Search Results

Search found 3684 results on 148 pages for 'sequence logo'.

Page 27/148 | < Previous Page | 23 24 25 26 27 28 29 30 31 32 33 34  | Next Page >

  • Find three numbers appeared only once

    - by shilk
    In a sequence of length n, where n=2k+3, that is there are k unique numbers appeared twice and three numbers appeared only once. The question is: how to find the three unique numbers that appeared only once? for example, in sequence 1 1 2 6 3 6 5 7 7 the three unique numbers are 2 3 5. Note: 3<=n<1e6 and the number will range from 1 to 2e9 Memory limits: 1000KB , this implies that we can't store the whole sequence. Method I have tried(Memory limit exceed): I initialize a tree, and when read in one number I try to remove it from the tree, if the remove returns false(not found), I add it to the tree. Finally, the tree has the three numbers. It works, but is Memory limit exceed. I know how to find one or two such number(s) using bit manipulation. So I wonder if we can find three using the same method(or some method similar)? Method to find one/two number(s) appeared only once: If there is one number appeared only once, we can apply XOR to the sequence to find it. If there are two, we can first apply XOR to the sequence, then separate the sequence into 2 parts by one bit of the result that is 1, and again apply XOR to the 2 parts, and we will find the answer.

    Read the article

  • conversion of DNA to Protein - c structure issue

    - by sam
    I am working on conversion of DNA sequence to Protein sequence. I had completed all program only one error I found there is of structure. dna_codon is a structure and I am iterating over it.In first iteration it shows proper values of structure but from next iteration, it dont show the proper value stored in structure. Its a small error so do not think that I havnt done anything and downvote. I am stucked here because I am new in c for structures. CODE : #include <stdio.h> #include<string.h> void main() { int i, len; char short_codons[20]; char short_slc[1000]; char sequence[1000]; struct codons { char amino_acid[20], slc[20], dna_codon[40]; }; struct codons c1 [20]= { {"Isoleucine", "I", "ATT, ATC, ATA"}, {"Leucine", "L", "CTT, CTC, CTA, CTG, TTA, TTG"}, {"Valine", "V", "GTT, GTC, GTA, GTG"}, {"Phenylalanine", "F", "TTT, TTC"}, {"Methionine", "M", "ATG"}, {"Cysteine", "C", "TGT, TGC"}, {"Alanine", "A", "GCT, GCC, GCA, GCG"}, {"Proline", "P", "CCT, CCC, CCA,CCG "}, {"Threonine", "T", "ACT, ACC, ACA, ACG"}, {"Serine", "S", "TCT, TCC, TCA, TCG, AGT, AGC"}, {"Tyrosine", "Y", "TAT, TAC"}, {"Tryptophan", "W", "TGG"}, {"Glutamine", "Q", "CAA, CAG"}, {"Aspargine","N" "AAT, AAC"}, {"Histidine", "H", "CAT, CAC"}, {"Glutamic acid", "E", "GAA, GAG"}, {"Aspartic acid", "D", "GAT, GAC"}, {"Lysine", "K", "AAA, AAG"}, {"Arginine", "R", "CGT, CGC, CGA, CGG, AGA, AGG"}, {"Stop codons", "Stop", "AA, TAG, TGA"} }; int count = 0; printf("Enter the sequence: "); gets(sequence); char *input_string = sequence; char *tmp_str = input_string; int k; char *pch; while (*input_string != '\0') { char string_3l[4] = {'\0'}; strncpy(string_3l, input_string, 3); printf("\n-----------%s & %s----------", string_3l, tmp_str ); for(k=0;k<20;k++) { //printf("@REAL - %s", c1[0].dna_codon); printf("@ %s", c1[k].dna_codon); int x; x = c1[k].dna_codon; pch = strtok(x, ","); while (pch != NULL) { printf("\n%d : %s with %s", k, string_3l, pch); count=strcmp(string_3l, pch); if(count==0) { strcat(short_slc, c1[k].slc); printf("\n==>%s", short_slc); } pch = strtok (NULL, " ,.-"); } } input_string = input_string+3; } printf("\nProtien sequence is : %s\n", short_slc); } INPUT : TAGTAG OUTPUT : If you see output of printf("\n-----------%s & %s----------", string_3l, tmp_str ); in both iterations, we found that values defined in structure are reduced. I want to know why structure reduces it or its my mistake? because I am stucked here

    Read the article

  • MySQL server has gone away

    - by user491992
    Hello Friends, I executed this query on my MySql Server and it is giving me "MySQL server has gone away" Error.In following query my both table have more then 1000000 rows. SELECT a_tab_11_10.url as url,a_tab_11_10.c5 as 't1',a_tab_12_10.c3 as 't2' FROM a_tab_11_10 join a_tab_12_10 on (a_tab_11_10.url)=(a_tab_12_10.url) order by (a_tab_11_10.c5-a_tab_12_10.c3) desc limit 10 here is my log file but i am not getting it. Thank you @Faisal for answer and i check my log file but i am not getting it.. 110111 10:19:50 [Note] Plugin 'FEDERATED' is disabled. 110111 10:19:51 InnoDB: Started; log sequence number 0 945537221 110111 10:19:51 [Note] Event Scheduler: Loaded 0 events 110111 10:19:51 [Note] wampmysqld: ready for connections. Version: '5.1.36-community-log' socket: '' port: 3306 MySQL Community Server (GPL) 110111 12:35:42 [Note] wampmysqld: Normal shutdown 110111 12:35:43 [Note] Event Scheduler: Purging the queue. 0 events 110111 12:35:43 InnoDB: Starting shutdown... 110111 12:35:45 InnoDB: Shutdown completed; log sequence number 0 945538624 110111 12:35:45 [Warning] Forcing shutdown of 1 plugins 110111 12:35:45 [Note] wampmysqld: Shutdown complete 110111 12:36:39 [Note] Plugin 'FEDERATED' is disabled. 110111 12:36:40 InnoDB: Started; log sequence number 0 945538624 110111 12:36:40 [Note] Event Scheduler: Loaded 0 events 110111 12:36:40 [Note] wampmysqld: ready for connections. Version: '5.1.36-community-log' socket: '' port: 3306 MySQL Community Server (GPL) 110111 12:36:40 [Note] wampmysqld: Normal shutdown 110111 12:36:40 [Note] Event Scheduler: Purging the queue. 0 events 110111 12:36:40 InnoDB: Starting shutdown... 110111 12:36:42 InnoDB: Shutdown completed; log sequence number 0 945538634 110111 12:36:42 [Warning] Forcing shutdown of 1 plugins 110111 12:36:42 [Note] wampmysqld: Shutdown complete 110111 12:36:52 [Note] Plugin 'FEDERATED' is disabled. 110111 12:36:52 InnoDB: Started; log sequence number 0 945538634 110111 12:36:52 [Note] Event Scheduler: Loaded 0 events 110111 12:36:52 [Note] wampmysqld: ready for connections. Version: '5.1.36-community-log' socket: '' port: 3306 MySQL Community Server (GPL) 110111 12:37:42 [Note] wampmysqld: Normal shutdown 110111 12:37:42 [Note] Event Scheduler: Purging the queue. 0 events 110111 12:37:42 InnoDB: Starting shutdown... 110111 12:37:43 InnoDB: Shutdown completed; log sequence number 0 945538634 110111 12:37:43 [Warning] Forcing shutdown of 1 plugins 110111 12:37:43 [Note] wampmysqld: Shutdown complete 110111 12:37:46 [Note] Plugin 'FEDERATED' is disabled. 110111 12:37:46 InnoDB: Started; log sequence number 0 945538634 110111 12:37:46 [Note] Event Scheduler: Loaded 0 events 110111 12:37:46 [Note] wampmysqld: ready for connections. Version: '5.1.36-community-log' socket: '' port: 3306 MySQL Community Server (GPL)

