Search Results

Search found 6774 results on 271 pages for 'special locations'.

Page 267/271 | < Previous Page | 263 264 265 266 267 268 269 270 271  | Next Page >

  • Implementation of ZipCrypto / Zip 2.0 encryption in java

    - by gomesla
    I'm trying o implement the zipcrypto / zip 2.0 encryption algoritm to deal with encrypted zip files as discussed in http://www.pkware.com/documents/casestudies/APPNOTE.TXT I believe I've followed the specs but just can't seem to get it working. I'm fairly sure the issue has to do with my interpretation of the crc algorithm. The documentation states CRC-32: (4 bytes) The CRC-32 algorithm was generously contributed by David Schwaderer and can be found in his excellent book "C Programmers Guide to NetBIOS" published by Howard W. Sams & Co. Inc. The 'magic number' for the CRC is 0xdebb20e3. The proper CRC pre and post conditioning is used, meaning that the CRC register is pre-conditioned with all ones (a starting value of 0xffffffff) and the value is post-conditioned by taking the one's complement of the CRC residual. Here is the snippet that I'm using for the crc32 public class PKZIPCRC32 { private static final int CRC32_POLYNOMIAL = 0xdebb20e3; private int crc = 0xffffffff; private int CRCTable[]; public PKZIPCRC32() { buildCRCTable(); } private void buildCRCTable() { int i, j; CRCTable = new int[256]; for (i = 0; i <= 255; i++) { crc = i; for (j = 8; j > 0; j--) if ((crc & 1) == 1) crc = (crc >>> 1) ^ CRC32_POLYNOMIAL; else crc >>>= 1; CRCTable[i] = crc; } } private int crc32(byte buffer[], int start, int count, int lastcrc) { int temp1, temp2; int i = start; crc = lastcrc; while (count-- != 0) { temp1 = crc >>> 8; temp2 = CRCTable[(crc ^ buffer[i++]) & 0xFF]; crc = temp1 ^ temp2; } return crc; } public int crc32(int crc, byte buffer) { return crc32(new byte[] { buffer }, 0, 1, crc); } } Below is my complete code. Can anyone see what I'm doing wrong. package org.apache.commons.compress.archivers.zip; import java.io.IOException; import java.io.InputStream; public class ZipCryptoInputStream extends InputStream { public class PKZIPCRC32 { private static final int CRC32_POLYNOMIAL = 0xdebb20e3; private int crc = 0xffffffff; private int CRCTable[]; public PKZIPCRC32() { buildCRCTable(); } private void buildCRCTable() { int i, j; CRCTable = new int[256]; for (i = 0; i <= 255; i++) { crc = i; for (j = 8; j > 0; j--) if ((crc & 1) == 1) crc = (crc >>> 1) ^ CRC32_POLYNOMIAL; else crc >>>= 1; CRCTable[i] = crc; } } private int crc32(byte buffer[], int start, int count, int lastcrc) { int temp1, temp2; int i = start; crc = lastcrc; while (count-- != 0) { temp1 = crc >>> 8; temp2 = CRCTable[(crc ^ buffer[i++]) & 0xFF]; crc = temp1 ^ temp2; } return crc; } public int crc32(int crc, byte buffer) { return crc32(new byte[] { buffer }, 0, 1, crc); } } private static final long ENCRYPTION_KEY_1 = 0x12345678; private static final long ENCRYPTION_KEY_2 = 0x23456789; private static final long ENCRYPTION_KEY_3 = 0x34567890; private InputStream baseInputStream = null; private final PKZIPCRC32 checksumEngine = new PKZIPCRC32(); private long[] keys = null; public ZipCryptoInputStream(ZipArchiveEntry zipEntry, InputStream inputStream, String passwd) throws Exception { baseInputStream = inputStream; // Decryption // ---------- // PKZIP encrypts the compressed data stream. Encrypted files must // be decrypted before they can be extracted. // // Each encrypted file has an extra 12 bytes stored at the start of // the data area defining the encryption header for that file. The // encryption header is originally set to random values, and then // itself encrypted, using three, 32-bit keys. The key values are // initialized using the supplied encryption password. After each byte // is encrypted, the keys are then updated using pseudo-random number // generation techniques in combination with the same CRC-32 algorithm // used in PKZIP and described elsewhere in this document. // // The following is the basic steps required to decrypt a file: // // 1) Initialize the three 32-bit keys with the password. // 2) Read and decrypt the 12-byte encryption header, further // initializing the encryption keys. // 3) Read and decrypt the compressed data stream using the // encryption keys. // Step 1 - Initializing the encryption keys // ----------------------------------------- // // Key(0) <- 305419896 // Key(1) <- 591751049 // Key(2) <- 878082192 // // loop for i <- 0 to length(password)-1 // update_keys(password(i)) // end loop // // Where update_keys() is defined as: // // update_keys(char): // Key(0) <- crc32(key(0),char) // Key(1) <- Key(1) + (Key(0) & 000000ffH) // Key(1) <- Key(1) * 134775813 + 1 // Key(2) <- crc32(key(2),key(1) >> 24) // end update_keys // // Where crc32(old_crc,char) is a routine that given a CRC value and a // character, returns an updated CRC value after applying the CRC-32 // algorithm described elsewhere in this document. keys = new long[] { ENCRYPTION_KEY_1, ENCRYPTION_KEY_2, ENCRYPTION_KEY_3 }; for (int i = 0; i < passwd.length(); ++i) { update_keys((byte) passwd.charAt(i)); } // Step 2 - Decrypting the encryption header // ----------------------------------------- // // The purpose of this step is to further initialize the encryption // keys, based on random data, to render a plaintext attack on the // data ineffective. // // Read the 12-byte encryption header into Buffer, in locations // Buffer(0) thru Buffer(11). // // loop for i <- 0 to 11 // C <- buffer(i) ^ decrypt_byte() // update_keys(C) // buffer(i) <- C // end loop // // Where decrypt_byte() is defined as: // // unsigned char decrypt_byte() // local unsigned short temp // temp <- Key(2) | 2 // decrypt_byte <- (temp * (temp ^ 1)) >> 8 // end decrypt_byte // // After the header is decrypted, the last 1 or 2 bytes in Buffer // should be the high-order word/byte of the CRC for the file being // decrypted, stored in Intel low-byte/high-byte order. Versions of // PKZIP prior to 2.0 used a 2 byte CRC check; a 1 byte CRC check is // used on versions after 2.0. This can be used to test if the password // supplied is correct or not. byte[] encryptionHeader = new byte[12]; baseInputStream.read(encryptionHeader); for (int i = 0; i < encryptionHeader.length; i++) { encryptionHeader[i] ^= decrypt_byte(); update_keys(encryptionHeader[i]); } } protected byte decrypt_byte() { byte temp = (byte) (keys[2] | 2); return (byte) ((temp * (temp ^ 1)) >> 8); } @Override public int read() throws IOException { // // Step 3 - Decrypting the compressed data stream // ---------------------------------------------- // // The compressed data stream can be decrypted as follows: // // loop until done // read a character into C // Temp <- C ^ decrypt_byte() // update_keys(temp) // output Temp // end loop int read = baseInputStream.read(); read ^= decrypt_byte(); update_keys((byte) read); return read; } private final void update_keys(byte ch) { keys[0] = checksumEngine.crc32((int) keys[0], ch); keys[1] = keys[1] + (byte) keys[0]; keys[1] = keys[1] * 134775813 + 1; keys[2] = checksumEngine.crc32((int) keys[2], (byte) (keys[1] >> 24)); } }

    Read the article

  • Reading php generated XML in flash?

    - by AdonisSMU
    Here is part 1 of our problem (Loading a dynamically generated XML file as PHP in Flash). Now we were able to get Flash to read the XML file, but we can only see the Flash render correctly when tested(test movie) from the actual Flash program. However, when we upload our files online to preview the Flash does not render correctly, missing some vital information(thumbnails, titles, video etc..). Here is a link to the Flash file using a manually created XML file (The Flash renders correctly): http://www.gaban.com/stackoverflow/TEN_xml.html Here is the path to the manually created XML file: http://dev.touchstorm.com/ten_hpn_admin2/client_user2.xml Now here is the link to the Flash file using the PHP generated XML file (Renders incomplete): http://www.gaban.com/stackoverflow/TEN_php.html Path to the PHP generated file (exactly the same as the manually created one): http://dev.touchstorm.com/ten_hpn_admin2/client_user.php?id=2 Additional information: The SWF file exists on Domain 1 The XML & PHP file both exists on Domain 2 And the HTML file with the embed code lies on Domain 3 Wondering if this could be a crossdomain issue? We have one of those files in place on Domain 1 & 2 where we have access too, however for Domain 3 we can't have a crossdomain.xml file there. Here is the PHP code: $xml = new XMLWriter(); $xml->openMemory(); $xml->setIndent(true); $xml->setIndentString("\t"); $xml->startDocument(); $xml->startElement('data'); $xml->startElement('config'); $xml->startElement('hex'); $xml->writeCData('0x' . $widget_profile['background_color']); $xml->endElement(); $xml->startElement('width'); $xml->writeCData($widget_profile['width']); $xml->endElement(); $xml->startElement('height'); $xml->writeCData($widget_profile['height']); $xml->endElement(); $xml->startElement('fullscreen'); $xml->writeCData('false'); $xml->endElement(); $xml->startElement('special'); $xml->writeCData('false'); $xml->endElement(); $xml->startElement('specialName'); $xml->writeCData('Tools & Offers'); $xml->endElement(); $xml->startElement('specialLink'); $xml->writeCData('http://bettycrocker.com'); $xml->endElement(); $xml->startElement('client'); $xml->writeCData($widget_profile['site_url']); $xml->endElement(); $xml->endElement(); if (count($widget_content) > 0) { foreach ($widget_content as $tab) { $xml->startElement('tab'); $xml->writeAttribute('id', $tab['tabname']); if (count($tab['video']) > 0) { foreach ($tab['video'] as $video) { $video_sql = "select VID, flvdoname, title from video where VID='" . $video . "'"; $video_result = $howdini->query($video_sql); if ($video_result->rowCount() > 0) { foreach ($video_result as $video_row) { $video_row['flvdoname'] = substr($video_row['flvdoname'], 35, -4); $xml->startElement('vid'); $xml->writeAttribute('flv', $video_row['flvdoname']); $xml->writeAttribute('thumb', 'http://www.howdini.com/thumb/' . $video_row['VID'] . '.jpg'); $xml->writeAttribute('title', $video_row['title']); $xml->endElement(); } } } } $xml->endElement(); } } $xml->endElement(); $xml->endDocument(); header('Content-Type: text/xml; charset=UTF-8'); echo $xml->flush(); Thanks in advance for any answers! EDIT: I have included the change and now Firebug sees the XML. Now it's just not seeing the swf file but I can see the swf file in other parts of the page.

    Read the article

  • Using AES encryption in .NET - CryptographicException saying the padding is invalid and cannot be removed

    - by Jake Petroules
    I wrote some AES encryption code in C# and I am having trouble getting it to encrypt and decrypt properly. If I enter "test" as the passphrase and "This data must be kept secret from everyone!" I receive the following exception: System.Security.Cryptography.CryptographicException: Padding is invalid and cannot be removed. at System.Security.Cryptography.RijndaelManagedTransform.DecryptData(Byte[] inputBuffer, Int32 inputOffset, Int32 inputCount, Byte[]& outputBuffer, Int32 outputOffset, PaddingMode paddingMode, Boolean fLast) at System.Security.Cryptography.RijndaelManagedTransform.TransformFinalBlock(Byte[] inputBuffer, Int32 inputOffset, Int32 inputCount) at System.Security.Cryptography.CryptoStream.FlushFinalBlock() at System.Security.Cryptography.CryptoStream.Dispose(Boolean disposing) at System.IO.Stream.Close() at System.IO.Stream.Dispose() ... And if I enter something less than 16 characters I get no output. I believe I need some special handling in the encryption since AES is a block cipher, but I'm not sure exactly what that is, and I wasn't able to find any examples on the web showing how. Here is my code: using System; using System.IO; using System.Security.Cryptography; using System.Text; public static class DatabaseCrypto { public static EncryptedData Encrypt(string password, string data) { return DatabaseCrypto.Transform(true, password, data, null, null) as EncryptedData; } public static string Decrypt(string password, EncryptedData data) { return DatabaseCrypto.Transform(false, password, data.DataString, data.SaltString, data.MACString) as string; } private static object Transform(bool encrypt, string password, string data, string saltString, string macString) { using (AesManaged aes = new AesManaged()) { aes.Mode = CipherMode.CBC; aes.Padding = PaddingMode.PKCS7; int key_len = aes.KeySize / 8; int iv_len = aes.BlockSize / 8; const int salt_size = 8; const int iterations = 8192; byte[] salt = encrypt ? new Rfc2898DeriveBytes(string.Empty, salt_size).Salt : Convert.FromBase64String(saltString); byte[] bc_key = new Rfc2898DeriveBytes("BLK" + password, salt, iterations).GetBytes(key_len); byte[] iv = new Rfc2898DeriveBytes("IV" + password, salt, iterations).GetBytes(iv_len); byte[] mac_key = new Rfc2898DeriveBytes("MAC" + password, salt, iterations).GetBytes(16); aes.Key = bc_key; aes.IV = iv; byte[] rawData = encrypt ? Encoding.UTF8.GetBytes(data) : Convert.FromBase64String(data); using (ICryptoTransform transform = encrypt ? aes.CreateEncryptor() : aes.CreateDecryptor()) using (MemoryStream memoryStream = encrypt ? new MemoryStream() : new MemoryStream(rawData)) using (CryptoStream cryptoStream = new CryptoStream(memoryStream, transform, encrypt ? CryptoStreamMode.Write : CryptoStreamMode.Read)) { if (encrypt) { cryptoStream.Write(rawData, 0, rawData.Length); return new EncryptedData(salt, mac_key, memoryStream.ToArray()); } else { byte[] originalData = new byte[rawData.Length]; int count = cryptoStream.Read(originalData, 0, originalData.Length); return Encoding.UTF8.GetString(originalData, 0, count); } } } } } public class EncryptedData { public EncryptedData() { } public EncryptedData(byte[] salt, byte[] mac, byte[] data) { this.Salt = salt; this.MAC = mac; this.Data = data; } public EncryptedData(string salt, string mac, string data) { this.SaltString = salt; this.MACString = mac; this.DataString = data; } public byte[] Salt { get; set; } public string SaltString { get { return Convert.ToBase64String(this.Salt); } set { this.Salt = Convert.FromBase64String(value); } } public byte[] MAC { get; set; } public string MACString { get { return Convert.ToBase64String(this.MAC); } set { this.MAC = Convert.FromBase64String(value); } } public byte[] Data { get; set; } public string DataString { get { return Convert.ToBase64String(this.Data); } set { this.Data = Convert.FromBase64String(value); } } } static void ReadTest() { Console.WriteLine("Enter password: "); string password = Console.ReadLine(); using (StreamReader reader = new StreamReader("aes.cs.txt")) { EncryptedData enc = new EncryptedData(); enc.SaltString = reader.ReadLine(); enc.MACString = reader.ReadLine(); enc.DataString = reader.ReadLine(); Console.WriteLine("The decrypted data was: " + DatabaseCrypto.Decrypt(password, enc)); } } static void WriteTest() { Console.WriteLine("Enter data: "); string data = Console.ReadLine(); Console.WriteLine("Enter password: "); string password = Console.ReadLine(); EncryptedData enc = DatabaseCrypto.Encrypt(password, data); using (StreamWriter stream = new StreamWriter("aes.cs.txt")) { stream.WriteLine(enc.SaltString); stream.WriteLine(enc.MACString); stream.WriteLine(enc.DataString); Console.WriteLine("The encrypted data was: " + enc.DataString); } }

    Read the article

  • LINQ 4 XML - What is the proper way to query deep in the tree structure?

