasted the above formula into row 25, say, I would like it to automatically change to this: =IF(D25="FOO", "BAR", "BAZ") Is there any way to achieve this?

    Read the article

< Previous Page | 256 257 258 259 260 261 262 263 264 265 266 267  | Next Page >