    Read the article

  • Oracle physical standby database received redo has not been applied

    - by Arthur Aoife
    Hi, I followed the steps in oracle documentation on creation of a physical standby database. The link to the configuration steps, http://download.oracle.com/docs/cd/B28359_01/server.111/b28294/create_ps.htm#i63561 When I perform "Step 4 Verfiy that received redo has been applied." my query result is not as expected, following is the result, SQL SELECT SEQUENCE#,APPLIED FROM V$ARCHIVED_LOG ORDER BY SEQUENCE#; SEQUENCE# APP 5 NO 6 NO 7 NO 8 NO 4 rows selected. Appreciate any advice on how to proceed, thanks.

    Read the article

  • What is the method to reset the Planar 1910m monitor?

    - by Richard J Foster
    My monitor (a Planar, apparently model number PL1910M) is not working. (It is flashing a green / orange sequence which I believe to be an error code. The sequence, in case it helps consists of orange and green three times quickly followed by a longer orange, then another green followed by a long period where both colors appear to be present). I vaguely recall a co-worker suffering from a similar problem, and our IT department "resetting" the monitor by holding down a certain set of keys as they apply power. Unfortunately, I do not remember what that key sequence was, our IT department is not responding, and the Planar web site is blocked by the content filtering firewall we have in place! What is the sequence to perform the reset? (For bonus geek-credit, what does the code mean... as if it indicates a blown component clearly a reset will not help me. ;-))

    Read the article

  • What steps to take when CPAN installation fails?

    - by pythonic metaphor
    I have used CPAN to install perl modules on quite a few occasions, but I've been lucky enough to just have it work. Unfortunately, I was trying to install Thread::Pool today and one of the required dependencies, Thread::Converyor::Monitored failed the test: Test Summary Report ------------------- t/Conveyor-Monitored02.t (Wstat: 65280 Tests: 89 Failed: 0) Non-zero exit status: 255 Parse errors: Tests out of sequence. Found (2) but expected (4) Tests out of sequence. Found (4) but expected (5) Tests out of sequence. Found (5) but expected (6) Tests out of sequence. Found (3) but expected (7) Tests out of sequence. Found (6) but expected (8) Displayed the first 5 of 86 TAP syntax errors. Re-run prove with the -p option to see them all. Files=3, Tests=258, 6 wallclock secs ( 0.07 usr 0.03 sys + 4.04 cusr 1.25 csys = 5.39 CPU) Result: FAIL Failed 1/3 test programs. 0/258 subtests failed. make: *** [test_dynamic] Error 255 ELIZABETH/Thread-Conveyor-Monitored-0.12.tar.gz /usr/bin/make test -- NOT OK //hint// to see the cpan-testers results for installing this module, try: reports ELIZABETH/Thread-Conveyor-Monitored-0.12.tar.gz Running make install make test had returned bad status, won't install without force Failed during this command: ELIZABETH/Thread-Conveyor-Monitored-0.12.tar.gz: make_test NO What steps do you take to start seeing why an installation failed? I'm not even sure how to begin tracking down what's wrong.

    Read the article

  • Shuffling in windows media player

    - by Crazy Buddy
    I think media player has several issues indeed. You see, I'll be hearing songs most of the time using WMP 11 (in WinXP SP3). Today - While I was wasting my time poking some sleepy questions in SE, I also noticed this... My "Now-playing" list contains some 500 mp3s (doesn't matter). I've enabled both Shuffle and Repeat. I play those songs. When I get irritated with some song (say - the 10th song), I change it. Something mysterious happened (happens even now). A sequence of atleast 3 songs (already played before the 10th song) repeat again in the same way following the selected one... Then, I skip those somehow and arrive at another boring song (say now - 20th) and now, the sequence would've increased by about 5 songs (sometimes)... Sometimes, I even notice a specific "sequence of songs" (including the skipped one) repeating again & again. I doubt most guys would've noticed. This makes me ask a question - Why? There are a lot songs in my playlist. Why the same sets of songs? Does WMP really chooses a sequence at start and follows it. Once a change is encountered, it starts the sequence again after several songs. Is it so? Feel free to shoot it down. I don't know whether it's acceptable here. Just curious about it... Note: This is only observed when both shuffle and repeat are enabled. To confirm, I tried it in two other PCs of mine (thereby dumped 2 hours). BTW, I also didn't observe this magic in VLC, Winamp, K-Lite and not even my Nokia cellphone. I think I'm not a good Googler and so, I can't find any such issues :-)

    Read the article

  • What is the method to reset the Planar 1910m monitor?