    - by Keith Barrows
    I have an XML structure that is 4 deep: <?xml version="1.0" encoding="utf-8"?> <EmailRuleList xmlns:xsd="EmailRules.xsd"> <TargetPST name="Tech Communities"> <Parse emailAsList="true" useJustDomain="false" fromAddress="false" toAddress="true"> <EmailRule address="@aspadvice.com" folder="Lists, ASP" saveAttachments="false" /> <EmailRule address="@sqladvice.com" folder="Lists, SQL" saveAttachments="false" /> <EmailRule address="@xmladvice.com" folder="Lists, XML" saveAttachments="false" /> </Parse> <Parse emailAsList="false" useJustDomain="false" fromAddress="false" toAddress="true"> <EmailRule address="[email protected]" folder="Special Interest Groups|Northern Colorado Architects Group" saveAttachments="false" /> <EmailRule address="[email protected]" folder="Support|SpamBayes" saveAttachments="false" /> </Parse> <Parse emailAsList="false" useJustDomain="false" fromAddress="true" toAddress="false"> <EmailRule address="[email protected]" folder="Support|GoDaddy" saveAttachments="false" /> <EmailRule address="[email protected]" folder="Support|No-IP.com" saveAttachments="false" /> <EmailRule address="[email protected]" folder="Discussions|Orchard Project" saveAttachments="false" /> </Parse> <Parse emailAsList="false" useJustDomain="true" fromAddress="true" toAddress="false"> <EmailRule address="@agilejournal.com" folder="Newsletters|Agile Journal" saveAttachments="false"/> <EmailRule address="@axosoft.ccsend.com" folder="Newsletters|Axosoft Newsletter" saveAttachments="false"/> <EmailRule address="@axosoft.com" folder="Newsletters|Axosoft Newsletter" saveAttachments="false"/> <EmailRule address="@cmcrossroads.com" folder="Newsletters|CM Crossroads" saveAttachments="false" /> <EmailRule address="@urbancode.com" folder="Newsletters|Urbancode" saveAttachments="false" /> <EmailRule address="@urbancode.ccsend.com" folder="Newsletters|Urbancode" saveAttachments="false" /> <EmailRule address="@Infragistics.com" folder="Newsletters|Infragistics" saveAttachments="false" /> <EmailRule address="@zdnet.online.com" folder="Newsletters|ZDNet Tech Update Today" saveAttachments="false" /> <EmailRule address="@sqlservercentral.com" folder="Newsletters|SQLServerCentral.com" saveAttachments="false" /> <EmailRule address="@simple-talk.com" folder="Newsletters|Simple-Talk Newsletter" saveAttachments="false" /> </Parse> </TargetPST> <TargetPST name="[Sharpen the Saw]"> <Parse emailAsList="false" useJustDomain="false" fromAddress="false" toAddress="true"> <EmailRule address="[email protected]" folder="Head Geek|Job Alerts" saveAttachments="false" /> <EmailRule address="[email protected]" folder="Social|LinkedIn USMC" saveAttachments="false"/> </Parse> <Parse emailAsList="false" useJustDomain="false" fromAddress="true" toAddress="false"> <EmailRule address="[email protected]" folder="Head Geek|Job Alerts" saveAttachments="false" /> <EmailRule address="[email protected]" folder="Head Geek|Job Alerts" saveAttachments="false" /> <EmailRule address="[email protected]" folder="Social|Cruise Critic" saveAttachments="false"/> </Parse> <Parse emailAsList="false" useJustDomain="true" fromAddress="true" toAddress="false"> <EmailRule address="@moody.edu" folder="Social|5 Love Languages" saveAttachments="false" /> <EmailRule address="@postmaster.twitter.com" folder="Social|Twitter" saveAttachments="false"/> <EmailRule address="@diabetes.org" folder="Physical|American Diabetes Association" saveAttachments="false"/> <EmailRule address="@membership.webshots.com" folder="Social|Webshots" saveAttachments="false"/> </Parse> </TargetPST> </EmailRuleList> Now, I have both an FromAddress and a ToAddress that is parsed from an incoming email. I would like to do a LINQ query against a class set that was deserialized from this XML. For instance: ToAddress = [email protected] FromAddress = [email protected] Query: Get EmailRule.Include(Parse).Include(TargetPST) where address == ToAddress AND Parse.ToAddress==true AND Parse.useJustDomain==false Get EmailRule.Include(Parse).Include(TargetPST) where address == [ToAddress Domain Only] AND Parse.ToAddress==true AND Parse.useJustDomain==true Get EmailRule.Include(Parse).Include(TargetPST) where address == FromAddress AND Parse.FromAddress==true AND Parse.useJustDomain==false Get EmailRule.Include(Parse).Include(TargetPST) where address == [FromAddress Domain Only] AND Parse.FromAddress==true AND Parse.useJustDomain==true I am having a hard time figuring this LINQ query out. I can, of course, loop on all the bits in the XML like so (includes deserialization into objects): XmlSerializer s = new XmlSerializer(typeof(EmailRuleList)); TextReader r = new StreamReader(path); _emailRuleList = (EmailRuleList)s.Deserialize(r); TargetPST[] PSTList = _emailRuleList.Items; foreach (TargetPST targetPST in PSTList) { olRoot = GetRootFolder(targetPST.name); if (olRoot != null) { Parse[] ParseList = targetPST.Items; foreach (Parse parseRules in ParseList) { EmailRule[] EmailRuleList = parseRules.Items; foreach (EmailRule targetFolders in EmailRuleList) { } } } } However, this means going through all these loops for each and every address. It makes more sense to me to query against the Objects. Any tips appreciated!

    Read the article

  • Unable to use factory girl with Cucumber and rails 3 (bundler problem)

    - by jbpros
    Hi there, I'm trying to run cucumber features with factory girl factories on a fresh Rails 3 application. Here is my Gemfile: source "http://gemcutter.org" gem "rails", "3.0.0.beta" gem "pg" gem "factory_girl", :git => "git://github.com/thoughtbot/factory_girl.git", :branch => "rails3" gem "rspec-rails", ">= 2.0.0.beta.4" gem "capybara" gem "database_cleaner" gem "cucumber-rails", :require => false Then the bundle install commande just runs smoothly: $ bundle install /usr/lib/ruby/gems/1.8/gems/bundler-0.9.3/lib/bundler/installer.rb:81:Warning: Gem::Dependency#version_requirements is deprecated and will be removed on or after August 2010. Use #requirement Updating git://github.com/thoughtbot/factory_girl.git Fetching source index from http://gemcutter.org Resolving dependencies Installing abstract (1.0.0) from system gems Installing actionmailer (3.0.0.beta) from system gems Installing actionpack (3.0.0.beta) from system gems Installing activemodel (3.0.0.beta) from system gems Installing activerecord (3.0.0.beta) from system gems Installing activeresource (3.0.0.beta) from system gems Installing activesupport (3.0.0.beta) from system gems Installing arel (0.2.1) from system gems Installing builder (2.1.2) from system gems Installing bundler (0.9.13) from system gems Installing capybara (0.3.6) from system gems Installing cucumber (0.6.3) from system gems Installing cucumber-rails (0.3.0) from system gems Installing culerity (0.2.9) from system gems Installing database_cleaner (0.5.0) from system gems Installing diff-lcs (1.1.2) from system gems Installing erubis (2.6.5) from system gems Installing factory_girl (1.2.3) from git://github.com/thoughtbot/factory_girl.git (at rails3) Installing ffi (0.6.3) from system gems Installing i18n (0.3.6) from system gems Installing json_pure (1.2.3) from system gems Installing mail (2.1.3) from system gems Installing memcache-client (1.7.8) from system gems Installing mime-types (1.16) from system gems Installing nokogiri (1.4.1) from system gems Installing pg (0.9.0) from system gems Installing polyglot (0.3.0) from system gems Installing rack (1.1.0) from system gems Installing rack-mount (0.4.7) from system gems Installing rack-test (0.5.3) from system gems Installing rails (3.0.0.beta) from system gems Installing railties (3.0.0.beta) from system gems Installing rake (0.8.7) from system gems Installing rspec (2.0.0.beta.4) from system gems Installing rspec-core (2.0.0.beta.4) from system gems Installing rspec-expectations (2.0.0.beta.4) from system gems Installing rspec-mocks (2.0.0.beta.4) from system gems Installing rspec-rails (2.0.0.beta.4) from system gems Installing selenium-webdriver (0.0.17) from system gems Installing term-ansicolor (1.0.5) from system gems Installing text-format (1.0.0) from system gems Installing text-hyphen (1.0.0) from system gems Installing thor (0.13.4) from system gems Installing treetop (1.4.4) from system gems Installing tzinfo (0.3.17) from system gems Installing webrat (0.7.0) from system gems Your bundle is complete! When I run cucumber, here is the error I get: $ rake cucumber (in /home/jbpros/projects/deorbitburn) /usr/lib/ruby/gems/1.8/gems/bundler-0.9.3/lib/bundler/resolver.rb:97:Warning: Gem::Dependency#version_requirements is deprecated and will be removed on or after August 2010. Use #requirement NOTICE: CREATE TABLE will create implicit sequence "posts_id_seq" for serial column "posts.id" NOTICE: CREATE TABLE / PRIMARY KEY will create implicit index "posts_pkey" for table "posts" /usr/bin/ruby1.8 -I "/usr/lib/ruby/gems/1.8/gems/cucumber-0.6.3/lib:lib" "/usr/lib/ruby/gems/1.8/gems/cucumber-0.6.3/bin/cucumber" --profile default Using the default profile... git://github.com/thoughtbot/factory_girl.git (at rails3) is not checked out. Please run `bundle install` (Bundler::PathError) /home/jbpros/.bundle/gems/bundler-0.9.13/lib/bundler/source.rb:282:in `load_spec_files' /home/jbpros/.bundle/gems/bundler-0.9.13/lib/bundler/source.rb:190:in `local_specs' /home/jbpros/.bundle/gems/bundler-0.9.13/lib/bundler/environment.rb:36:in `runtime_gems' /home/jbpros/.bundle/gems/bundler-0.9.13/lib/bundler/environment.rb:35:in `each' /home/jbpros/.bundle/gems/bundler-0.9.13/lib/bundler/environment.rb:35:in `runtime_gems' /home/jbpros/.bundle/gems/bundler-0.9.13/lib/bundler/index.rb:5:in `build' /home/jbpros/.bundle/gems/bundler-0.9.13/lib/bundler/environment.rb:34:in `runtime_gems' /home/jbpros/.bundle/gems/bundler-0.9.13/lib/bundler/environment.rb:14:in `index' /home/jbpros/.bundle/gems/bundler-0.9.13/lib/bundler/index.rb:5:in `build' /home/jbpros/.bundle/gems/bundler-0.9.13/lib/bundler/environment.rb:13:in `index' /home/jbpros/.bundle/gems/bundler-0.9.13/lib/bundler/environment.rb:55:in `resolve_locally' /home/jbpros/.bundle/gems/bundler-0.9.13/lib/bundler/environment.rb:28:in `specs' /home/jbpros/.bundle/gems/bundler-0.9.13/lib/bundler/environment.rb:65:in `specs_for' /home/jbpros/.bundle/gems/bundler-0.9.13/lib/bundler/environment.rb:23:in `requested_specs' /home/jbpros/.bundle/gems/bundler-0.9.13/lib/bundler/runtime.rb:18:in `setup' /home/jbpros/.bundle/gems/bundler-0.9.13/lib/bundler.rb:68:in `setup' /home/jbpros/projects/deorbitburn/config/boot.rb:7 /usr/local/lib/site_ruby/1.8/rubygems/custom_require.rb:31:in `gem_original_require' /usr/local/lib/site_ruby/1.8/rubygems/custom_require.rb:31:in `polyglot_original_require' /usr/lib/ruby/gems/1.8/gems/polyglot-0.3.0/lib/polyglot.rb:65:in `require' /home/jbpros/projects/deorbitburn/config/application.rb:1 /usr/local/lib/site_ruby/1.8/rubygems/custom_require.rb:31:in `gem_original_require' /usr/local/lib/site_ruby/1.8/rubygems/custom_require.rb:31:in `polyglot_original_require' /usr/lib/ruby/gems/1.8/gems/polyglot-0.3.0/lib/polyglot.rb:65:in `require' /home/jbpros/projects/deorbitburn/config/environment.rb:2 /usr/local/lib/site_ruby/1.8/rubygems/custom_require.rb:31:in `gem_original_require' /usr/local/lib/site_ruby/1.8/rubygems/custom_require.rb:31:in `polyglot_original_require' /usr/lib/ruby/gems/1.8/gems/polyglot-0.3.0/lib/polyglot.rb:65:in `require' /home/jbpros/projects/deorbitburn/features/support/env.rb:8 /usr/local/lib/site_ruby/1.8/rubygems/custom_require.rb:31:in `gem_original_require' /usr/local/lib/site_ruby/1.8/rubygems/custom_require.rb:31:in `polyglot_original_require' /usr/lib/ruby/gems/1.8/gems/polyglot-0.3.0/lib/polyglot.rb:65:in `require' /usr/lib/ruby/gems/1.8/gems/cucumber-0.6.3/bin/../lib/cucumber/rb_support/rb_language.rb:124:in `load_code_file' /usr/lib/ruby/gems/1.8/gems/cucumber-0.6.3/bin/../lib/cucumber/step_mother.rb:85:in `load_code_file' /usr/lib/ruby/gems/1.8/gems/cucumber-0.6.3/bin/../lib/cucumber/step_mother.rb:77:in `load_code_files' /usr/lib/ruby/gems/1.8/gems/cucumber-0.6.3/bin/../lib/cucumber/step_mother.rb:76:in `each' /usr/lib/ruby/gems/1.8/gems/cucumber-0.6.3/bin/../lib/cucumber/step_mother.rb:76:in `load_code_files' /usr/lib/ruby/gems/1.8/gems/cucumber-0.6.3/bin/../lib/cucumber/cli/main.rb:48:in `execute!' /usr/lib/ruby/gems/1.8/gems/cucumber-0.6.3/bin/../lib/cucumber/cli/main.rb:20:in `execute' /usr/lib/ruby/gems/1.8/gems/cucumber-0.6.3/bin/cucumber:8 rake aborted! Command failed with status (1): [/usr/bin/ruby1.8 -I "/usr/lib/ruby/gems/1....] (See full trace by running task with --trace) Do I have to do something special for bundler to check out factory girl's repository on github?

    Read the article

  • w3schools xsd example won't work with dom4j. How do I use dom4j to validate xml using xsds?

    - by HappyEngineer
    I am trying to use dom4j to validate the xml at http://www.w3schools.com/Schema/schema_example.asp using the xsd from that same page. It fails with the following error: org.xml.sax.SAXParseException: cvc-elt.1: Cannot find the declaration of element 'shiporder'. I'm using the following code: SAXReader reader = new SAXReader(); reader.setValidation(true); reader.setFeature("http://apache.org/xml/features/validation/schema", true); reader.setErrorHandler(new XmlErrorHandler()); reader.read(in); where in is an InputStream and XmlErrorHandler is a simple class that just logs all errors. I'm using the following xml file: <?xml version="1.0" encoding="ISO-8859-1"?> <shiporder orderid="889923" xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xsi:noNamespaceSchemaLocation="test1.xsd"> <orderperson>John Smith</orderperson> <shipto> <name>Ola Nordmann</name> <address>Langgt 23</address> <city>4000 Stavanger</city> <country>Norway</country> </shipto> <item> <title>Empire Burlesque</title> <note>Special Edition</note> <quantity>1</quantity> <price>10.90</price> </item> <item> <title>Hide your heart</title> <quantity>1</quantity> <price>9.90</price> </item> </shiporder> and the corresponding xsd: <?xml version="1.0" encoding="ISO-8859-1" ?> <xs:schema xmlns:xs="http://www.w3.org/2001/XMLSchema"> <xs:simpleType name="stringtype"> <xs:restriction base="xs:string"/> </xs:simpleType> <xs:simpleType name="inttype"> <xs:restriction base="xs:positiveInteger"/> </xs:simpleType> <xs:simpleType name="dectype"> <xs:restriction base="xs:decimal"/> </xs:simpleType> <xs:simpleType name="orderidtype"> <xs:restriction base="xs:string"> <xs:pattern value="[0-9]{6}"/> </xs:restriction> </xs:simpleType> <xs:complexType name="shiptotype"> <xs:sequence> <xs:element name="name" type="stringtype"/> <xs:element name="address" type="stringtype"/> <xs:element name="city" type="stringtype"/> <xs:element name="country" type="stringtype"/> </xs:sequence> </xs:complexType> <xs:complexType name="itemtype"> <xs:sequence> <xs:element name="title" type="stringtype"/> <xs:element name="note" type="stringtype" minOccurs="0"/> <xs:element name="quantity" type="inttype"/> <xs:element name="price" type="dectype"/> </xs:sequence> </xs:complexType> <xs:complexType name="shipordertype"> <xs:sequence> <xs:element name="orderperson" type="stringtype"/> <xs:element name="shipto" type="shiptotype"/> <xs:element name="item" maxOccurs="unbounded" type="itemtype"/> </xs:sequence> <xs:attribute name="orderid" type="orderidtype" use="required"/> </xs:complexType> <xs:element name="shiporder" type="shipordertype"/> </xs:schema> The xsd and xml file are in the same directory. What is the problem?

    Read the article

  • Ejabberd clustering problem with amazon EC2 server

    - by user353362
    Hello Guys! I have been trying to install ejabberd server on Amazons EC2 instance. I am kinds a stuck at this step right now. I am following this guide: http://tdewolf.blogspot.com/2009/07/clustering-ejabberd-nodes-using-mnes... From the guide I have sucessfully completed the Set up First Node (on ejabberd1) part. But am stuck in part 4 of Set up Second Node (on ejabberd2) So all in all, I created the main node and am able to run the server on that node and access its admin console from then internet. In the second node I have installed ejabberd. But I am stuck at point 4 of setting up the node instruction presented in this blog (http://tdewolf.blogspot.com/2009/07/clustering-ejabberd-nodes-using-mnes...). I execute this command " erl -sname ejabberd@domU-12-31-39-0F-7D-14 -mnesia dir '"/var/lib/ejabberd/"' -mnesia extra_db_nodes "['ejabberd@domU-12-31-39-02-C8-36']" -s mnesia " on the second server and get a crashing error: root@domU-12-31-39-0F-7D-14:/var/lib/ejabberd# erl -sname ejabberd@domU-12-31-39-0F-7D-14 -mnesia dir '"/var/lib/ejabberd/"' -mnesia extra_db_nodes "['ejabberd@domU-12-31-39-02-C8-36']" -s mnesia {error_logger,{{2010,5,28},{23,52,25}},"Protocol: ~p: register error: ~p~n",["inet_tcp",{{badmatch,{error,duplicate_name}},[{inet_tcp_dist,listen,1},{net_kernel,start_protos,4},{net_kernel,start_protos,3},{net_kernel,init_node,2},{net_kernel,init,1},{gen_server,init_it,6},{proc_lib,init_p_do_apply,3}]}]} {error_logger,{{2010,5,28},{23,52,25}},crash_report,[[{pid,<0.21.0},{registered_name,net_kernel},{error_info,{exit,{error,badarg},[{gen_server,init_it,6},{proc_lib,init_p_do_apply,3}]}},{initial_call,{net_kernel,init,['Argument__1']}},{ancestors,[net_sup,kernel_sup,<0.8.0]},{messages,[]},{links,[#Port<0.52,<0.18.0]},{dictionary,[{longnames,false}]},{trap_exit,true},{status,running},{heap_size,610},{stack_size,23},{reductions,518}],[]]} {error_logger,{{2010,5,28},{23,52,25}},supervisor_report,[{supervisor,{local,net_sup}},{errorContext,start_error},{reason,{'EXIT',nodistribution}},{offender,[{pid,undefined},{name,net_kernel},{mfa,{net_kernel,start_link,[['ejabberd@domU-12-31-39-0F-7D-14',shortnames]]}},{restart_type,permanent},{shutdown,2000},{child_type,worker}]}]} {error_logger,{{2010,5,28},{23,52,25}},supervisor_report,[{supervisor,{local,kernel_sup}},{errorContext,start_error},{reason,shutdown},{offender,[{pid,undefined},{name,net_sup},{mfa,{erl_distribution,start_link,[]}},{restart_type,permanent},{shutdown,infinity},{child_type,supervisor}]}]} {error_logger,{{2010,5,28},{23,52,25}},crash_report,[[{pid,<0.7.0},{registered_name,[]},{error_info,{exit,{shutdown,{kernel,start,[normal,[]]}},[{application_master,init,4},{proc_lib,init_p_do_apply,3}]}},{initial_call,{application_master,init,['Argument_1','Argument_2','Argument_3','Argument_4']}},{ancestors,[<0.6.0]},{messages,[{'EXIT',<0.8.0,normal}]},{links,[<0.6.0,<0.5.0]},{dictionary,[]},{trap_exit,true},{status,running},{heap_size,233},{stack_size,23},{reductions,123}],[]]} {error_logger,{{2010,5,28},{23,52,25}},std_info,[{application,kernel},{exited,{shutdown,{kernel,start,[normal,[]]}}},{type,permanent}]} {"Kernel pid terminated",application_controller,"{application_start_failure,kernel,{shutdown,{kernel,start,[normal,[]]}}}"} Crash dump was written to: erl_crash.dump Kernel pid terminated (application_controller) ({application_start_failure,kernel,{shutdown,{kernel,start,[normal,[]]}}}) root@domU-12-31-39-0F-7D-14:/var/lib/ejabberd# any idea what going on? I am not really sure how to solve this problem :S how to let ejabberd only access register from one special server? › Is that the right way of copying .erlang.cookie file? Submitted by privateson on Sat, 2010-05-29 00:11. before this I was getting this error (see below), I solved it by running this command: chmod 400 .erlang.cookie Also to copy the cookie I simply created a file using vi on the second server and copied the secret code from server one to the second server. Is that the right way of copying .erlang.cookie file? ERROR ~~~~~~~~~~ root@domU-12-31-39-0F-7D-14:/etc/ejabberd# erl -sname ejabberd@domU-12-31-39-0F-7D-14 -mnesia dir '"/var/lib/ejabberd/"' -mnesia extra_db_nodes "['ejabberd@domU-12-31-39-02-C8-36']" -s mnesia {error_logger,{{2010,5,28},{23,28,56}},"Cookie file /root/.erlang.cookie must be accessible by owner only",[]} {error_logger,{{2010,5,28},{23,28,56}},crash_report,[[{pid,<0.20.0},{registered_name,auth},{error_info,{exit,{"Cookie file /root/.erlang.cookie must be accessible by owner only",[{auth,init_cookie,0},{auth,init,1},{gen_server,init_it,6},{proc_lib,init_p_do_apply,3}]},[{gen_server,init_it,6},{proc_lib,init_p_do_apply,3}]}},{initial_call,{auth,init,['Argument__1']}},{ancestors,[net_sup,kernel_sup,<0.8.0]},{messages,[]},{links,[<0.18.0]},{dictionary,[]},{trap_exit,true},{status,running},{heap_size,987},{stack_size,23},{reductions,439}],[]]} {error_logger,{{2010,5,28},{23,28,56}},supervisor_report,[{supervisor,{local,net_sup}},{errorContext,start_error},{reason,{"Cookie file /root/.erlang.cookie must be accessible by owner only",[{auth,init_cookie,0},{auth,init,1},{gen_server,init_it,6},{proc_lib,init_p_do_apply,3}]}},{offender,[{pid,undefined},{name,auth},{mfa,{auth,start_link,[]}},{restart_type,permanent},{shutdown,2000},{child_type,worker}]}]} {error_logger,{{2010,5,28},{23,28,56}},supervisor_report,[{supervisor,{local,kernel_sup}},{errorContext,start_error},{reason,shutdown},{offender,[{pid,undefined},{name,net_sup},{mfa,{erl_distribution,start_link,[]}},{restart_type,permanent},{shutdown,infinity},{child_type,supervisor}]}]} {error_logger,{{2010,5,28},{23,28,56}},crash_report,[[{pid,<0.7.0},{registered_name,[]},{error_info,{exit,{shutdown,{kernel,start,[normal,[]]}},[{application_master,init,4},{proc_lib,init_p_do_apply,3}]}},{initial_call,{application_master,init,['Argument_1','Argument_2','Argument_3','Argument_4']}},{ancestors,[<0.6.0]},{messages,[{'EXIT',<0.8.0,normal}]},{links,[<0.6.0,<0.5.0]},{dictionary,[]},{trap_exit,true},{status,running},{heap_size,233},{stack_size,23},{reductions,123}],[]]} {error_logger,{{2010,5,28},{23,28,56}},std_info,[{application,kernel},{exited,{shutdown,{kernel,start,[normal,[]]}}},{type,permanent}]} {"Kernel pid terminated",application_controller,"{application_start_failure,kernel,{shutdown,{kernel,start,[normal,[]]}}}"} Crash dump was written to: erl_crash.dump Kernel pid terminated (application_controller) ({application_start_failure,kernel,{shutdown,{kernel,start,[normal,[]]}}}) root@domU-12-31-39-0F-7D-14:/var/lib/ejabberd# cat /var/log/ejabberd/ejabberd.log =INFO REPORT==== 2010-05-28 22:48:53 === I(<0.321.0:mod_pubsub:154) : pubsub init "localhost" [{access_createnode, pubsub_createnode}, {plugins, ["default","pep"]}] =INFO REPORT==== 2010-05-28 22:48:53 === I(<0.321.0:mod_pubsub:210) : ** tree plugin is nodetree_default =INFO REPORT==== 2010-05-28 22:48:53 === I(<0.321.0:mod_pubsub:214) : ** init default plugin =INFO REPORT==== 2010-05-28 22:48:53 === I(<0.321.0:mod_pubsub:214) : ** init pep plugin =ERROR REPORT==== 2010-05-28 23:40:08 === ** Connection attempt from disallowed node 'ejabberdctl1275090008486951000@domU-12-31-39-0F-7D-14' ** =ERROR REPORT==== 2010-05-28 23:41:10 === ** Connection attempt from disallowed node 'ejabberdctl1275090070163253000@domU-12-31-39-0F-7D-14' **

    Read the article

  • Getting java.lang.ClassNotFoundException: javax.servlet.ServletContext in junit

    - by coder
    I'm using spring mvc in my application and I'm writing junit test cases for a DAO. But when I run the test, I get an error java.lang.ClassNotFoundException: javax.servlet.ServletContext. In the stacktrace, I see that this error is caused during getApplicationContext. In my applicationContext, I havent defined any servlet. Servlet mapping is done only in web.xml so I dont understand why I'm getting this error. Here is my applicationContext.xml: <?xml version="1.0" encoding="UTF-8"?> <beans xmlns="http://www.springframework.org/schema/beans" xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xmlns:p="http://www.springframework.org/schema/p" xmlns:context="http://www.springframework.org/schema/context" xmlns:mvc="http://www.springframework.org/schema/mvc" xsi:schemaLocation="http://www.springframework.org/schema/beans http://www.springframework.org/schema/beans/spring-beans-3.0.xsd http://www.springframework.org/schema/tx http://www.springframework.org/schema/tx/spring-tx-2.0.xsd http://www.springframework.org/schema/aop http://www.springframework.org/schema/aop/spring-aop-2.0.xsd http://www.springframework.org/schema/context http://www.springframework.org/schema/context/spring-context-3.0.xsd http://www.springframework.org/schema/mvc http://www.springframework.org/schema/mvc/spring-mvc-3.0.xsd" xmlns:tx="http://www.springframework.org/schema/tx"> <bean id="dataSource" class="com.mchange.v2.c3p0.ComboPooledDataSource" destroy-method="close"> <property name="driverClass" value="com.mysql.jdbc.Driver"/> <property name="jdbcUrl" value="jdbc:mysql://localhost:3306/testdb"/> <property name="user" value="username"/> </bean> <bean id="sessionFactory" class="org.springframework.orm.hibernate3.annotation.AnnotationSessionFactoryBean"> <property name="dataSource" ref="dataSource"/> <property name="hibernateProperties"> <props> <prop key="hibernate.dialect">org.hibernate.dialect.MySQLDialect</prop> <prop key="hibernate.connection.driver_class">com.mysql.jdbc.Driver</prop> <prop key="hibernate.connection.url">jdbc:mysql://localhost:3306/myWorld_test</prop> <prop key="hibernate.connection.username">username</prop> </props> </property> <property name="packagesToScan"> <list> <value>com.myprojects.pojos</value> </list> </property> </bean> <bean id="hibernateTemplate" class="org.springframework.orm.hibernate3.HibernateTemplate"> <property name="sessionFactory" ref="sessionFactory"/> </bean> <tx:annotation-driven transaction-manager="transactionManager"/> <bean id="transactionManager" class="org.springframework.orm.hibernate3.HibernateTransactionManager"> <property name="sessionFactory" ref="sessionFactory" /> </bean> <context:component-scan base-package="com.myprojects"/> <context:annotation-config/> <mvc:annotation-driven/> </beans> Here is the stacktrace: java.lang.NoClassDefFoundError: javax/servlet/ServletContext at java.lang.Class.getDeclaredMethods0(Native Method) at java.lang.Class.privateGetDeclaredMethods(Class.java:2521) at java.lang.Class.getDeclaredMethods(Class.java:1845) at org.springframework.core.type.StandardAnnotationMetadata.hasAnnotatedMethods(StandardAnnotationMetadata.java:161) at org.springframework.context.annotation.ConfigurationClassUtils.isLiteConfigurationCandidate(ConfigurationClassUtils.java:106) at org.springframework.context.annotation.ConfigurationClassUtils.checkConfigurationClassCandidate(ConfigurationClassUtils.java:88) at org.springframework.context.annotation.ConfigurationClassPostProcessor.processConfigBeanDefinitions(ConfigurationClassPostProcessor.java:253) at org.springframework.context.annotation.ConfigurationClassPostProcessor.postProcessBeanDefinitionRegistry(ConfigurationClassPostProcessor.java:223) at org.springframework.context.support.AbstractApplicationContext.invokeBeanFactoryPostProcessors(AbstractApplicationContext.java:630) at org.springframework.context.support.AbstractApplicationContext.refresh(AbstractApplicationContext.java:461) at org.springframework.test.context.support.AbstractGenericContextLoader.loadContext(AbstractGenericContextLoader.java:120) at org.springframework.test.context.support.AbstractGenericContextLoader.loadContext(AbstractGenericContextLoader.java:60) at org.springframework.test.context.support.AbstractDelegatingSmartContextLoader.delegateLoading(AbstractDelegatingSmartContextLoader.java:100) at org.springframework.test.context.support.AbstractDelegatingSmartContextLoader.loadContext(AbstractDelegatingSmartContextLoader.java:248) at org.springframework.test.context.CacheAwareContextLoaderDelegate.loadContextInternal(CacheAwareContextLoaderDelegate.java:64) at org.springframework.test.context.CacheAwareContextLoaderDelegate.loadContext(CacheAwareContextLoaderDelegate.java:91) at org.springframework.test.context.TestContext.getApplicationContext(TestContext.java:122) at org.springframework.test.context.support.DependencyInjectionTestExecutionListener.injectDependencies(DependencyInjectionTestExecutionListener.java:109) at org.springframework.test.context.support.DependencyInjectionTestExecutionListener.prepareTestInstance(DependencyInjectionTestExecutionListener.java:75) at org.springframework.test.context.TestContextManager.prepareTestInstance(TestContextManager.java:312) at org.springframework.test.context.junit4.SpringJUnit4ClassRunner.createTest(SpringJUnit4ClassRunner.java:211) at org.springframework.test.context.junit4.SpringJUnit4ClassRunner$1.runReflectiveCall(SpringJUnit4ClassRunner.java:288) at org.junit.internal.runners.model.ReflectiveCallable.run(ReflectiveCallable.java:12) at org.springframework.test.context.junit4.SpringJUnit4ClassRunner.methodBlock(SpringJUnit4ClassRunner.java:284) at org.springframework.test.context.junit4.SpringJUnit4ClassRunner.runChild(SpringJUnit4ClassRunner.java:231) at org.springframework.test.context.junit4.SpringJUnit4ClassRunner.runChild(SpringJUnit4ClassRunner.java:88) at org.junit.runners.ParentRunner$3.run(ParentRunner.java:238) at org.junit.runners.ParentRunner$1.schedule(ParentRunner.java:63) at org.junit.runners.ParentRunner.runChildren(ParentRunner.java:236) at org.junit.runners.ParentRunner.access$000(ParentRunner.java:53) at org.junit.runners.ParentRunner$2.evaluate(ParentRunner.java:229) at org.junit.internal.runners.statements.RunBefores.evaluate(RunBefores.java:26) at org.springframework.test.context.junit4.statements.RunBeforeTestClassCallbacks.evaluate(RunBeforeTestClassCallbacks.java:61) at org.junit.internal.runners.statements.RunAfters.evaluate(RunAfters.java:27) at org.springframework.test.context.junit4.statements.RunAfterTestClassCallbacks.evaluate(RunAfterTestClassCallbacks.java:71) at org.junit.runners.ParentRunner.run(ParentRunner.java:309) at org.springframework.test.context.junit4.SpringJUnit4ClassRunner.run(SpringJUnit4ClassRunner.java:174) at org.gradle.api.internal.tasks.testing.junit.JUnitTestClassExecuter.runTestClass(JUnitTestClassExecuter.java:80) at org.gradle.api.internal.tasks.testing.junit.JUnitTestClassExecuter.execute(JUnitTestClassExecuter.java:47) at org.gradle.api.internal.tasks.testing.junit.JUnitTestClassProcessor.processTestClass(JUnitTestClassProcessor.java:69) at org.gradle.api.internal.tasks.testing.SuiteTestClassProcessor.processTestClass(SuiteTestClassProcessor.java:49) at sun.reflect.NativeMethodAccessorImpl.invoke0(Native Method) at sun.reflect.NativeMethodAccessorImpl.invoke(NativeMethodAccessorImpl.java:57) at sun.reflect.DelegatingMethodAccessorImpl.invoke(DelegatingMethodAccessorImpl.java:43) at java.lang.reflect.Method.invoke(Method.java:606) at org.gradle.messaging.dispatch.ReflectionDispatch.dispatch(ReflectionDispatch.java:35) at org.gradle.messaging.dispatch.ReflectionDispatch.dispatch(ReflectionDispatch.java:24) at org.gradle.messaging.dispatch.ContextClassLoaderDispatch.dispatch(ContextClassLoaderDispatch.java:32) at org.gradle.messaging.dispatch.ProxyDispatchAdapter$DispatchingInvocationHandler.invoke(ProxyDispatchAdapter.java:93) at com.sun.proxy.$Proxy2.processTestClass(Unknown Source) at org.gradle.api.internal.tasks.testing.worker.TestWorker.processTestClass(TestWorker.java:103) at sun.reflect.NativeMethodAccessorImpl.invoke0(Native Method) at sun.reflect.NativeMethodAccessorImpl.invoke(NativeMethodAccessorImpl.java:57) at sun.reflect.DelegatingMethodAccessorImpl.invoke(DelegatingMethodAccessorImpl.java:43) at java.lang.reflect.Method.invoke(Method.java:606) at org.gradle.messaging.dispatch.ReflectionDispatch.dispatch(ReflectionDispatch.java:35) at org.gradle.messaging.dispatch.ReflectionDispatch.dispatch(ReflectionDispatch.java:24) at org.gradle.messaging.remote.internal.hub.MessageHub$Handler.run(MessageHub.java:355) at org.gradle.internal.concurrent.DefaultExecutorFactory$StoppableExecutorImpl$1.run(DefaultExecutorFactory.java:66) at java.util.concurrent.ThreadPoolExecutor.runWorker(ThreadPoolExecutor.java:1145) at java.util.concurrent.ThreadPoolExecutor$Worker.run(ThreadPoolExecutor.java:615) at java.lang.Thread.run(Thread.java:724) Caused by: java.lang.ClassNotFoundException: javax.servlet.ServletContext at java.net.URLClassLoader$1.run(URLClassLoader.java:366) at java.net.URLClassLoader$1.run(URLClassLoader.java:355) at java.security.AccessController.doPrivileged(Native Method) at java.net.URLClassLoader.findClass(URLClassLoader.java:354) at java.lang.ClassLoader.loadClass(ClassLoader.java:424) at sun.misc.Launcher$AppClassLoader.loadClass(Launcher.java:308) at java.lang.ClassLoader.loadClass(ClassLoader.java:357) ... 62 more Test class: import org.junit.After; import org.junit.AfterClass; import org.junit.Before; import org.junit.BeforeClass; import org.junit.Test; import static org.junit.Assert.*; import org.junit.runner.RunWith; import org.springframework.beans.factory.annotation.Autowired; import org.springframework.test.context.ContextConfiguration; import org.springframework.test.context.junit4.SpringJUnit4ClassRunner; @RunWith(SpringJUnit4ClassRunner.class) @ContextConfiguration(locations = {"classpath:applicationContext.xml"}) public class UserServiceTest { @Autowired private UserService service; public UserServiceTest() { } @BeforeClass public static void setUpClass() { } @AfterClass public static void tearDownClass() { } @Before public void setUp() { } @After public void tearDown() { } } Even before writing any test method, I got this error. Any idea why this error?