    - by Richard J Foster
    My monitor (a Planar, apparently model number PL1910M) is not working. (It is flashing a green / orange sequence which I believe to be an error code. The sequence, in case it helps consists of orange and green three times quickly followed by a longer orange, then another green followed by a long period where both colors appear to be present). I vaguely recall a co-worker suffering from a similar problem, and our IT department "resetting" the monitor by holding down a certain set of keys as they apply power. Unfortunately, I do not remember what that key sequence was, our IT department is not responding, and the Planar web site is blocked by the content filtering firewall we have in place! What is the sequence to perform the reset? (For bonus geek-credit, what does the code mean... as if it indicates a blown component clearly a reset will not help me. ;-))

    Read the article

  • Use external display from boot on Samsung laptop

    - by OhMrBigshot
    I have a Samsung RV511 laptop, and recently my screen broke. I connected an external screen and it works fine, but only after Windows starts. I want to be able to use the external screen right from boot, in order to set the BIOS to boot from DVD, and to then install a different OS and also format the hard drive. Right now I can only use the screen when Windows loads. What I've tried: I've tried opening up the laptop and disconnecting the display to make it only find the external and use the VGA as default -- didn't work. I've tried using the Fn+key combo in BIOS to connect external display - nothing I've been looking around for ways to change boot sequence without entering BIOS, but it doesn't look like it's possible. Possible solutions? A way to change boot sequence without entering BIOS? Someone with the same brand/similar model to help me blindly keystroke the correct arrows/F5/F6 buttons while in BIOS mode to change boot sequence? A way to force the external display to work from boot, through modifying the internal connections (I have no problem taking the laptop apart if needed, please no soldering though), through BIOS or program? Also, if I change boot sequence without accessing external screen, would the Ubuntu 12.1 installation sequence attempt to use the external screen or would I only be able to use it after Linux is installed and running? I'd really appreciate help, I can't afford to fix the screen for a few months from now, and I'd really like to make my computer come back to decent performance! Thanks in advance!

    Read the article

  • Convert text to table

    - by Quattro
    I would like convert text into a table. Here is a link to the text http://www.tcdb.org/public/tcdb Short example: >gnl|TC-DB|A0CIB0|1.A.17.3.1 Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1 MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI >gnl|TC-DB|A0CS82|9.B.82.1.5 Chromosome undetermined scaffold_26, whole genome shotgun sequence - Paramecium tetraurelia. MIIEEQIEEKMIYKAIHRVKVNYQKKIDRYILYKKSRWFFNLLLMLLYAYRIQNIGGFYI VTYIYCVYQLQLLIDYFTPLGLPPVNLEDEEEDDDQFQNDFSELPTTLSNKNELNDKEFR PLLRTTSEFKVWQKSVFSVIFAYFCTYIPIWDIPVYWPFLFCYFFVIVGMSIRKYIKHMK KYGYTILDFTKKK I wanted to have columns for example delimited with pipe | or ; |>gnl|TC-DB|A0CIB0|1.A.17.3.1| Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1| MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI I am working with Windows and I don't know how to do it I just know every row starts with > I want to substitute the first whitespace in a row with a delimiter like | or ; after the first regular expression new line in a row, I want also a delimiter everything between the regular expression first new line and > should go into a new column (it's a sequence of a protein)

    Read the article

  • Defining recursive algebraic data types in XML XSD

    - by Ben Challenor
    Imagine I have a recursive algebraic data type like this (Haskell syntax): data Expr = Zero | One | Add Expr Expr | Mul Expr Expr I'd like to represent this in XML, and I'd like an XSD schema for it. I have figured out how to achieve this syntax: <Expr> <Add> <Expr> <Zero/> </Expr> <Expr> <Mul> <Expr> <One/> </Expr> <Expr> <Add> <Expr> <One/> </Expr> <Expr> <One/> </Expr> </Add> </Expr> </Mul> </Expr> </Add> </Expr> with this schema: <xs:complexType name="Expr"> <xs:choice minOccurs="1" maxOccurs="1"> <xs:element minOccurs="1" maxOccurs="1" name="Zero" type="Zero" /> <xs:element minOccurs="1" maxOccurs="1" name="One" type="One" /> <xs:element minOccurs="1" maxOccurs="1" name="Add" type="Add" /> <xs:element minOccurs="1" maxOccurs="1" name="Mul" type="Mul" /> </xs:choice> </xs:complexType> <xs:complexType name="Zero"> <xs:sequence> </xs:sequence> </xs:complexType> <xs:complexType name="One"> <xs:sequence> </xs:sequence> </xs:complexType> <xs:complexType name="Add"> <xs:sequence> <xs:element minOccurs="2" maxOccurs="2" name="Expr" type="Expr" /> </xs:sequence> </xs:complexType> <xs:complexType name="Mul"> <xs:sequence> <xs:element minOccurs="2" maxOccurs="2" name="Expr" type="Expr" /> </xs:sequence> </xs:complexType> But what I really want is this syntax: <Add> <Zero/> <Mul> <One/> <Add> <One/> <One/> </Add> </Mul> </Add> Is this possible? Thanks!