    Read the article

  • C#: Inheritance, Overriding, and Hiding

    - by Rosarch
    I'm having difficulty with an architectural decision for my C# XNA game. The basic entity in the world, such as a tree, zombie, or the player, is represented as a GameObject. Each GameObject is composed of at least a GameObjectController, GameObjectModel, and GameObjectView. These three are enough for simple entities, like inanimate trees or rocks. However, as I try to keep the functionality as factored out as possible, the inheritance begins to feel unwieldy. Syntactically, I'm not even sure how best to accomplish my goals. Here is the GameObjectController: public class GameObjectController { protected GameObjectModel model; protected GameObjectView view; public GameObjectController(GameObjectManager gameObjectManager) { this.gameObjectManager = gameObjectManager; model = new GameObjectModel(this); view = new GameObjectView(this); } public GameObjectManager GameObjectManager { get { return gameObjectManager; } } public virtual GameObjectView View { get { return view; } } public virtual GameObjectModel Model { get { return model; } } public virtual void Update(long tick) { } } I want to specify that each subclass of GameObjectController will have accessible at least a GameObjectView and GameObjectModel. If subclasses are fine using those classes, but perhaps are overriding for a more sophisticated Update() method, I don't want them to have to duplicate the code to produce those dependencies. So, the GameObjectController constructor sets those objects up. However, some objects do want to override the model and view. This is where the trouble comes in. Some objects need to fight, so they are CombatantGameObjects: public class CombatantGameObject : GameObjectController { protected new readonly CombatantGameModel model; public new virtual CombatantGameModel Model { get { return model; } } protected readonly CombatEngine combatEngine; public CombatantGameObject(GameObjectManager gameObjectManager, CombatEngine combatEngine) : base(gameObjectManager) { model = new CombatantGameModel(this); this.combatEngine = combatEngine; } public override void Update(long tick) { if (model.Health <= 0) { gameObjectManager.RemoveFromWorld(this); } base.Update(tick); } } Still pretty simple. Is my use of new to hide instance variables correct? Note that I'm assigning CombatantObjectController.model here, even though GameObjectController.Model was already set. And, combatants don't need any special view functionality, so they leave GameObjectController.View alone. Then I get down to the PlayerController, at which a bug is found. public class PlayerController : CombatantGameObject { private readonly IInputReader inputReader; private new readonly PlayerModel model; public new PlayerModel Model { get { return model; } } private float lastInventoryIndexAt; private float lastThrowAt; public PlayerController(GameObjectManager gameObjectManager, IInputReader inputReader, CombatEngine combatEngine) : base(gameObjectManager, combatEngine) { this.inputReader = inputReader; model = new PlayerModel(this); Model.Health = Constants.PLAYER_HEALTH; } public override void Update(long tick) { if (Model.Health <= 0) { gameObjectManager.RemoveFromWorld(this); for (int i = 0; i < 10; i++) { Debug.WriteLine("YOU DEAD SON!!!"); } return; } UpdateFromInput(tick); // .... } } The first time that this line is executed, I get a null reference exception: model.Body.ApplyImpulse(movementImpulse, model.Position); model.Position looks at model.Body, which is null. This is a function that initializes GameObjects before they are deployed into the world: public void Initialize(GameObjectController controller, IDictionary<string, string> data, WorldState worldState) { controller.View.read(data); controller.View.createSpriteAnimations(data, _assets); controller.Model.read(data); SetUpPhysics(controller, worldState, controller.Model.BoundingCircleRadius, Single.Parse(data["x"]), Single.Parse(data["y"]), bool.Parse(data["isBullet"])); } Every object is passed as a GameObjectController. Does that mean that if the object is really a PlayerController, controller.Model will refer to the base's GameObjectModel and not the PlayerController's overriden PlayerObjectModel? In response to rh: This means that now for a PlayerModel p, p.Model is not equivalent to ((CombatantGameObject)p).Model, and also not equivalent to ((GameObjectController)p).Model. That is exactly what I do not want. I want: PlayerController p; p.Model == ((CombatantGameObject)p).Model p.Model == ((GameObjectController)p).Model How can I do this? override?

    Read the article

  • improving conversions to binary and back in C#

    - by Saad Imran.
    I'm trying to write a general purpose socket server for a game I'm working on. I know I could very well use already built servers like SmartFox and Photon, but I wan't to go through the pain of creating one myself for learning purposes. I've come up with a BSON inspired protocol to convert the the basic data types, their arrays, and a special GSObject to binary and arrange them in a way so that it can be put back together into object form on the client end. At the core, the conversion methods utilize the .Net BitConverter class to convert the basic data types to binary. Anyways, the problem is performance, if I loop 50,000 times and convert my GSObject to binary each time it takes about 5500ms (the resulting byte[] is just 192 bytes per conversion). I think think this would be way too slow for an MMO that sends 5-10 position updates per second with a 1000 concurrent users. Yes, I know it's unlikely that a game will have a 1000 users on at the same time, but like I said earlier this is supposed to be a learning process for me, I want to go out of my way and build something that scales well and can handle at least a few thousand users. So yea, if anyone's aware of other conversion techniques or sees where I'm loosing performance I would appreciate the help. GSBitConverter.cs This is the main conversion class, it adds extension methods to main datatypes to convert to the binary format. It uses the BitConverter class to convert the base types. I've shown only the code to convert integer and integer arrays, but the rest of the method are pretty much replicas of those two, they just overload the type. public static class GSBitConverter { public static byte[] ToGSBinary(this short value) { return BitConverter.GetBytes(value); } public static byte[] ToGSBinary(this IEnumerable<short> value) { List<byte> bytes = new List<byte>(); short length = (short)value.Count(); bytes.AddRange(length.ToGSBinary()); for (int i = 0; i < length; i++) bytes.AddRange(value.ElementAt(i).ToGSBinary()); return bytes.ToArray(); } public static byte[] ToGSBinary(this bool value); public static byte[] ToGSBinary(this IEnumerable<bool> value); public static byte[] ToGSBinary(this IEnumerable<byte> value); public static byte[] ToGSBinary(this int value); public static byte[] ToGSBinary(this IEnumerable<int> value); public static byte[] ToGSBinary(this long value); public static byte[] ToGSBinary(this IEnumerable<long> value); public static byte[] ToGSBinary(this float value); public static byte[] ToGSBinary(this IEnumerable<float> value); public static byte[] ToGSBinary(this double value); public static byte[] ToGSBinary(this IEnumerable<double> value); public static byte[] ToGSBinary(this string value); public static byte[] ToGSBinary(this IEnumerable<string> value); public static string GetHexDump(this IEnumerable<byte> value); } Program.cs Here's the the object that I'm converting to binary in a loop. class Program { static void Main(string[] args) { GSObject obj = new GSObject(); obj.AttachShort("smallInt", 15); obj.AttachInt("medInt", 120700); obj.AttachLong("bigInt", 10900800700); obj.AttachDouble("doubleVal", Math.PI); obj.AttachStringArray("muppetNames", new string[] { "Kermit", "Fozzy", "Piggy", "Animal", "Gonzo" }); GSObject apple = new GSObject(); apple.AttachString("name", "Apple"); apple.AttachString("color", "red"); apple.AttachBool("inStock", true); apple.AttachFloat("price", (float)1.5); GSObject lemon = new GSObject(); apple.AttachString("name", "Lemon"); apple.AttachString("color", "yellow"); apple.AttachBool("inStock", false); apple.AttachFloat("price", (float)0.8); GSObject apricoat = new GSObject(); apple.AttachString("name", "Apricoat"); apple.AttachString("color", "orange"); apple.AttachBool("inStock", true); apple.AttachFloat("price", (float)1.9); GSObject kiwi = new GSObject(); apple.AttachString("name", "Kiwi"); apple.AttachString("color", "green"); apple.AttachBool("inStock", true); apple.AttachFloat("price", (float)2.3); GSArray fruits = new GSArray(); fruits.AddGSObject(apple); fruits.AddGSObject(lemon); fruits.AddGSObject(apricoat); fruits.AddGSObject(kiwi); obj.AttachGSArray("fruits", fruits); Stopwatch w1 = Stopwatch.StartNew(); for (int i = 0; i < 50000; i++) { byte[] b = obj.ToGSBinary(); } w1.Stop(); Console.WriteLine(BitConverter.IsLittleEndian ? "Little Endian" : "Big Endian"); Console.WriteLine(w1.ElapsedMilliseconds + "ms"); } Here's the code for some of my other classes that are used in the code above. Most of it is repetitive. GSObject GSArray GSWrappedObject

    Read the article

  • Ignoring focusLost(), SWT.Verify, or other SWT listeners in Java code.

    - by Zoot
    Outside of the actual SWT listener, is there any way to ignore a listener via code? For example, I have a java program that implements SWT Text Widgets, and the widgets have: SWT.Verify listeners to filter out unwanted text input. ModifyListeners to wait for the correct number of valid input characters and automatically set focus (using setFocus())to the next valid field, skipping the other text widgets in the tab order. focusLost(FocusEvent) FocusListeners that wait for the loss of focus from the text widget to perform additional input verification and execute an SQL query based on the user input. The issue I run into is clearing the text widgets. One of the widgets has the format "####-##" (Four Numbers, a hyphen, then two numbers) and I have implemented this listener, which is a modified version of SWT Snippet Snippet179. The initial text for this text widget is " - " to provide visual feedback to the user as to the expected format. Only numbers are acceptable input, and the program automatically skips past the hyphen at the appropriate point. /* * This listener was adapted from the "verify input in a template (YYYY/MM/DD)" SWT Code * Snippet (also known as Snippet179), from the Snippets page of the SWT Project. * SWT Code Snippets can be found at: * http://www.eclipse.org/swt/snippets/ */ textBox.addListener(SWT.Verify, new Listener() { boolean ignore; public void handleEvent(Event e) { if (ignore) return; e.doit = false; StringBuffer buffer = new StringBuffer(e.text); char[] chars = new char[buffer.length()]; buffer.getChars(0, chars.length, chars, 0); if (e.character == '\b') { for (int i = e.start; i < e.end; i++) { switch (i) { case 0: /* [x]xxx-xx */ case 1: /* x[x]xx-xx */ case 2: /* xx[x]x-xx */ case 3: /* xxx[x]-xx */ case 5: /* xxxx-[x]x */ case 6: /* xxxx-x[x] */ { buffer.append(' '); break; } case 4: /* xxxx[-]xx */ { buffer.append('-'); break; } default: return; } } textBox.setSelection(e.start, e.start + buffer.length()); ignore = true; textBox.insert(buffer.toString()); ignore = false; textBox.setSelection(e.start, e.start); return; } int start = e.start; if (start > 6) return; int index = 0; for (int i = 0; i < chars.length; i++) { if (start + index == 4) { if (chars[i] == '-') { index++; continue; } buffer.insert(index++, '-'); } if (chars[i] < '0' || '9' < chars[i]) return; index++; } String newText = buffer.toString(); int length = newText.length(); textBox.setSelection(e.start, e.start + length); ignore = true; textBox.insert(newText); ignore = false; /* * After a valid key press, verifying if the input is completed * and passing the cursor to the next text box. */ if (7 == textBox.getCaretPosition()) { /* * Attempting to change the text after receiving a known valid input that has no results (0000-00). */ if ("0000-00".equals(textBox.getText())) { // "0000-00" is the special "Erase Me" code for these text boxes. ignore = true; textBox.setText(" - "); ignore = false; } // Changing focus to a different textBox by using "setFocus()" method. differentTextBox.setFocus(); } } } ); As you can see, the only method I've figured out to clear this text widget from a different point in the code is by assigning "0000-00" textBox.setText("000000") and checking for that input in the listener. When that input is received, the listener changes the text back to " - " (four spaces, a hyphen, then two spaces). There is also a focusLost Listener that parses this text widget for spaces, then in order to avoid unnecessary SQL queries, it clears/resets all fields if the input is invalid (i.e contains spaces). // Adding focus listener to textBox to wait for loss of focus to perform SQL statement. textBox.addFocusListener(new FocusAdapter() { @Override public void focusLost(FocusEvent evt) { // Get the contents of otherTextBox and textBox. (otherTextBox must be <= textBox) String boxFour = otherTextBox.getText(); String boxFive = textBox.getText(); // If either text box has spaces in it, don't perform the search. if (boxFour.contains(" ") || boxFive.contains(" ")) { // Don't perform SQL statements. Debug statement. System.out.println("Tray Position input contains spaces. Ignoring."); //Make all previous results invisible, if any. labels.setVisible(false); differentTextBox.setText(""); labelResults.setVisible(false); } else { //... Perform SQL statement ... } } } ); OK. Often, I use SWT MessageBox widgets in this code to communicate to the user, or wish to change the text widgets back to an empty state after verifying the input. The problem is that messageboxes seem to create a focusLost event, and using the .setText(string) method is subject to SWT.Verify listeners that are present on the text widget. Any suggestions as to selectively ignoring these listeners in code, but keeping them present for all other user input? Thank you in advance for your assistance.

    Read the article

  • @ContextConfiguration in Spring 3.0 give me No default constructor found

    - by atomsfat
    I have already do the test using AbstractDependencyInjectionSpringContextTests and it works but in spring 3 it is deprecated, so I decided to try @ContextConfiguration but spring say that default constructor is not found, I check and the class doesn't have any constructor. If I use this test spring give the object. package atoms.portales.servicios.impl; import atoms.portales.model.Cliente; import atoms.portales.servicios.ClienteService; import java.util.List; import javax.persistence.EntityManager; import org.springframework.test.AbstractDependencyInjectionSpringContextTests; /** * * @author tsalazar */ public class ClienteServiceImplDeTest extends AbstractDependencyInjectionSpringContextTests{ private ClienteService clienteService; public ClienteService getClienteService() { return clienteService; } public void setClienteService(ClienteService clienteService) { this.clienteService = clienteService; } public ClienteServiceImplDeTest(String testName) { super(testName); } @Override protected String[] getConfigLocations() { return new String[]{"PersistenceAppCtx.xml", "ServicesAppCtx.xml"}; } /** * Test of buscaCliente method, of class ClienteServiceImplDeTest. */ public void testBuscaCliente() { System.out.println("======================================="); System.out.println("buscaCliente"); String nombre = ""; System.out.println(clienteService); System.out.println("======================================="); } } But if I use this, spring say that default constructor is not found. package atoms.config.portales.servicios.impl; import atoms.portales.model.Cliente; import atoms.portales.servicios.ClienteService; import org.junit.runner.RunWith; import org.junit.Test; import org.springframework.beans.factory.annotation.Autowired; import org.springframework.test.context.ContextConfiguration; import org.springframework.test.context.junit4.SpringJUnit4ClassRunner; import org.springframework.test.context.transaction.TransactionConfiguration; import org.springframework.transaction.annotation.Transactional; /** * * @author tsalazar */ @RunWith(SpringJUnit4ClassRunner.class) @ContextConfiguration(locations = {"/PersistenceAppCtx.xml", "/ServicesAppCtx.xml"}) @TransactionConfiguration(transactionManager = "transactionManager") @Transactional public class ClienteServiceImplTest { @Autowired private ClienteService clienteService; /** * Test of buscaCliente method, of class ClienteServiceImpl. */ @Test public void testBuscaCliente() { System.out.println("======================================="); System.out.println("buscaCliente"); System.out.println(clienteService); System.out.println("======================================="); } } This how I do the implementacion: package atoms.portales.servicios; import atoms.portales.model; /** * Una interface para obtener clientes, con sus surcursales, servicios, layouts * y contratos. Tambien soporta operaciones CRUD. * @author tsalazar */ public interface ClienteService { /** * Busca clientes a partir del nombre * @param nombre */ public Cliente buscaCliente(String nombre); } the implemetacion package atoms.portales..servicios.impl; import atoms.portales.model.Cliente; import atoms.portales.servicios.ClienteService; import javax.persistence.EntityManager; import javax.persistence.PersistenceContext; import org.springframework.stereotype.Repository; import org.springframework.stereotype.Service; import org.springframework.transaction.annotation.Transactional; /** * A JPA-based implementation.Delegates to a JPA entity manager to issue data access calls * against the backing repository. The EntityManager reference is provided by the managing container (Spring) * automatically. */ @Service("clienteSerivice") @Repository public class ClienteServiceImpl implements ClienteService { public ClienteServiceImpl() { } private EntityManager em; @PersistenceContext public void setEntityManager(EntityManager em) { this.em = em; } @Transactional(readOnly = true) public Cliente buscaCliente(String nombre) { Cliente cliente = em.getReference(Cliente.class, 1l); return cliente; } } spring configuration: <?xml version="1.0" encoding="UTF-8"?> <beans xmlns="http://www.springframework.org/schema/beans" xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xmlns:tx="http://www.springframework.org/schema/tx" xsi:schemaLocation=" http://www.springframework.org/schema/beans http://www.springframework.org/schema/beans/spring-beans-2.5.xsd http://www.springframework.org/schema/tx http://www.springframework.org/schema/tx/spring-tx-2.5.xsd"> <!-- Instructs Spring to perfrom declarative transaction management on annotated classes --> <tx:annotation-driven /> <!-- Drives transactions using local JPA APIs --> <bean id="transactionManager" class="org.springframework.orm.jpa.JpaTransactionManager"> <property name="entityManagerFactory" ref="entityManagerFactory" /> </bean> <!-- Creates a EntityManagerFactory for use with the Hibernate JPA provider and a simple in-memory data source populated with test data --> <bean id="entityManagerFactory" class="org.springframework.orm.jpa.LocalContainerEntityManagerFactoryBean"> <property name="dataSource" ref="dataSource" /> <property name="jpaVendorAdapter"> <bean class="org.springframework.orm.jpa.vendor.HibernateJpaVendorAdapter" /> </property> </bean> <!-- Deploys a in-memory "booking" datasource populated --> <bean id="dataSource" class="org.springframework.jdbc.datasource.DriverManagerDataSource"> <property name="driverClassName" value="org.hsqldb.jdbcDriver" /> <property name="url" value="jdbc:hsqldb:hsql://localhost/test" /> <property name="username" value="sa" /> <property name="password" value="" /> </bean> <context:component-scan base-package="atoms.portales.servicios" /> </beans> This is the persistence.xml <?xml version="1.0" encoding="UTF-8"?> <persistence xmlns="http://java.sun.com/xml/ns/persistence" xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xsi:schemaLocation="http://java.sun.com/xml/ns/persistence http://java.sun.com/xml/ns/persistence/persistence_1_0.xsd" version="1.0"> <persistence-unit name="configuradorPortales" transaction-type="RESOURCE_LOCAL"> <provider>org.hibernate.ejb.HibernatePersistence</provider> <class>atoms.portales.model.Cliente</class> <properties> <property name="hibernate.dialect" value="org.hibernate.dialect.HSQLDialect"/> <property name="hibernate.hbm2ddl.auto" value="create-drop"/> <property name="hibernate.show_sql" value="true"/> <property name="hibernate.cache.provider_class" value="org.hibernate.cache.HashtableCacheProvider"/> </properties> </persistence-unit> </persistence> This is the error that give me:

    Read the article

  • Making swap faster, easier to use and exception-safe

    - by FredOverflow
    I could not sleep last night and started thinking about std::swap. Here is the familiar C++98 version: template <typename T> void swap(T& a, T& b) { T c(a); a = b; b = c; } If a user-defined class Foo uses external ressources, this is inefficient. The common idiom is to provide a method void Foo::swap(Foo& other) and a specialization of std::swap<Foo>. Note that this does not work with class templates since you cannot partially specialize a function template, and overloading names in the std namespace is illegal. The solution is to write a template function in one's own namespace and rely on argument dependent lookup to find it. This depends critically on the client to follow the "using std::swap idiom" instead of calling std::swap directly. Very brittle. In C++0x, if Foo has a user-defined move constructor and a move assignment operator, providing a custom swap method and a std::swap<Foo> specialization has little to no performance benefit, because the C++0x version of std::swap uses efficient moves instead of copies: #include <utility> template <typename T> void swap(T& a, T& b) { T c(std::move(a)); a = std::move(b); b = std::move(c); } Not having to fiddle with swap anymore already takes a lot of burden away from the programmer. Current compilers do not generate move constructors and move assignment operators automatically yet, but as far as I know, this will change. The only problem left then is exception-safety, because in general, move operations are allowed to throw, and this opens up a whole can of worms. The question "What exactly is the state of a moved-from object?" complicates things further. Then I was thinking, what exactly are the semantics of std::swap in C++0x if everything goes fine? What is the state of the objects before and after the swap? Typically, swapping via move operations does not touch external resources, only the "flat" object representations themselves. So why not simply write a swap template that does exactly that: swap the object representations? #include <cstring> template <typename T> void swap(T& a, T& b) { unsigned char c[sizeof(T)]; memcpy( c, &a, sizeof(T)); memcpy(&a, &b, sizeof(T)); memcpy(&b, c, sizeof(T)); } This is as efficient as it gets: it simply blasts through raw memory. It does not require any intervention from the user: no special swap methods or move operations have to be defined. This means that it even works in C++98 (which does not have rvalue references, mind you). But even more importantly, we can now forget about the exception-safety issues, because memcpy never throws. I can see two potential problems with this approach: First, not all objects are meant to be swapped. If a class designer hides the copy constructor or the copy assignment operator, trying to swap objects of the class should fail at compile-time. We can simply introduce some dead code that checks whether copying and assignment are legal on the type: template <typename T> void swap(T& a, T& b) { if (false) // dead code, never executed { T c(a); // copy-constructible? a = b; // assignable? } unsigned char c[sizeof(T)]; std::memcpy( c, &a, sizeof(T)); std::memcpy(&a, &b, sizeof(T)); std::memcpy(&b, c, sizeof(T)); } Any decent compiler can trivially get rid of the dead code. (There are probably better ways to check the "swap conformance", but that is not the point. What matters is that it's possible). Second, some types might perform "unusual" actions in the copy constructor and copy assignment operator. For example, they might notify observers of their change. I deem this a minor issue, because such kinds of objects probably should not have provided copy operations in the first place. Please let me know what you think of this approach to swapping. Would it work in practice? Would you use it? Can you identify library types where this would break? Do you see additional problems? Discuss!

    Read the article

  • Maze not generating properly. Out of bounds exception. need quick fix

    - by Dan Joseph Porcioncula
    My maze generator seems to have a problem. I am trying to generate something like the maze from http://mazeworks.com/mazegen/mazetut/index.htm . My program displays this http://a1.sphotos.ak.fbcdn.net/hphotos-ak-snc7/s320x320/374060_426350204045347_100000111130260_1880768_1572427285_n.jpg and the error Exception in thread "main" java.lang.ArrayIndexOutOfBoundsException: -1 at Grid.genRand(Grid.java:73) at Grid.main(Grid.java:35) How do I fix my generator program? import java.awt.*; import java.awt.Color; import java.awt.Component; import java.awt.Graphics; import javax.swing.*; import java.util.ArrayList; public class Grid extends Canvas { Cell[][] maze; int size; int pathSize; double width, height; ArrayList<int[]> coordinates = new ArrayList<int[]>(); public Grid(int size, int h, int w) { this.size = size; maze = new Cell[size][size]; for(int i = 0; i<size; i++){ for(int a =0; a<size; a++){ maze[i][a] = new Cell(); } } setPreferredSize(new Dimension(h, w)); } public static void main(String[] args) { JFrame y = new JFrame(); y.setLayout(new BorderLayout()); Grid f = new Grid(25, 400, 400); y.add(f, BorderLayout.CENTER); y.setSize(450, 450); y.setVisible(true); y.setDefaultCloseOperation(y.EXIT_ON_CLOSE); f.genRand(); f.repaint(); } public void push(int[] xy) { coordinates.add(xy); int i = coordinates.size(); coordinates.ensureCapacity(i++); } public int[] pop() { int[] x = coordinates.get((coordinates.size())-1); coordinates.remove((coordinates.size())-1); return x; } public int[] top() { return coordinates.get((coordinates.size())-1); } public void genRand(){ // create a CellStack (LIFO) to hold a list of cell locations [x] // set TotalCells = number of cells in grid int TotalCells = size*size; // choose a cell at random and call it CurrentCell int m = randomInt(size); int n = randomInt(size); Cell curCel = maze[m][n]; // set VisitedCells = 1 int visCel = 1,d=0; int[] q; int h,o = 0,p = 0; // while VisitedCells < TotalCells while( visCel < TotalCells){ // find all neighbors of CurrentCell with all walls intact if(maze[m-1][n].countWalls() == 4){d++;} if(maze[m+1][n].countWalls() == 4){d++;} if(maze[m][n-1].countWalls() == 4){d++;} if(maze[m][n+1].countWalls() == 4){d++;} // if one or more found if(d!=0){ Point[] ls = new Point[4]; ls[0] = new Point(m-1,n); ls[1] = new Point(m+1,n); ls[2] = new Point(m,n-1); ls[3] = new Point(m,n+1); // knock down the wall between it and CurrentCell h = randomInt(3); switch(h){ case 0: o = (int)(ls[0].getX()); p = (int)(ls[0].getY()); curCel.destroyWall(2); maze[o][p].destroyWall(1); break; case 1: o = (int)(ls[1].getX()); p = (int)(ls[1].getY()); curCel.destroyWall(1); maze[o][p].destroyWall(2); break; case 2: o = (int)(ls[2].getX()); p = (int)(ls[2].getY()); curCel.destroyWall(3); maze[o][p].destroyWall(0); break; case 3: o = (int)(ls[3].getX()); p = (int)(ls[3].getY()); curCel.destroyWall(0); maze[o][p].destroyWall(3); break; } // push CurrentCell location on the CellStack push(new int[] {m,n}); // make the new cell CurrentCell m = o; n = p; curCel = maze[m][n]; // add 1 to VisitedCells visCel++; } // else else{ // pop the most recent cell entry off the CellStack q = pop(); m = q[0]; n = q[1]; curCel = maze[m][n]; // make it CurrentCell // endIf } // endWhile } } public int randomInt(int s) { return (int)(s* Math.random());} public void paint(Graphics g) { int k, j; width = getSize().width; height = getSize().height; double htOfRow = height / (size); double wdOfRow = width / (size); //checks verticals - destroys east border of cell for (k = 0; k < size; k++) { for (j = 0; j < size; j++) { if(maze[k][j].checkWall(2)){ g.drawLine((int) (k * wdOfRow), (int) (j * htOfRow), (int) (k * wdOfRow), (int) ((j+1) * htOfRow)); }} } //checks horizontal - destroys north border of cell for (k = 0; k < size; k++) { for (j = 0; j < size; j++) { if(maze[k][j].checkWall(3)){ g.drawLine((int) (k * wdOfRow), (int) (j * htOfRow), (int) ((k+1) * wdOfRow), (int) (j * htOfRow)); }} } } } class Cell { private final static int NORTH = 0; private final static int EAST = 1; private final static int WEST = 2; private final static int SOUTH = 3; private final static int NO = 4; private final static int START = 1; private final static int END = 2; boolean[] wall = new boolean[4]; boolean[] border = new boolean[4]; boolean[] backtrack = new boolean[4]; boolean[] solution = new boolean[4]; private boolean isVisited = false; private int Key = 0; public Cell(){ for(int i=0;i<4;i++){wall[i] = true;} } public int countWalls(){ int i, k =0; for(i=0; i<4; i++) { if (wall[i] == true) {k++;} } return k;} public boolean checkWall(int x){ switch(x){ case 0: return wall[0]; case 1: return wall[1]; case 2: return wall[2]; case 3: return wall[3]; } return true; } public void destroyWall(int x){ switch(x){ case 0: wall[0] = false; break; case 1: wall[1] = false; break; case 2: wall[2] = false; break; case 3: wall[3] = false; break; } } public void setStart(int i){Key = i;} public int getKey(){return Key;} public boolean checkVisit(){return isVisited;} public void visitCell(){isVisited = true;} }