    Read the article

  • DataTable ReadXmlSchema and ReadXml Resulting in error

    - by MasterMax1313
    I'm having some trouble with the ReadXmlSchema and ReadXml methods for a DataTable. I'm getting the error "DataTable does not support schema inference from Xml". Code Snippet: I've tried Table.ReadXmlSchema(new StringReader(File.ReadAllText(XsdFilePath))); Table.ReadXml(new StringReader(File.ReadAllText(XmlFilePath))); And Table.ReadXmlSchema(XsdFilePath); Table.ReadXml(XmlFilePath); Xml Snippet: <ScreenSets> <ScreenSet id="Credit 1"> <Screen xmlFile="sb-credit1.en.xml" tabText="Recommendation" isCached="false"> <Buttons> <Button id="btnClosePresentation"/> </Buttons> </Screen> </ScreenSet> <ScreenSet id="Credit 2"> <Screen xmlFile="sb-credit2.en.xml" tabText="Recommendation" isCached="false"> <Buttons> <Button id="btnClosePresentation"/> </Buttons> </Screen> </ScreenSet> <ScreenSet id="Credit 3"> <Screen xmlFile="sb-credit3.en.xml" tabText="Recommendation" isCached="false"> <Buttons> <Button id="btnClosePresentation"/> </Buttons> </Screen> </ScreenSet> </ScreenSets> Xsd: <?xml version="1.0" encoding="utf-8"?> <xs:schema attributeFormDefault="unqualified" elementFormDefault="qualified" xmlns:xs="http://www.w3.org/2001/XMLSchema"> <xs:element name="ScreenSets"> <xs:complexType> <xs:sequence> <xs:element maxOccurs="unbounded" name="ScreenSet"> <xs:complexType> <xs:sequence> <xs:element name="Screen"> <xs:complexType> <xs:sequence> <xs:element name="Buttons"> <xs:complexType> <xs:sequence> <xs:element maxOccurs="unbounded" name="Button"> <xs:complexType> <xs:attribute name="id" type="xs:string" use="required" /> </xs:complexType> </xs:element> </xs:sequence> </xs:complexType> </xs:element> </xs:sequence> <xs:attribute name="xmlFile" type="xs:string" use="required" /> <xs:attribute name="tabText" type="xs:string" use="required" /> <xs:attribute name="isCached" type="xs:boolean" use="required" /> </xs:complexType> </xs:element> </xs:sequence> <xs:attribute name="id" type="xs:string" use="required" /> </xs:complexType> </xs:element> </xs:sequence> </xs:complexType> </xs:element> </xs:schema>

    Read the article

  • Resolve naming conflict in included XSDs for JAXB compilation

    - by Jason Faust
    I am currently trying to compile with JAXB (IBM build 2.1.3) a pair of schema files into the same package. Each will compile on it's own, but when trying to compile them together i get a element naming conflict due to includes. My question is; is there a way to specify with an external binding a resolution to the naming collision. Example files follow. In the example the offending element is called "Common", which is defined in both incA and incB: incA.xsd <?xml version="1.0" encoding="UTF-8"?> <schema xmlns="http://www.w3.org/2001/XMLSchema" targetNamespace="http://www.example.org/" xmlns:tns="http://www.example.org/" elementFormDefault="qualified"> <complexType name="TypeA"> <sequence> <element name="ElementA" type="string"></element> </sequence> </complexType> <!-- Conflicting element --> <element name="Common" type="tns:TypeA"></element> </schema> incB.xsd <?xml version="1.0" encoding="UTF-8"?> <schema xmlns="http://www.w3.org/2001/XMLSchema" targetNamespace="http://www.example.org/" xmlns:tns="http://www.example.org/" elementFormDefault="qualified"> <complexType name="TypeB"> <sequence> <element name="ElementB" type="int"></element> </sequence> </complexType> <!-- Conflicting element --> <element name="Common" type="tns:TypeB"></element> </schema> A.xsd <?xml version="1.0" encoding="UTF-8"?> <schema targetNamespace="http://www.example.org/" elementFormDefault="qualified" xmlns="http://www.w3.org/2001/XMLSchema" xmlns:tns="http://www.example.org/"> <include schemaLocation="incA.xsd"></include> <complexType name="A"> <sequence> <element ref="tns:Common"></element> </sequence> </complexType> </schema> B.xsd <?xml version="1.0" encoding="UTF-8"?> <schema targetNamespace="http://www.example.org/" elementFormDefault="qualified" xmlns="http://www.w3.org/2001/XMLSchema" xmlns:tns="http://www.example.org/"> <include schemaLocation="incB.xsd"></include> <complexType name="B"> <sequence> <element ref="tns:Common"></element> </sequence> </complexType> </schema> Compiler error when both are compiled from one evocation of xjb: [ERROR] 'Common' is already defined line 9 of file:/C:/temp/incB.xsd [ERROR] (related to above error) the first definition appears here line 9 of file:/C:/temp/incA.xsd (For reference, this is a generalization to resolve an issue with compiling the OAGIS8 SP3 package)

    Read the article

  • Alternate method to dependent, nested if statements to check multiple states

    - by octopusgrabbus
    Is there an easier way to process multiple true/false states than using nested if statements? I think there is, and it would be to create a sequence of states, and then use a function like when to determine if all states were true, and drop out if not. I am asking the question to make sure there is not a preferred Clojure way to do this. Here is the background of my problem: I have an application that depends on quite a few input files. The application depends on .csv data reports; column headers for each report (.csv files also), so each sequence in the sequence of sequences can be zipped together with its columns for the purposes of creating a smaller sequence; and column files for output data. I use the following functions to find out if a file is present: (defn kind [filename] (let [f (File. filename)] (cond (.isFile f) "file" (.isDirectory f) "directory" (.exists f) "other" :else "(cannot be found)" ))) (defn look-for [filename expected-type] (let [find-status (kind-stat filename expected-type)] find-status)) And here are the first few lines of a multiple if which looks ugly and is hard to maintain: (defn extract-re-values "Plain old-fashioned sub-routine to process real-estate values / 3rd Q re bills extract." [opts] (if (= (utl/look-for (:ifm1 opts) "f") 0) ; got re columns? (if (= (utl/look-for (:ifn1 opts) "f") 0) ; got re data? (if (= (utl/look-for (:ifm3 opts) "f") 0) ; got re values output columns? (if (= (utl/look-for (:ifm4 opts) "f") 0) ; got re_mixed_use_ratio columns? (let [re-in-col-nams (first (utl/fetch-csv-data (:ifm1 opts))) re-in-data (utl/fetch-csv-data (:ifn1 opts)) re-val-cols-out (first (utl/fetch-csv-data (:ifm3 opts))) mu-val-cols-out (first (utl/fetch-csv-data (:ifm4 opts))) chk-results (utl/chk-seq-len re-in-col-nams (first re-in-data) re-rec-count)] I am not looking for a discussion of the best way, but what is in Clojure that facilitates solving a problem like this.