    Read the article

  • Spring transactions not committing

    - by Clinton Bosch
    I am struggling to get my spring managed transactions to commit, could someone please spot what I have done wrong. All my tables are mysql InnonDB tables. My RemoteServiceServlet (GWT) is as follows: public class TrainTrackServiceImpl extends RemoteServiceServlet implements TrainTrackService { @Autowired private DAO dao; @Override public void init(ServletConfig config) throws ServletException { super.init(config); WebApplicationContext ctx = WebApplicationContextUtils.getRequiredWebApplicationContext(config.getServletContext()); AutowireCapableBeanFactory beanFactory = ctx.getAutowireCapableBeanFactory(); beanFactory.autowireBean(this); } @Transactional(propagation= Propagation.REQUIRED, rollbackFor=Exception.class) public UserDTO createUser(String firstName, String lastName, String idNumber, String cellPhone, String email, int merchantId) { User user = new User(); user.setFirstName(firstName); user.setLastName(lastName); user.setIdNumber(idNumber); user.setCellphone(cellPhone); user.setEmail(email); user.setDateCreated(new Date()); Merchant merchant = (Merchant) dao.find(Merchant.class, merchantId); if (merchant != null) { user.setMerchant(merchant); } // Save the user. dao.saveOrUpdate(user); UserDTO dto = new UserDTO(); dto.id = user.getId(); dto.firstName = user.getFirstName(); dto.lastName = user.getLastName(); return dto; } The DAO is as follows: public class DAO extends HibernateDaoSupport { private String adminUsername; private String adminPassword; private String godUsername; private String godPassword; public String getAdminUsername() { return adminUsername; } public void setAdminUsername(String adminUsername) { this.adminUsername = adminUsername; } public String getAdminPassword() { return adminPassword; } public void setAdminPassword(String adminPassword) { this.adminPassword = adminPassword; } public String getGodUsername() { return godUsername; } public void setGodUsername(String godUsername) { this.godUsername = godUsername; } public String getGodPassword() { return godPassword; } public void setGodPassword(String godPassword) { this.godPassword = godPassword; } public void saveOrUpdate(ModelObject obj) { getHibernateTemplate().saveOrUpdate(obj); } And my applicationContext.xml is as follows: <context:annotation-config/> <context:component-scan base-package="za.co.xxx.traintrack.server"/> <!-- Application properties --> <bean id="propertyConfigurer" class="org.springframework.beans.factory.config.PropertyPlaceholderConfigurer"> <property name="locations"> <list> <value>file:${user.dir}/@propertiesFile@</value> </list> </property> </bean> <bean id="sessionFactory" class="org.springframework.orm.hibernate3.annotation.AnnotationSessionFactoryBean"> <property name="hibernateProperties"> <props> <prop key="hibernate.dialect">${connection.dialect}</prop> <prop key="hibernate.connection.username">${connection.username}</prop> <prop key="hibernate.connection.password">${connection.password}</prop> <prop key="hibernate.connection.url">${connection.url}</prop> <prop key="hibernate.connection.driver_class">${connection.driver.class}</prop> <prop key="hibernate.show_sql">${show.sql}</prop> <prop key="hibernate.hbm2ddl.auto">update</prop> <prop key="hibernate.c3p0.min_size">5</prop> <prop key="hibernate.c3p0.max_size">20</prop> <prop key="hibernate.c3p0.timeout">300</prop> <prop key="hibernate.c3p0.max_statements">50</prop> <prop key="hibernate.c3p0.idle_test_period">60</prop> </props> </property> <property name="annotatedClasses"> <list> <value>za.co.xxx.traintrack.server.model.Answer</value> <value>za.co.xxx.traintrack.server.model.Company</value> <value>za.co.xxx.traintrack.server.model.CompanyRegion</value> <value>za.co.xxx.traintrack.server.model.Merchant</value> <value>za.co.xxx.traintrack.server.model.Module</value> <value>za.co.xxx.traintrack.server.model.Question</value> <value>za.co.xxx.traintrack.server.model.User</value> <value>za.co.xxx.traintrack.server.model.CompletedModule</value> </list> </property> </bean> <bean id="dao" class="za.co.xxx.traintrack.server.DAO"> <property name="sessionFactory" ref="sessionFactory"/> <property name="adminUsername" value="${admin.user.name}"/> <property name="adminPassword" value="${admin.user.password}"/> <property name="godUsername" value="${god.user.name}"/> <property name="godPassword" value="${god.user.password}"/> </bean> <bean id="transactionManager" class="org.springframework.orm.hibernate3.HibernateTransactionManager"> <property name="sessionFactory"> <ref local="sessionFactory"/> </property> </bean> <!-- enable the configuration of transactional behavior based on annotations --> <tx:annotation-driven transaction-manager="transactionManager"/> If I change the sessionFactory property to be autoCommit=true then my object does get persisited. <prop key="hibernate.connection.autocommit">true</prop>

    Read the article

  • During Spring unit test, data written to db but test not seeing the data

    - by richever
    I wrote a test case that extends AbstractTransactionalJUnit4SpringContextTests. The single test case I've written creates an instance of class User and attempts to write it to the database using Hibernate. The test code then uses SimpleJdbcTemplate to execute a simple select count(*) from the user table to determine if the user was persisted to the database or not. The test always fails though. I was suspect because in the Spring controller I wrote, the ability to save an instance of User to the db is successful. So I added the Rollback annotation to the unit test and sure enough, the data is written to the database since I can even see it in the appropriate table -- the transaction isn't rolled back when the test case is finished. Here's my test case: @ContextConfiguration(locations = { "classpath:context-daos.xml", "classpath:context-dataSource.xml", "classpath:context-hibernate.xml"}) public class UserDaoTest extends AbstractTransactionalJUnit4SpringContextTests { @Autowired private UserDao userDao; @Test @Rollback(false) public void teseCreateUser() { try { UserModel user = randomUser(); String username = user.getUserName(); long id = userDao.create(user); String query = "select count(*) from public.usr where usr_name = '%s'"; long count = simpleJdbcTemplate.queryForLong(String.format(query, username)); Assert.assertEquals("User with username should be in the db", 1, count); } catch (Exception e) { e.printStackTrace(); Assert.assertNull("testCreateUser: " + e.getMessage()); } } } I think I was remiss by not adding the configuration files. context-hibernate.xml <?xml version="1.0" encoding="UTF-8"?> <beans xmlns="http://www.springframework.org/schema/beans" xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xsi:schemaLocation=" http://www.springframework.org/schema/beans http://www.springframework.org/schema/beans/spring-beans-3.0.xsd> <bean id="namingStrategy" class="org.springframework.beans.factory.config.FieldRetrievingFactoryBean"> <property name="staticField"> <value>org.hibernate.cfg.ImprovedNamingStrategy.INSTANCE</value> </property> </bean> <bean id="sessionFactory" class="org.springframework.orm.hibernate3.LocalSessionFactoryBean" destroy-method="destroy" scope="singleton"> <property name="namingStrategy"> <ref bean="namingStrategy"/> </property> <property name="dataSource" ref="dataSource"/> <property name="mappingResources"> <list> <value>com/company/model/usr.hbm.xml</value> </list> </property> <property name="hibernateProperties"> <props> <prop key="hibernate.dialect">org.hibernate.dialect.PostgreSQLDialect</prop> <prop key="hibernate.show_sql">true</prop> <prop key="hibernate.use_sql_comments">true</prop> <prop key="hibernate.query.substitutions">yes 'Y', no 'N'</prop> <prop key="hibernate.cache.provider_class">org.hibernate.cache.EhCacheProvider</prop> <prop key="hibernate.cache.use_query_cache">true</prop> <prop key="hibernate.cache.use_minimal_puts">false</prop> <prop key="hibernate.cache.use_second_level_cache">true</prop> <prop key="hibernate.current_session_context_class">thread</prop> </props> </property> </bean> <bean id="transactionManager" class="org.springframework.orm.hibernate3.HibernateTransactionManager"> <property name="sessionFactory" ref="sessionFactory"/> <property name="nestedTransactionAllowed" value="false" /> </bean> <bean id="transactionInterceptor" class="org.springframework.transaction.interceptor.TransactionInterceptor"> <property name="transactionManager"> <ref local="transactionManager"/> </property> <property name="transactionAttributes"> <props> <prop key="create">PROPAGATION_REQUIRED</prop> <prop key="delete">PROPAGATION_REQUIRED</prop> <prop key="update">PROPAGATION_REQUIRED</prop> <prop key="*">PROPAGATION_SUPPORTS,readOnly</prop> </props> </property> </bean> </beans> context-dataSource.xml <?xml version="1.0" encoding="UTF-8"?> <beans xmlns="http://www.springframework.org/schema/beans" xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xsi:schemaLocation=" http://www.springframework.org/schema/beans http://www.springframework.org/schema/beans/spring-beans-3.0.xsd"> <bean id="dataSource" class="com.mchange.v2.c3p0.ComboPooledDataSource" destroy-method="close"> <property name="driverClass" value="org.postgresql.Driver" /> <property name="jdbcUrl" value="jdbc\:postgresql\://localhost:5432/company_dev" /> <property name="user" value="postgres" /> <property name="password" value="postgres" /> </bean> </beans> context-daos.xml <?xml version="1.0" encoding="UTF-8"?> <beans xmlns="http://www.springframework.org/schema/beans" xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xsi:schemaLocation=" http://www.springframework.org/schema/beans http://www.springframework.org/schema/beans/spring-beans-3.0.xsd"> <bean id="extendedFinderNamingStrategy" class="com.company.dao.finder.impl.ExtendedFinderNamingStrategy"/> <bean id="finderIntroductionAdvisor" class="com.company.dao.finder.impl.FinderIntroductionAdvisor"/> <bean id="abstractDaoTarget" class="com.company.dao.impl.GenericDaoHibernateImpl" abstract="true" depends-on="sessionFactory"> <property name="sessionFactory"> <ref bean="sessionFactory"/> </property> <property name="namingStrategy"> <ref bean="extendedFinderNamingStrategy"/> </property> </bean> <bean id="abstractDao" class="org.springframework.aop.framework.ProxyFactoryBean" abstract="true"> <property name="interceptorNames"> <list> <value>transactionInterceptor</value> <value>finderIntroductionAdvisor</value> </list> </property> </bean> <bean id="userDao" parent="abstractDao"> <property name="proxyInterfaces"> <value>com.company.dao.UserDao</value> </property> <property name="target"> <bean parent="abstractDaoTarget"> <constructor-arg> <value>com.company.model.UserModel</value> </constructor-arg> </bean> </property> </bean> </beans> Some of this I've inherited from someone else. I wouldn't have used the proxying that is going on here because I'm not sure it's needed but this is what I'm working with. Any help much appreciated.

    Read the article

  • Why is insertion into my tree faster on sorted input than random input?

    - by Juliet
    Now I've always heard binary search trees are faster to build from randomly selected data than ordered data, simply because ordered data requires explicit rebalancing to keep the tree height at a minimum. Recently I implemented an immutable treap, a special kind of binary search tree which uses randomization to keep itself relatively balanced. In contrast to what I expected, I found I can consistently build a treap about 2x faster and generally better balanced from ordered data than unordered data -- and I have no idea why. Here's my treap implementation: http://pastebin.com/VAfSJRwZ And here's a test program: using System; using System.Collections.Generic; using System.Linq; using System.Diagnostics; namespace ConsoleApplication1 { class Program { static Random rnd = new Random(); const int ITERATION_COUNT = 20; static void Main(string[] args) { List<double> rndTimes = new List<double>(); List<double> orderedTimes = new List<double>(); rndTimes.Add(TimeIt(50, RandomInsert)); rndTimes.Add(TimeIt(100, RandomInsert)); rndTimes.Add(TimeIt(200, RandomInsert)); rndTimes.Add(TimeIt(400, RandomInsert)); rndTimes.Add(TimeIt(800, RandomInsert)); rndTimes.Add(TimeIt(1000, RandomInsert)); rndTimes.Add(TimeIt(2000, RandomInsert)); rndTimes.Add(TimeIt(4000, RandomInsert)); rndTimes.Add(TimeIt(8000, RandomInsert)); rndTimes.Add(TimeIt(16000, RandomInsert)); rndTimes.Add(TimeIt(32000, RandomInsert)); rndTimes.Add(TimeIt(64000, RandomInsert)); rndTimes.Add(TimeIt(128000, RandomInsert)); string rndTimesAsString = string.Join("\n", rndTimes.Select(x => x.ToString()).ToArray()); orderedTimes.Add(TimeIt(50, OrderedInsert)); orderedTimes.Add(TimeIt(100, OrderedInsert)); orderedTimes.Add(TimeIt(200, OrderedInsert)); orderedTimes.Add(TimeIt(400, OrderedInsert)); orderedTimes.Add(TimeIt(800, OrderedInsert)); orderedTimes.Add(TimeIt(1000, OrderedInsert)); orderedTimes.Add(TimeIt(2000, OrderedInsert)); orderedTimes.Add(TimeIt(4000, OrderedInsert)); orderedTimes.Add(TimeIt(8000, OrderedInsert)); orderedTimes.Add(TimeIt(16000, OrderedInsert)); orderedTimes.Add(TimeIt(32000, OrderedInsert)); orderedTimes.Add(TimeIt(64000, OrderedInsert)); orderedTimes.Add(TimeIt(128000, OrderedInsert)); string orderedTimesAsString = string.Join("\n", orderedTimes.Select(x => x.ToString()).ToArray()); Console.WriteLine("Done"); } static double TimeIt(int insertCount, Action<int> f) { Console.WriteLine("TimeIt({0}, {1})", insertCount, f.Method.Name); List<double> times = new List<double>(); for (int i = 0; i < ITERATION_COUNT; i++) { Stopwatch sw = Stopwatch.StartNew(); f(insertCount); sw.Stop(); times.Add(sw.Elapsed.TotalMilliseconds); } return times.Average(); } static void RandomInsert(int insertCount) { Treap<double> tree = new Treap<double>((x, y) => x.CompareTo(y)); for (int i = 0; i < insertCount; i++) { tree = tree.Insert(rnd.NextDouble()); } } static void OrderedInsert(int insertCount) { Treap<double> tree = new Treap<double>((x, y) => x.CompareTo(y)); for(int i = 0; i < insertCount; i++) { tree = tree.Insert(i + rnd.NextDouble()); } } } } And here's a chart comparing random and ordered insertion times in milliseconds: Insertions Random Ordered RandomTime / OrderedTime 50 1.031665 0.261585 3.94 100 0.544345 1.377155 0.4 200 1.268320 0.734570 1.73 400 2.765555 1.639150 1.69 800 6.089700 3.558350 1.71 1000 7.855150 4.704190 1.67 2000 17.852000 12.554065 1.42 4000 40.157340 22.474445 1.79 8000 88.375430 48.364265 1.83 16000 197.524000 109.082200 1.81 32000 459.277050 238.154405 1.93 64000 1055.508875 512.020310 2.06 128000 2481.694230 1107.980425 2.24 I don't see anything in the code which makes ordered input asymptotically faster than unordered input, so I'm at a loss to explain the difference. Why is it so much faster to build a treap from ordered input than random input?

    Read the article

  • Why wont this entire word doc file generate from my php script?

    - by CheeseConQueso
    Here's the php script I'm using on a linux environment: <?php include("../_inc/odbcw.php"); //connect string $cat = $_GET["cat"]; if($_GET["st"]){$crs_query = "select crs_no, title, credits, abstr, prereq, coreq, lab_fee from xxx where active = 'Y' and cat = '".$cat."' and spec_top = 'Y' and prog='UNDG' order by crs_no";} else {$crs_query = "select crs_no, title, credits, abstr, prereq, coreq, lab_fee from xxx where active = 'Y' and cat = '".$cat."' and prog='UNDG' order by crs_no";} $crs_result = @mysql_query($crs_query); header("Content-type: application/vnd.ms-word"); header("Content-Disposition: attachment;Filename=cat.doc"); echo "<html>"; echo "<meta http-equiv=\"Content-Type\" content=\"text/html; charset=Windows-1252\">"; echo "<body>"; echo '<table border=0 width = 700>'; if($_GET["st"]){echo '<tr><td><font face=arial size=2><center>CATALOGUE<br>COURSE DESCRIPTIONS - '.$cat.'<br>SPECIAL TOPICS</center></font></td></tr>';} else {echo '<tr><td><font face=arial size=2><center>CATALOGUE<br>COURSE DESCRIPTIONS - '.$cat.'</center></font></td></tr>';} echo '</table>'; echo '<hr width=700>'; while($row = mysql_fetch_array($crs_result)) { $crs_no = $row['crs_no']; $title = $row['title']; $credits = $row['credits']; $abstr = $row['abstr']; $prereq = $row['prereq']; $coreq = $row['coreq']; $lab_fee = $row['lab_fee']; $rowspan = 2; if($prereq) {$rowspan++;} if($coreq) {$rowspan++;} if($lab_fee=="Y") {$rowspan++;} echo "<table border=0 width = 700>"; echo "<tr>"; echo "<td rowspan=".$rowspan." valign=top width=100><font face=arial size=2>".$crs_no."</font></td>"; echo "<td valign=top><font face=arial size=2><u>".$title."</u></font></td> <td valign=top align=right><font face=arial size=2>".$credits."</font></td>"; echo "</tr>"; echo "<tr>"; echo "<td colspan=2 valign=top align=justify><font face=arial size=2>".$abstr."</font></td>"; echo "</tr>"; if($prereq) { echo "<tr>"; echo "<td colspan=2 valign=top><font face=arial size=2>Prerequisite: ".$prereq."</font></td>"; echo "</tr>"; } if($coreq) { echo "<tr>"; echo "<td colspan=2 valign=top><font face=arial size=2>Coerequisite: ".$coreq."</font></td>"; echo "</tr>"; } if($lab_fee=="Y") { echo "<tr>"; echo "<td colspan=2 valign=top><font face=arial size=2>Lab Fee Required</font></td>"; echo "</tr>"; } echo "</table>"; echo "<br>"; } echo "</body>"; echo "</html>"; ?> Everything works fine before the inclusion of: header("Content-type: application/vnd.ms-word"); header("Content-Disposition: attachment;Filename=cat.doc"); echo "<html>"; echo "<meta http-equiv=\"Content-Type\" content=\"text/html; charset=Windows-1252\">"; echo "<body>"; These lines successfully bring up the dialogue box to open or save cat.doc, but after I open it, the only lines printed are: CATALOGUE COURSE DESCRIPTIONS - and the <HR> beneath this echoed text. It seems to go on lunch break for the while loop echoing section. Any ideas?

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • Java style FOR loop in a clojure interpeter ?

    - by Kevin
    I have a basic interpreter in clojure. Now i need to implement for (initialisation; finish-test; loop-update) { statements } inside my interpreter. I will attach my interpreter code I got so far. Any help is appreciated. Interpreter (declare interpret make-env) ;; (def do-trace false) ;; ;; simple utilities (def third ; return third item in a list (fn [a-list] (second (rest a-list)))) (def fourth ; return fourth item in a list (fn [a-list] (third (rest a-list)))) (def run ; make it easy to test the interpreter (fn [e] (println "Processing: " e) (println "=> " (interpret e (make-env))))) ;; for the environment (def make-env (fn [] '())) (def add-var (fn [env var val] (cons (list var val) env))) (def lookup-var (fn [env var] (cond (empty? env) 'error (= (first (first env)) var) (second (first env)) :else (lookup-var (rest env) var)))) ;; -- define numbers (def is-number? (fn [expn] (number? expn))) (def interpret-number (fn [expn env] expn)) ;; -- define symbols (def is-symbol? (fn [expn] (symbol? expn))) (def interpret-symbol (fn [expn env] (lookup-var env expn))) ;; -- define boolean (def is-boolean? (fn [expn] (or (= expn 'true) (= expn 'false)))) (def interpret-boolean (fn [expn env] expn)) ;; -- define functions (def is-function? (fn [expn] (and (list? expn) (= 3 (count expn)) (= 'lambda (first expn))))) (def interpret-function (fn [expn env] expn)) ;; -- define addition (def is-plus? (fn [expn] (and (list? expn) (= 3 (count expn)) (= '+ (first expn))))) (def interpret-plus (fn [expn env] (+ (interpret (second expn) env) (interpret (third expn) env)))) ;; -- define subtraction (def is-minus? (fn [expn] (and (list? expn) (= 3 (count expn)) (= '- (first expn))))) (def interpret-minus (fn [expn env] (- (interpret (second expn) env) (interpret (third expn) env)))) ;; -- define multiplication (def is-times? (fn [expn] (and (list? expn) (= 3 (count expn)) (= '* (first expn))))) (def interpret-times (fn [expn env] (* (interpret (second expn) env) (interpret (third expn) env)))) ;; -- define division (def is-divides? (fn [expn] (and (list? expn) (= 3 (count expn)) (= '/ (first expn))))) (def interpret-divides (fn [expn env] (/ (interpret (second expn) env) (interpret (third expn) env)))) ;; -- define equals test (def is-equals? (fn [expn] (and (list? expn) (= 3 (count expn)) (= '= (first expn))))) (def interpret-equals (fn [expn env] (= (interpret (second expn) env) (interpret (third expn) env)))) ;; -- define greater-than test (def is-greater-than? (fn [expn] (and (list? expn) (= 3 (count expn)) (= '> (first expn))))) (def interpret-greater-than (fn [expn env] (> (interpret (second expn) env) (interpret (third expn) env)))) ;; -- define not (def is-not? (fn [expn] (and (list? expn) (= 2 (count expn)) (= 'not (first expn))))) (def interpret-not (fn [expn env] (not (interpret (second expn) env)))) ;; -- define or (def is-or? (fn [expn] (and (list? expn) (= 3 (count expn)) (= 'or (first expn))))) (def interpret-or (fn [expn env] (or (interpret (second expn) env) (interpret (third expn) env)))) ;; -- define and (def is-and? (fn [expn] (and (list? expn) (= 3 (count expn)) (= 'and (first expn))))) (def interpret-and (fn [expn env] (and (interpret (second expn) env) (interpret (third expn) env)))) ;; -- define with (def is-with? (fn [expn] (and (list? expn) (= 3 (count expn)) (= 'with (first expn))))) (def interpret-with (fn [expn env] (interpret (third expn) (add-var env (first (second expn)) (interpret (second (second expn)) env))))) ;; -- define if (def is-if? (fn [expn] (and (list? expn) (= 4 (count expn)) (= 'if (first expn))))) (def interpret-if (fn [expn env] (cond (interpret (second expn) env) (interpret (third expn) env) :else (interpret (fourth expn) env)))) ;; -- define function-application (def is-function-application? (fn [expn env] (and (list? expn) (= 2 (count expn)) (is-function? (interpret (first expn) env))))) (def interpret-function-application (fn [expn env] (let [function (interpret (first expn) env)] (interpret (third function) (add-var env (first (second function)) (interpret (second expn) env)))))) ;; the interpreter itself (def interpret (fn [expn env] (cond do-trace (println "Interpret is processing: " expn)) (cond ; basic values (is-number? expn) (interpret-number expn env) (is-symbol? expn) (interpret-symbol expn env) (is-boolean? expn) (interpret-boolean expn env) (is-function? expn) (interpret-function expn env) ; built-in functions (is-plus? expn) (interpret-plus expn env) (is-minus? expn) (interpret-minus expn env) (is-times? expn) (interpret-times expn env) (is-divides? expn) (interpret-divides expn env) (is-equals? expn) (interpret-equals expn env) (is-greater-than? expn) (interpret-greater-than expn env) (is-not? expn) (interpret-not expn env) (is-or? expn) (interpret-or expn env) (is-and? expn) (interpret-and expn env) ; special syntax (is-with? expn) (interpret-with expn env) (is-if? expn) (interpret-if expn env) ; functions (is-function-application? expn env) (interpret-function-application expn env) :else 'error)))

    Read the article

  • I asked this yesterday, after the input given I'm still having trouble implementing..

    - by Josh
    I'm not sure how to fix this or what I did wrong, but whenever I enter in a value it just closes out the run prompt. So, seems I do have a problem somewhere in my coding. Whenever I run the program and input a variable, it always returns the same answer.."The content at location 76 is 0." On that note, someone told me that "I don't know, but I suspect that Program A incorrectly has a fixed address being branched to on instructions 10 and 11." - mctylr but I'm not sure how to fix that.. I'm trying to figure out how to incorporate this idea from R Samuel Klatchko.. I'm still not sure what I'm missing but I can't get it to work.. const int OP_LOAD = 3; const int OP_STORE = 4; const int OP_ADD = 5; ... const int OP_LOCATION_MULTIPLIER = 100; mem[0] = OP_LOAD * OP_LOCATION_MULTIPLIER + ...; mem[1] = OP_ADD * OP_LOCATION_MULTIPLIER + ...; operand = memory[ j ] % OP_LOCATION_MULTIPLIER; operation = memory[ j ] / OP_LOCATION_MULTIPLIER; I'm new to programming, I'm not the best, so I'm going for simplicity. Also this is an SML program. Anyway, this IS a homework assignment and I'm wanting a good grade on this. So I was looking for input and making sure this program will do what I'm hoping they are looking for. Anyway, here are the instructions: Write SML (Simpletron Machine language) programs to accomplish each of the following task: A) Use a sentinel-controlled loop to read positive number s and compute and print their sum. Terminate input when a neg number is entered. B) Use a counter-controlled loop to read seven numbers, some positive and some negative, and compute + print the avg. C) Read a series of numbers, and determine and print the largest number. The first number read indicates how many numbers should be processed. Without further a due, here is my program. All together. int main() { const int READ = 10; const int WRITE = 11; const int LOAD = 20; const int STORE = 21; const int ADD = 30; const int SUBTRACT = 31; const int DIVIDE = 32; const int MULTIPLY = 33; const int BRANCH = 40; const int BRANCHNEG = 41; const int BRANCHZERO = 41; const int HALT = 43; int mem[100] = {0}; //Making it 100, since simpletron contains a 100 word mem. int operation; //taking the rest of these variables straight out of the book seeing as how they were italisized. int operand; int accum = 0; // the special register is starting at 0 int j; // This is for part a, it will take in positive variables in a sent-controlled loop and compute + print their sum. Variables from example in text. memory [0] = 1010; memory [01] = 2009; memory [02] = 3008; memory [03] = 2109; memory [04] = 1109; memory [05] = 4300; memory [06] = 1009; j = 0; //Makes the variable j start at 0. while ( true ) { operand = memory[ j ]%100; // Finds the op codes from the limit on the memory (100) operation = memory[ j ]/100; //using a switch loop to set up the loops for the cases switch ( operation ){ case 10: //reads a variable into a word from loc. Enter in -1 to exit cout <<"\n Input a positive variable: "; cin >> memory[ operand ]; break; case 11: // takes a word from location cout << "\n\nThe content at location " << operand << "is " << memory[operand]; break; case 20:// loads accum = memory[ operand ]; break; case 21: //stores memory[ operand ] = accum; break; case 30: //adds accum += mem[operand]; break; case 31: // subtracts accum-= memory[ operand ]; break; case 32: //divides accum /=(memory[ operand ]); break; case 33: // multiplies accum*= memory [ operand ]; break; case 40: // Branches to location j = -1; break; case 41: //branches if acc. is < 0 if (accum < 0) j = 5; break; case 42: //branches if acc = 0 if (accum == 0) j = 5; break; case 43: // Program ends exit(0); break; } j++; } return 0; }

    Read the article

  • clicking a button via javascript does not cause a post

    - by Andreas Niedermair
    hi there! <!DOCTYPE html PUBLIC "-//W3C//DTD XHTML 1.1//EN" "http://www.w3.org/TR/xhtml11/DTD/xhtml11.dtd"> <html xmlns="http://www.w3.org/1999/xhtml" > <head> <script type="text/javascript" src="http://ajax.googleapis.com/ajax/libs/jquery/1.4.2/jquery.js"></script> <script type="text/javascript" src="http://ajax.googleapis.com/ajax/libs/jqueryui/1.8.2/jquery-ui.js"></script> </head> <body> <form id="fooForm"> <script type="text/javascript"> function FooMethod() { alert('hello'); } var fooButton; var fooForm; $(document).ready(function() { InitializeVariables(); InitiliazeDialog(); InitiliazeForm(); }); function InitializeVariables() { fooButton = $('#fooButton'); fooForm = $('#fooForm'); } function InitiliazeDialog() { var dialog = $('<div/>'); dialog.css('display', 'none'); var content = $('<p/>'); var icon = $('<span/>'); icon.addClass('ui-icon ui-icon-alert'); icon.css('float', 'left'); icon.css('margin', '0px 7px 20px 0px'); content.text('do you really want to hurt me?'); icon.prependTo(content); content.appendTo(dialog); var dialogOpenMethod = function () { dialog.dialog('open'); return false; }; var dialogOpenHandlerMethod = function (event, ui) { var widget = dialog.dialog('widget'); widget.appendTo(fooForm); var overlay = widget.prev(); overlay.css('z-index', 999); overlay.appendTo(fooForm); widget.css('position', 'fixed'); widget.css('top', '50%'); widget.css('margin-top', widget.height() / 2 * -1); widget.css('left', '50%'); widget.css('margin-left', widget.width() / 2 * -1); }; var submitMethod = function () { dialog.dialog('option', 'closeOnEscape', false); var widget = dialog.dialog('widget'); var yesButton = $(':button:eq(0)', widget); var noButton = $(':button:eq(1)', widget); var closeButton = $('a.ui-dialog-titlebar-close', widget); noButton.remove(); closeButton.remove(); fooButton.unbind('click', dialogOpenMethod); fooButton.click(); }; dialog.dialog({ autoOpen: false, modal: true, buttons: { 'Ja': submitMethod, 'Nein': function () { dialog.dialog('close'); } }, open: dialogOpenHandlerMethod }); fooButton.bind('click', dialogOpenMethod); } function InitiliazeForm() { fooButton.button(); fooForm.submit(function () { alert('doing a submit'); }); } </script> <input type="submit" id="fooButton" value="submit it!" onclick="FooMethod();"></input> </form> </body> </html> what am i doing? i want a modal-confirmation: user clicks on button, confirmation "do you really want to...?", user clicks "yes", this click unbinds the original click-handler and clicks the button again (which should cause a submit). what/why is not working? indeed you need a special case. this demo won't work, unless you set modal: false. interesting to mention: the original handler (onclick="FooMethod();") is called in modal and non-modal dialog. can anybody help me out? thanks in advance! i also opened a ticket on jqueryUI for this

    Read the article

  • Where should I put zoomIn in my MapActivity?