    Read the article

  • Sorting Algorithm : output

    - by Aaditya
    I faced this problem on a website and I quite can't understand the output, please help me understand it :- Bogosort, is a dumb algorithm which shuffles the sequence randomly until it is sorted. But here we have tweaked it a little, so that if after the last shuffle several first elements end up in the right places we will fix them and don't shuffle those elements furthermore. We will do the same for the last elements if they are in the right places. For example, if the initial sequence is (3, 5, 1, 6, 4, 2) and after one shuffle we get (1, 2, 5, 4, 3, 6) we will keep 1, 2 and 6 and proceed with sorting (5, 4, 3) using the same algorithm. Calculate the expected amount of shuffles for the improved algorithm to sort the sequence of the first n natural numbers given that no elements are in the right places initially. Input: 2 6 10 Output: 2 1826/189 877318/35343 For each test case output the expected amount of shuffles needed for the improved algorithm to sort the sequence of first n natural numbers in the form of irreducible fractions. I just can't understand the output.

    Read the article

  • Position:absolute

    - by Andrew
    I have I have a div called logo. I want the logo to be on top of other areas and to overlap into the the preface top of a drupal site, the logo currently sits in the header area. I looked up position absolute and I think that what I need to use but when I use position absolute the logo disappears, I can see it if I use position fixed, relative etc. I thought the logo was being hidden because I was not using a z-index but even with that I cant see the logo. What am I doing wrong? #logo { position: absolute; top: 30px; /* 30 pixels from the top of the page */ left: 80px; /* 80 pixels from the left hand side */ z-index:1099; border: 1px solid red; /* So we can see what is happening */ } Also does anyone know of a really good free online css course? Here is some additional information, namely the CSS and the page.tpl.php: <?php // $Id: page.tpl.php,v 1.1.2.5 2010/04/08 07:02:59 sociotech Exp $ ?><!DOCTYPE html PUBLIC "-//W3C//DTD XHTML 1.0 Strict//EN" "http://www.w3.org/TR/xhtml1/DTD/xhtml1-strict.dtd"> <html xmlns="http://www.w3.org/1999/xhtml" lang="<?php print $language->language; ?>" xml:lang="<?php print $language->language; ?>"> <head> <title><?php print $head_title; ?></title> <?php print $head; ?> <?php print $styles; ?> <?php print $setting_styles; ?> <!--[if IE 8]> <?php print $ie8_styles; ?> <![endif]--> <!--[if IE 7]> <?php print $ie7_styles; ?> <![endif]--> <!--[if lte IE 6]> <?php print $ie6_styles; ?> <![endif]--> <?php print $local_styles; ?> <?php print $scripts; ?> </head> <body id="<?php print $body_id; ?>" class="<?php print $body_classes; ?>"> <div id="page" class="page"> <div id="page-inner" class="page-inner"> <div id="skip"> <a href="#main-content-area"><?php print t('Skip to Main Content Area'); ?></a> </div> <!-- header-top row: width = grid_width --> <?php print theme('grid_row', $header_top, 'header-top', 'full-width', $grid_width); ?> <!-- header-group row: width = grid_width --> <div id="header-group-wrapper" class="header-group-wrapper full-width"> <div id="header-group" class="header-group row <?php print $grid_width; ?>"> <div id="header-group-inner" class="header-group-inner inner clearfix"> <?php print theme('grid_block', theme('links', $secondary_links), 'secondary-menu'); ?> <?php print theme('grid_block', $search_box, 'search-box'); ?> <?php if ($logo || $site_name || $site_slogan): ?> <div id="header-site-info" class="header-site-info block"> <div id="header-site-info-inner" class="header-site-info-inner inner"> <?php if ($logo): ?> <div id="logo"> <a href="<?php print check_url($front_page); ?>" title="<?php print t('Home'); ?>"><img src="<?php print $logo; ?>" alt="<?php print t('Home'); ?>" /></a> </div> <?php endif; ?> <?php if ($site_name || $site_slogan): ?> <div id="site-name-wrapper" class="clearfix"> <?php if ($site_name): ?> <span id="site-name"><a href="<?php print check_url($front_page); ?>" title="<?php print t('Home'); ?>"><?php print $site_name; ?></a></span> <?php endif; ?> <?php if ($site_slogan): ?> <span id="slogan"><?php print $site_slogan; ?></span> <?php endif; ?> </div><!-- /site-name-wrapper --> <?php endif; ?> </div><!-- /header-site-info-inner --> </div><!-- /header-site-info --> <?php endif; ?> <?php print $header; ?> <?php print theme('grid_block', $primary_links_tree, 'primary-menu'); ?> </div><!-- /header-group-inner --> </div><!-- /header-group --> </div><!-- /header-group-wrapper --> <!-- preface-top row: width = grid_width --> <?php print theme('grid_row', $preface_top, 'preface-top', 'full-width', $grid_width); ?> <!-- main row: width = grid_width --> <div id="main-wrapper" class="main-wrapper full-width<?php if ($is_front) { print ' front'; } ?>"> <div id="main" class="main row <?php print $grid_width; ?>"> <div id="main-inner" class="main-inner inner clearfix"> <?php print theme('grid_row', $sidebar_first, 'sidebar-first', 'nested', $sidebar_first_width); ?> <!-- main group: width = grid_width - sidebar_first_width --> <div id="main-group" class="main-group row nested <?php print $main_group_width; ?>"> <div id="main-group-inner" class="main-group-inner inner"> <?php print theme('grid_row', $preface_bottom, 'preface-bottom', 'nested'); ?> <div id="main-content" class="main-content row nested"> <div id="main-content-inner" class="main-content-inner inner"> <!-- content group: width = grid_width - (sidebar_first_width + sidebar_last_width) --> <div id="content-group" class="content-group row nested <?php print $content_group_width; ?>"> <div id="content-group-inner" class="content-group-inner inner"> <?php print theme('grid_block', $breadcrumb, 'breadcrumbs'); ?> <?php if ($content_top || $help || $messages): ?> <div id="content-top" class="content-top row nested"> <div id="content-top-inner" class="content-top-inner inner"> <?php print theme('grid_block', $help, 'content-help'); ?> <?php print theme('grid_block', $messages, 'content-messages'); ?> <?php print $content_top; ?> </div><!-- /content-top-inner --> </div><!-- /content-top --> <?php endif; ?> <div id="content-region" class="content-region row nested"> <div id="content-region-inner" class="content-region-inner inner"> <a name="main-content-area" id="main-content-area"></a> <?php print theme('grid_block', $tabs, 'content-tabs'); ?> <div id="content-inner" class="content-inner block"> <div id="content-inner-inner" class="content-inner-inner inner"> <?php if ($title): ?> <h1 class="title"><?php print $title; ?></h1> <?php endif; ?> <?php if ($content): ?> <div id="content-content" class="content-content"> <?php print $content; ?> <?php print $feed_icons; ?> </div><!-- /content-content --> <?php endif; ?> </div><!-- /content-inner-inner --> </div><!-- /content-inner --> </div><!-- /content-region-inner --> </div><!-- /content-region --> <?php print theme('grid_row', $content_bottom, 'content-bottom', 'nested'); ?> </div><!-- /content-group-inner --> </div><!-- /content-group --> <?php print theme('grid_row', $sidebar_last, 'sidebar-last', 'nested', $sidebar_last_width); ?> </div><!-- /main-content-inner --> </div><!-- /main-content --> <?php print theme('grid_row', $postscript_top, 'postscript-top', 'nested'); ?> </div><!-- /main-group-inner --> </div><!-- /main-group --> </div><!-- /main-inner --> </div><!-- /main --> </div><!-- /main-wrapper --> <!