    - by Johny
    I'm writing an Android app, and I'd like to zoomIn as soon as the map has been loaded. I get the following error: java.lang.IllegalArgumentException: width and height must be > 0 This MapActivity - width and height must be > 0 question suggests the problem is the zoomIn() method is in the onCreate() method. But I get same error when I put it in the onResume() method. I've been searching for hours and I can't find anything about it at http://developer.android.com or anywhere else... Also I can't find a way to get the time point the map has been loaded. A "MapLoadedListener" or something like that... EDIT Here is my code: public class AMap extends MapActivity{ private final String LOG_TAG = this.getClass().getSimpleName(); private Context mContext; private Chronometer timer; private TextView tvCountdown; private RelativeLayout rl; private MapView mapView; private MapController mapController; private List<Overlay> mapOverlays; private PlayersOverlay playersOverlay; private Drawable drawable; private Builder endDialog; private ContextThemeWrapper ctw; private Handler mHandler = new Handler(); private Player player = new Player(); private StartTask startTask; private EndTask endTask; private MyDBAdapter mdba; private Cursor playersCursor; private UpdateBroadcastReceiver r; @Override public void onCreate(Bundle savedInstanceState) { super.onCreate(savedInstanceState); setContentView(R.layout.map_view); mContext = AMap.this; // set map mapView = (MapView) findViewById(R.id.mapview); mapView.setBuiltInZoomControls(true); mapView.setFocusable(true); // find the relative layout rl = (RelativeLayout) findViewById(R.id.rl); // set the chronometer timer = (Chronometer) findViewById(R.id.tv_timer); timer.setBackgroundColor(Color.DKGRAY); // set the countdown textview tvCountdown = (TextView) findViewById(R.id.tv_countdown); // Open DB connection and get players Cursor mdba = new MyDBAdapter(mContext); mdba.open(); playersCursor = mdba.getGame(); // Get this player's id and location Intent starter = this.getIntent(); player.setId(starter.getIntExtra("id", 0)); player.setLatitude(starter.getDoubleExtra("lat", 0)); player.setLongitude(starter.getDoubleExtra("lon", 0)); // Set this player's location as map's center GeoPoint geoPoint = new GeoPoint((int) (player.getLatitude()*1E6), (int) (player.getLongitude()*1E6)); mapController = mapView.getController(); mapController.setCenter(geoPoint); mapController.setZoom(15); Log.d(LOG_TAG, "My playersCursor has "+playersCursor.getCount()+" rows"); // drawable is needed but not used drawable = this.getResources().getDrawable(R.drawable.ic_launcher); // set PlayersOverlay (locations and statuses) playersOverlay = new PlayersOverlay(player.getId(), playersCursor, drawable, this); mapOverlays = mapView.getOverlays(); mapOverlays.add(playersOverlay); mHandler.postDelayed(mUpdateTimeTask, 100); } private Runnable mUpdateTimeTask = new Runnable() { public void run() { int h = mapView.getLayoutParams().height; int w = mapView.getLayoutParams().width; Log.d(LOG_TAG, "w = "+w+" , h = "+h); mHandler.postAtTime(this, System.currentTimeMillis() + 1000); } }; @Override public void onAttachedToWindow(){ Log.d(LOG_TAG, "Attached to Window"); int h = mapView.getLayoutParams().height; int w = mapView.getLayoutParams().width; Log.d(LOG_TAG, " Attached to window: w = "+w+" , h = "+h); //mapController.zoomInFixing(screenPoint.x, screenPoint.y); } public void onWindowFocusChanged(boolean hasFocus){ Log.d(LOG_TAG, "Focus changed to: "+hasFocus); int h = mapView.getLayoutParams().height; int w = mapView.getLayoutParams().width; Log.d(LOG_TAG, " Window focus changed: w = "+w+" , h = "+h); //mapController.zoomInFixing(screenPoint.x, screenPoint.y); } @Override protected void onStart(){ super.onStart(); // Create and register the broadcast receiver for messages from service IntentFilter filter = new IntentFilter(AppConstants.iGAME_UPDATE); r = new UpdateBroadcastReceiver(); registerReceiver(r, filter); // Create the dialog for end of game ctw = new ContextThemeWrapper(mContext, android.R.style.Theme_Translucent_NoTitleBar_Fullscreen); endDialog = new AlertDialog.Builder(ctw); endDialog.setMessage("End of Game"); endDialog.setCancelable(false); endDialog.setNeutralButton("OK", new OnClickListener(){ @Override public void onClick(DialogInterface dialog, int which) { Intent highScores = new Intent(AMap.this, HighScores.class); startActivity(highScores); playersCursor.close(); finish(); } }); } @Override protected void onStop() { if(!playersCursor.isClosed()) playersCursor.close(); unregisterReceiver(r); mdba.close(); super.onStop(); } @Override protected boolean isRouteDisplayed() { return false; } // Receives signal from NetworkService that DB has been updated public class UpdateBroadcastReceiver extends BroadcastReceiver { boolean startSignal, update, endSignal; @Override public void onReceive(Context context, Intent intent) { endSignal = intent.getBooleanExtra("endSignal", false); if(endSignal){ Log.d(LOG_TAG, "Game Update BroadcastReceiver received End Signal"); endTask = new EndTask(); endTask.execute(); return; } update = intent.getBooleanExtra("update", false); if(update){ Log.d(LOG_TAG, "Game Update BroadcastReceiver received game update"); playersCursor.requery(); mapView.invalidate(); return; } startSignal = intent.getBooleanExtra("startSignal", false); if(startSignal){ Log.d(LOG_TAG, "Game Update BroadcastReceiver received Start Signal"); startTask = new StartTask(); startTask.execute(); return; } } } class StartTask extends AsyncTask<Void,Integer,Void>{ private final ToneGenerator tg = new ToneGenerator(AudioManager.STREAM_NOTIFICATION, 100); private final long DELAY = 1200; @Override protected Void doInBackground(Void... params) { int i = 3; while(i>=0){ publishProgress(i); try { Thread.sleep(DELAY); } catch (InterruptedException e) { e.printStackTrace(); } i--; } return null; } @Override protected void onProgressUpdate(Integer... progress){ tg.startTone(ToneGenerator.TONE_PROP_PROMPT); tvCountdown.setText(""+progress[0]); } @Override protected void onPostExecute(Void result) { rl.removeView(tvCountdown); timer.setBase(SystemClock.elapsedRealtime()); timer.start(); //enable screen touches playersOverlay.setGameStarted(true); } } class EndTask extends AsyncTask<Void,Void,Void>{ @Override protected void onPreExecute(){ //disable screen touches playersOverlay.setEndOfGame(true); timer.stop(); } @Override protected Void doInBackground(Void... params) { return null; } @Override protected void onPostExecute(Void result) { try{ endDialog.show(); }catch(Exception e){ Toast.makeText(mContext, "End of game", Toast.LENGTH_LONG); Intent highScores = new Intent(AMap.this, HighScores.class); startActivity(highScores); playersCursor.close(); finish(); } mHandler.removeCallbacks(mUpdateTimeTask); } } }

    Read the article

  • spring annotation configuration issue

    - by shrimpy
    I don't know why spring 2.5.6 keeps complaining, but I don't have any "orderBy" annotation. 2009-10-10 13:55:37.242::WARN: Nested in org.springframework.beans.factory.BeanCreationException: Error creating bean with name 'org.springframework.context.annotation.internalPersiste nceAnnotationProcessor': Error setting property values; nested exception is org.springframework.beans.NotWritablePropertyException: Invalid property 'order' of bean class [org.springfra mework.orm.jpa.support.PersistenceAnnotationBeanPostProcessor]: Bean property 'order' is not writable or has an invalid setter method. Does the parameter type of the setter match the re turn type of the getter?: org.springframework.beans.NotWritablePropertyException: Invalid property 'order' of bean class [org.springframework.orm.jpa.support.PersistenceAnnotationBeanPostProcessor]: Bean propert y 'order' is not writable or has an invalid setter method. Does the parameter type of the setter match the return type of the getter? at org.springframework.beans.BeanWrapperImpl.setPropertyValue(BeanWrapperImpl.java:801) at org.springframework.beans.BeanWrapperImpl.setPropertyValue(BeanWrapperImpl.java:651) at org.springframework.beans.AbstractPropertyAccessor.setPropertyValues(AbstractPropertyAccessor.java:78) at org.springframework.beans.AbstractPropertyAccessor.setPropertyValues(AbstractPropertyAccessor.java:59) at org.springframework.beans.factory.support.AbstractAutowireCapableBeanFactory.applyPropertyValues(AbstractAutowireCapableBeanFactory.java:1276) at org.springframework.beans.factory.support.AbstractAutowireCapableBeanFactory.populateBean(AbstractAutowireCapableBeanFactory.java:1010) or even when I swap to use lower version spring 2.5.1, it's still complaining: 2009-10-10 13:57:56.062::WARN: failed ContextHandlerCollection@5da0b94d java.lang.NoClassDefFoundError: org/springframework/context/support/AbstractRefreshableConfigApplicationContext at java.lang.ClassLoader.defineClass1(Native Method) at java.lang.ClassLoader.defineClass(ClassLoader.java:621) at java.security.SecureClassLoader.defineClass(SecureClassLoader.java:124) at java.net.URLClassLoader.defineClass(URLClassLoader.java:260) at java.net.URLClassLoader.access$000(URLClassLoader.java:56) at java.net.URLClassLoader$1.run(URLClassLoader.java:195) at java.security.AccessController.doPrivileged(Native Method) at java.net.URLClassLoader.findClass(URLClassLoader.java:188) at org.mortbay.jetty.webapp.WebAppClassLoader.loadClass(WebAppClassLoader.java:366) at org.mortbay.jetty.webapp.WebAppClassLoader.loadClass(WebAppClassLoader.java:337) at java.lang.ClassLoader.loadClassInternal(ClassLoader.java:320) at java.lang.ClassLoader.defineClass1(Native Method) at java.lang.ClassLoader.defineClass(ClassLoader.java:621) at java.security.SecureClassLoader.defineClass(SecureClassLoader.java:124) at java.net.URLClassLoader.defineClass(URLClassLoader.java:260) at java.net.URLClassLoader.access$000(URLClassLoader.java:56) at java.net.URLClassLoader$1.run(URLClassLoader.java:195) at java.security.AccessController.doPrivileged(Native Method) at java.net.URLClassLoader.findClass(URLClassLoader.java:188) at org.mortbay.jetty.webapp.WebAppClassLoader.loadClass(WebAppClassLoader.java:366) at org.mortbay.jetty.webapp.WebAppClassLoader.loadClass(WebAppClassLoader.java:337) at org.springframework.util.ClassUtils.forName(ClassUtils.java:230) at org.springframework.util.ClassUtils.forName(ClassUtils.java:183) at org.springframework.web.context.ContextLoader.determineContextClass(ContextLoader.java:283) at org.springframework.web.context.ContextLoader.createWebApplicationContext(ContextLoader.java:243) If I do not use annotation, it works fine. No problem at all, Everything happened after this <beans xmlns="http://www.springframework.org/schema/beans" xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xmlns:context="http://www.springframework.org/schema/context" xsi:schemaLocation="http://www.springframework.org/schema/beans http://www.springframework.org/schema/beans/spring-beans-2.5.xsd http://www.springframework.org/schema/context http://www.springframework.org/schema/context/spring-context-2.5.xsd" default-autowire="byName"> <context:component-scan base-package="demo.dao"> <context:include-filter type="annotation" expression="org.springframework.stereotype.Repository"/> </context:component-scan> </beans> and I am sure my spring is configured properly. <?xml version="1.0" encoding="UTF-8"?> <beans xmlns="http://www.springframework.org/schema/beans" xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xmlns:aop="http://www.springframework.org/schema/aop" xmlns:util="http://www.springframework.org/schema/util" xmlns:context="http://www.springframework.org/schema/context" xmlns:tx="http://www.springframework.org/schema/tx" xsi:schemaLocation="http://www.springframework.org/schema/beans http://www.springframework.org/schema/beans/spring-beans-2.5.xsd http://www.springframework.org/schema/aop http://www.springframework.org/schema/aop/spring-aop-2.5.xsd http://www.springframework.org/schema/util http://www.springframework.org/schema/util/spring-util-2.5.xsd http://www.springframework.org/schema/context http://www.springframework.org/schema/context/spring-context-2.5.xsd http://www.springframework.org/schema/tx http://www.springframework.org/schema/tx/spring-tx-2.5.xsd" default-autowire="byName"> <!-- For mail settings and future properties files --> <bean id="propertyConfigurer" class="org.springframework.beans.factory.config.PropertyPlaceholderConfigurer"> <property name="locations"> <list> <value>classpath:jdbc.properties</value> </list> </property> </bean> <!-- Check all the beans managed by Spring for persistence-related annotations. e.g. PersistenceContext --> <bean class="org.springframework.orm.jpa.support.PersistenceAnnotationBeanPostProcessor" /> <bean id="dataSource" class="org.springframework.jdbc.datasource.DriverManagerDataSource"> <property name="driverClassName" value="${jdbc.driverClassName}"/> <property name="url" value="${jdbc.url}"/> <property name="username" value="${jdbc.username}"/> <property name="password" value="${jdbc.password}"/> </bean> <bean id="entityManagerFactory" class="org.springframework.orm.jpa.LocalContainerEntityManagerFactoryBean"> <property name="dataSource" ref="dataSource"/> <!-- jpaVendorAdapter Hibernate, injected into emf --> <property name="jpaVendorAdapter"> <bean class="org.springframework.orm.jpa.vendor.HibernateJpaVendorAdapter"> <property name="showSql" value="${hibernate.show_sql}"/> <!-- Data Definition Language script is generated and executed for each run --> <property name="generateDdl" value="${jdbc.generateDdl}"/> </bean> </property> <!--<property name="hibernateProperties"> --> <property name="jpaProperties"> <props> <prop key="hibernate.dialect">${hibernate.dialect} </prop> <prop key="hibernate.show_sql">${hibernate.show_sql}</prop> <prop key="hibernate.hbm2ddl.auto">${hibernate.hbm2ddl.auto} </prop> </props> </property> </bean> <tx:annotation-driven transaction-manager="transactionManager" /> <bean id="transactionManager" class="org.springframework.orm.jpa.JpaTransactionManager"> <property name="entityManagerFactory" ref="entityManagerFactory"/> <property name="dataSource" ref="dataSource"/> </bean> </beans> Can anyone tell me what is wrong? How can I fix this?

    Read the article

  • Multiple (variant) arguments overloading in Java: What's the purpose?

    - by fortran
    Browsing google's guava collect library code, I've found the following: // Casting to any type is safe because the list will never hold any elements. @SuppressWarnings("unchecked") public static <E> ImmutableList<E> of() { return (ImmutableList<E>) EmptyImmutableList.INSTANCE; } public static <E> ImmutableList<E> of(E element) { return new SingletonImmutableList<E>(element); } public static <E> ImmutableList<E> of(E e1, E e2) { return new RegularImmutableList<E>( ImmutableList.<E>nullCheckedList(e1, e2)); } public static <E> ImmutableList<E> of(E e1, E e2, E e3) { return new RegularImmutableList<E>( ImmutableList.<E>nullCheckedList(e1, e2, e3)); } public static <E> ImmutableList<E> of(E e1, E e2, E e3, E e4) { return new RegularImmutableList<E>( ImmutableList.<E>nullCheckedList(e1, e2, e3, e4)); } public static <E> ImmutableList<E> of(E e1, E e2, E e3, E e4, E e5) { return new RegularImmutableList<E>( ImmutableList.<E>nullCheckedList(e1, e2, e3, e4, e5)); } public static <E> ImmutableList<E> of(E e1, E e2, E e3, E e4, E e5, E e6) { return new RegularImmutableList<E>( ImmutableList.<E>nullCheckedList(e1, e2, e3, e4, e5, e6)); } public static <E> ImmutableList<E> of( E e1, E e2, E e3, E e4, E e5, E e6, E e7) { return new RegularImmutableList<E>( ImmutableList.<E>nullCheckedList(e1, e2, e3, e4, e5, e6, e7)); } public static <E> ImmutableList<E> of( E e1, E e2, E e3, E e4, E e5, E e6, E e7, E e8) { return new RegularImmutableList<E>( ImmutableList.<E>nullCheckedList(e1, e2, e3, e4, e5, e6, e7, e8)); } public static <E> ImmutableList<E> of( E e1, E e2, E e3, E e4, E e5, E e6, E e7, E e8, E e9) { return new RegularImmutableList<E>( ImmutableList.<E>nullCheckedList(e1, e2, e3, e4, e5, e6, e7, e8, e9)); } public static <E> ImmutableList<E> of( E e1, E e2, E e3, E e4, E e5, E e6, E e7, E e8, E e9, E e10) { return new RegularImmutableList<E>(ImmutableList.<E>nullCheckedList( e1, e2, e3, e4, e5, e6, e7, e8, e9, e10)); } public static <E> ImmutableList<E> of( E e1, E e2, E e3, E e4, E e5, E e6, E e7, E e8, E e9, E e10, E e11) { return new RegularImmutableList<E>(ImmutableList.<E>nullCheckedList( e1, e2, e3, e4, e5, e6, e7, e8, e9, e10, e11)); } public static <E> ImmutableList<E> of( E e1, E e2, E e3, E e4, E e5, E e6, E e7, E e8, E e9, E e10, E e11, E e12, E... others) { final int paramCount = 12; Object[] array = new Object[paramCount + others.length]; arrayCopy(array, 0, e1, e2, e3, e4, e5, e6, e7, e8, e9, e10, e11, e12); arrayCopy(array, paramCount, others); return new RegularImmutableList<E>(ImmutableList.<E>nullCheckedList(array)); } And although it seems reasonable to have overloads for empty and single arguments (as they are going to use special instances), I cannot see the reason behind having all the others, when just the last one (with two fixed arguments plus the variable argument instead the dozen) seems to be enough. As I'm writing, one explanation that pops into my head is that the API pre-dates Java 1.5; and although the signatures would be source-level compatible, the binary interface would differ. Isn't it?

    Read the article

< Previous Page | 263 264 265 266 267 268 269 270 271  | Next Page >