-- postscript-bottom row: width = grid_width --> <?php print theme('grid_row', $postscript_bottom, 'postscript-bottom', 'full-width', $grid_width); ?> <!-- footer row: width = grid_width --> <?php print theme('grid_row', $footer, 'footer', 'full-width', $grid_width); ?> <!-- footer-message row: width = grid_width --> <div id="footer-message-wrapper" class="footer-message-wrapper full-width"> <div id="footer-message" class="footer-message row <?php print $grid_width; ?>"> <div id="footer-message-inner" class="footer-message-inner inner clearfix"> <?php print theme('grid_block', $footer_message, 'footer-message-text'); ?> </div><!-- /footer-message-inner --> </div><!-- /footer-message --> </div><!-- /footer-message-wrapper --> </div><!-- /page-inner --> </div><!-- /page --> <?php print $closure; ?> </body> </html> CSS /* $Id: style.css,v 1.1.2.11 2010/07/02 22:11:04 sociotech Exp $ */ /* Margin, Padding, Border Resets -------------------------------------------------------------- */ html, body, div, span, p, dl, dt, dd, ul, ol, li, h1, h2, h3, h4, h5, h6, form, fieldset, input, textarea { margin: 0; padding: 0; } img, abbr, acronym { border: 0; } /* HTML Elements -------------------------------------------------------------- */ p { margin: 1em 0; } h1, h2, h3, h4, h5, h6 { margin: 0 0 0.5em 0; } h1 { color: white !important; text-shadow: black !important; } ul, ol, dd { margin-bottom: 1.5em; margin-left: 2em; /* LTR */ } li ul, li ol { margin-bottom: 0; } ul { list-style-type: disc; } ol { list-style-type: decimal; } a { margin: 0; padding: 0; text-decoration: none; } a:link, a:visited { } a:hover, a:focus, a:active { text-decoration: underline; } blockquote { } hr { height: 1px; border: 1px solid gray; } /* tables */ table { border-spacing: 0; width: 100%; } tr.even td, tr.odd td { background-color: #FFFFFF; border: 1px solid #dbdbdb; } caption { text-align: left; } th { margin: 0; padding: 0 10px 0 0; } th.active img { display: inline; } thead th { padding-right: 10px; } td { margin: 0; padding: 3px; } /* Remove grid block styles from Drupal's table ".block" class */ td.block { border: none; float: none; margin: 0; } /* Maintain light background/dark text on dragged table rows */ tr.drag td, tr.drag-previous td { background: #FFFFDD; color: #000; } /* Accessibility /-------------------------------------------------------------- */ /* skip-link to main content, hide offscreen */ #skip a, #skip a:hover, #skip a:visited { height: 1px; left: 0px; overflow: hidden; position: absolute; top: -500px; width: 1px; } /* make skip link visible when selected */ #skip a:active, #skip a:focus { background-color: #fff; color: #000; height: auto; padding: 5px 10px; position: absolute; top: 0; width: auto; z-index: 99; } #skip a:hover { text-decoration: none; } /* Helper Classes /-------------------------------------------------------------- */ .hide { display: none; visibility: hidden; } .left { float: left; } .right { float: right; } .clear { clear: both; } /* clear floats after an element */ /* (also in ie6-fixes.css, ie7-fixes.css) */ .clearfix:after, .clearfix .inner:after { clear: both; content: "."; display: block; font-size: 0; height: 0; line-height: 0; overflow: auto; visibility: hidden; } /* Grid Layout Basics (specifics in 'gridnn_x.css') -------------------------------------------------------------- */ /* center page and full rows: override this for left-aligned page */ .page, .row { margin: 0 auto; } /* fix layout/background display on floated elements */ .row, .nested, .block { overflow: hidden; } /* full-width row wrapper */ div.full-width { width: 100%; } /* float, un-center & expand nested rows */ .nested { float: left; /* LTR */ margin: 0; width: 100%; } /* allow Superfish menus to overflow */ #sidebar-first.nested, #sidebar-last.nested, div.superfish { overflow: visible; } /* sidebar layouts */ .sidebars-both-first .content-group { float: right; /* LTR */ } .sidebars-both-last .sidebar-first { float: right; /* LTR */ } /* Grid Mask Overlay -------------------------------------------------------------- */ #grid-mask-overlay { display: none; left: 0; opacity: 0.75; position: absolute; top: 0; width: 100%; z-index: 997; } #grid-mask-overlay .row { margin: 0 auto; } #grid-mask-overlay .block .inner { background-color: #e3fffc; outline: none; } .grid-mask #grid-mask-overlay { display: block; } .grid-mask .block { overflow: visible; } .grid-mask .block .inner { outline: #f00 dashed 1px; } #grid-mask-toggle { background-color: #777; border: 2px outset #fff; color: #fff; cursor: pointer; font-variant: small-caps; font-weight: normal; left: 0; -moz-border-radius: 5px; padding: 0 5px 2px 5px; position: absolute; text-align: center; top: 22px; -webkit-border-radius: 5px; z-index: 998; } #grid-mask-toggle.grid-on { border-style: inset; font-weight: bold; } /* Site Info -------------------------------------------------------------- */ #header-site-info { width: auto; } #site-name-wrapper { float: left; /* LTR */ } #site-name, #slogan { display: block; } #site-name a:link, #site-name a:visited, #site-name a:hover, #site-name a:active { text-decoration: none; } #site-name a { outline: 0; } /* Regions -------------------------------------------------------------- */ /* Header Regions -------------------------------------------------------------- */ #header-group { overflow: visible; } /* Content Regions (Main) -------------------------------------------------------------- */ .node-bottom { margin: 1.5em 0 0 0; } /* Clear floats on regions -------------------------------------------------------------- */ #header-top-wrapper, #header-group-wrapper, #preface-top-wrapper, #main-wrapper, #preface-bottom, #content-top, #content-region, #content-bottom, #postscript-top, #postscript-bottom-wrapper, #footer-wrapper, #footer-message-wrapper { clear: both; } /* Drupal Core /-------------------------------------------------------------- */ /* Lists /-------------------------------------------------------------- */ .item-list ul li { margin: 0; } .block ul, .block ol { margin-left: 2em; /* LTR */ padding: 0; } .content-inner ul, .content-inner ol { margin-bottom: 1.5em; } .content-inner li ul, .content-inner li ol { margin-bottom: 0; } .block ul.links { margin-left: 0; /* LTR */ } /* Menus /-------------------------------------------------------------- */ ul.menu li, ul.links li { margin: 0; padding: 0; } /* Primary Menu /-------------------------------------------------------------- */ /* use ID to override overflow: hidden for .block, dropdowns should always be visible */ #primary-menu { overflow: visible; } /* remove left margin from primary menu list */ #primary-menu.block ul { margin-left: 0; /* LTR */ } /* remove bullets, float left */ .primary-menu ul li { float: left; /* LTR */ list-style: none; position: relative; } /* style links, and unlinked parent items (via Special Menu Items module) */ .primary-menu ul li a, .primary-menu ul li .nolink { display: block; padding: 0.75em 1em; text-decoration: none; } /* Add cursor style for unlinked parent menu items */ .primary-menu ul li .nolink { cursor: default; } /* remove outline */ .primary-menu ul li:hover, .primary-menu ul li.sfHover, .primary-menu ul a:focus, .primary-menu ul a:hover, .primary-menu ul a:active { outline: 0; } /* Secondary Menu /-------------------------------------------------------------- */ .secondary-menu-inner ul.links { margin-left: 0; /* LTR */ } /* Skinr styles /-------------------------------------------------------------- */ /* Skinr selectable helper classes */ .fusion-clear { clear: both; } div.fusion-right { float: right; /* LTR */ } div.fusion-center { float: none; margin-left: auto; margin-right: auto; } .fusion-center-content .inner { text-align: center; } .fusion-center-content .inner ul.menu { display: inline-block; text-align: center; } /* required to override drupal core */ .fusion-center-content #user-login-form { text-align: center; } .fusion-right-content .inner { text-align: right; /* LTR */ } /* required to override drupal core */ .fusion-right-content #user-login-form { text-align: right; /* LTR */ } /* Large, bold callout text style */ .fusion-callout .inner { font-weight: bold; } /* Extra padding on block */ .fusion-padding .inner { padding: 30px; } /* Adds 1px border and padding */ .fusion-border .inner { border-width: 1px; border-style: solid; padding: 10px; } /* Single line menu with separators */ .fusion-inline-menu .inner ul.menu { margin-left: 0; /* LTR */ } .fusion-inline-menu .inner ul.menu li { border-right-style: solid; border-right-width: 1px; display: inline; margin: 0; padding: 0; white-space: nowrap; } .fusion-inline-menu .inner ul.menu li a { padding: 0 8px 0 5px; /* LTR */ } .fusion-inline-menu .inner ul li.last { border: none; } /* Hide second level (and beyond) menu items */ .fusion-inline-menu .inner ul li.expanded ul { display: none; } /* Multi-column menu style with bolded top level menu items */ .fusion-multicol-menu .inner ul { margin-left: 0; /* LTR */ text-align: left; /* LTR */ } .fusion-multicol-menu .inner ul li { border-right: none; display: block; font-weight: bold; } .fusion-multicol-menu .inner ul li.last { border-right: none; } .fusion-multicol-menu .inner ul li.last a { padding-right: 0; /* LTR */ } .fusion-multicol-menu .inner ul li.expanded, .fusion-multicol-menu .inner ul li.leaf { float: left; /* LTR */ list-style-image: none; margin-left: 50px; /* LTR */ } .fusion-multicol-menu .inner ul.menu li.first { margin-left: 0; /* LTR */ } .fusion-multicol-menu .inner ul li.expanded li.leaf { float: none; margin-left: 0; /* LTR */ } .fusion-multicol-menu .inner ul li.expanded ul { display: block; margin-left: 0; /* LTR */ } .fusion-multicol-menu .inner ul li.expanded ul li { border: none; margin-left: 0; /* LTR */ text-align: left; /* LTR */ } .fusion-multicol-menu .inner ul.menu li ul.menu li { font-weight: normal; } /* Split list across multiple columns */ .fusion-2-col-list .inner .item-list ul li, .fusion-2-col-list .inner ul.menu li { float: left; /* LTR */ width: 50%; } .fusion-3-col-list .inner .item-list ul li, .fusion-3-col-list .inner ul.menu li { float: left; /* LTR */ width: 33%; } .fusion-2-col-list .inner .item-list ul.pager li, .fusion-3-col-list .inner .item-list ul.pager li { float: none; width: auto; } /* List with bottom border Fixes a common issue when list items have bottom borders and appear to be doubled when nested lists end and begin. This removes the extra border-bottom */ .fusion-list-bottom-border .inner ul li { list-style: none; list-style-type: none; list-style-image: none; } .fusion-list-bottom-border .inner ul li, .fusion-list-bottom-border .view-content div.views-row { padding: 0 0 0 10px; /* LTR */ border-bottom-style: solid; border-bottom-width: 1px; line-height: 216.7%; /* 26px */ } .fusion-list-bottom-border .inner ul { margin: 0; } .fusion-list-bottom-border .inner ul li ul { border-bottom-style: solid; border-bottom-width: 1px; } .fusion-list-bottom-border .inner ul li ul li.last { border-bottom-style: solid; border-bottom-width: 1px; margin-bottom: -1px; margin-top: -1px; } #views_slideshow_singleframe_pager_slideshow-page_2 .pager-item { display:block; } #views_slideshow_singleframe_pager_slideshow-page_2 { position:absolute; right:0; top:0; } #header-group-wrapper { background: none; } #page { background-color:#F3F3F3; background-image:url('/sites/all/themes/fusion/fusion_core/images/runswithgradient.jpg'); background-repeat:no-repeat; background-attachment: fixed; width: auto; } #views_slideshow_singleframe_pager_slideshow-page_2 div a img { top:0px; height:60px; width:80px; padding-right:10px; padding-bottom:19px; } #mycontent{ width: 720px; } .product-body { -moz-border-radius: 4px 4px 4px 4px; margin: 0 0 20px; overflow: hidden; padding: 20px; background: none repeat scroll 0 0 #F7F7F7; border: 1px solid #000000; border-style:solid; border-width:thin; color:#000000; } #product-details { background: none repeat scroll 0 0 #F7F7F7 !important; border: 1px solid #000000 !important; color: #8E8E8E; } #logo { position: relative; top: 30px; /* 30 pixels from the top of the page */ left: 80px; /* 80 pixels from the left hand side */ z-index:1099; border: 1px solid red; /* So we can see what is happening */ } #breadcrumbs-inner { background: none; border-color: transparent; border-style: none; } #block-views-new_products-block_1{ height:200px; } /* List with no bullet and extra padding This is a common style for menus, which removes the bullet and adds more vertical padding for a simple list style */ .fusion-list-vertical-spacing .inner ul, .fusion-list-vertical-spacing div.views-row-first { margin-left: 0; margin-top: 10px; } .fusion-list-vertical-spacing .inner ul li, .fusion-list-vertical-spacing div.views-row { line-height: 133.3%; /* 16px/12px */ margin-bottom: 10px; padding: 0; } .fusion-list-vertical-spacing .inner ul li { list-style: none; list-style-image: none; list-style-type: none; } .fusion-list-vertical-spacing .inner ul li ul { margin-left: 10px; /* LTR */ } /* Bold all links */ .fusion-bold-links .inner a { font-weight: bold; } /* Float imagefield images left and add margin */ .fusion-float-imagefield-left .field-type-filefield, .fusion-float-imagefield-left .image-insert, .fusion-float-imagefield-left .imagecache { float: left; /* LTR */ margin: 0 15px 15px 0; /* LTR */ } /* Clear float on new Views item so each row drops to a new line */ .fusion-float-imagefield-left .views-row { clear: left; /* LTR */ } /* Float imagefield images right and add margin */ .fusion-float-imagefield-right .field-type-filefield, .fusion-float-imagefield-right .image-insert .fusion-float-imagefield-right .imagecache { float: right; /* LTR */ margin: 0 0 15px 15px; /* LTR */ } /* Clear float on new Views item so each row drops to a new line */ .fusion-float-imagefield-right .views-row { clear: right; /* LTR */ } /* Superfish: all menus */ .sf-menu li { list-style: none; list-style-image: none; list-style-type: none; } /* Superfish: vertical menus */ .superfish-vertical { position: relative; z-index: 9; } ul.sf-vertical { background: #fafafa; margin: 0; width: 100%; } ul.sf-vertical li { border-bottom: 1px solid #ccc; font-weight: bold; line-height: 200%; /* 24px */ padding: 0; width: 100%; } ul.sf-vertical li a:link, ul.sf-vertical li a:visited, ul.sf-vertical li .nolink { margin-left: 10px; padding: 2px; } ul.sf-vertical li a:hover, ul.sf-vertical li a.active { text-decoration: underline; } ul.sf-vertical li ul { background: #fafafa; border-top: 1px solid #ccc; margin-left: 0; width: 150px; } ul.sf-vertical li ul li.last { border-top: 1px solid #ccc; margin-bottom: -1px; margin-top: -1px; } ul.sf-vertical li ul { border-top: none; padding: 4px 0; } ul.sf-vertical li ul li { border-bottom: none; line-height: 150%; /* 24px */ More below but I can't paste that much Thanks for the suggestion I've tried this #header-group { position: relative; z-index: 9; } #logo { position: abosolute; top: 230px; /* 30 pixels from the top of the page */ left: 10px; /* 80 pixels from the left hand side */ z-index: 999; } but it's not working. I've taken a screen shot of the div to show the structure. http://i.stack.imgur.com/ff4DP.png

    Read the article

  • HTML/JavaScript: mouseover effect for image maps?

    - by MVCDummy09
    I'm trying to help out a nonprofit by doing their website. They want (ugh) their logo to serve as an HTML image map. In other words, when you click on different parts of the logo, you're directed to different web pages. They also, however, want mouseover effects: when you mouseover a particular portion of the image map, that piece of the graphic should be highlighted. If the logo was simple, I would slice it up into rectangles and attach mouseover and click events to the appropriate rectangles. With the complexity of their logo, this is not possible, however. Has anyone done anything like this without Flash? I'm not a Flash developer but this is looking like a very difficult task in just HTML/JavaScript. Any ideas? Thanks!

    Read the article

  • SSRS: Report loading external images, image not found, can I hide the image control

    - by Nauman
    My SSRS report loads logo images for each customer from a customer number specific folder on the report server. I write an expression, to form my URL to the image based on th customer number. ..."http://localhost/images/" + iCustomerNumber.ToString() + "/logo.gif" I am able to get this working, but the problem I face is, when a particular customer doesn't has an image, then my report shows a red X mark in place of the logo. In this case, I expect to hide the image control itself. Any thoughts???? The other dirty solution will be to ensure that each customer specific folder has the designated image! even if there is no logo for a customer, I'll place a blank.gif or a spacer.gif of probably a square pixel in dimension!.

    Read the article

  • Browser relative positioning with jQuery and CutyCapt

    - by Acoustic
    I've been using CutyCapt to take screen shots of several web pages with great success. My challenge now is to paint a few dots on those screen shots that represent where a user clicked. CutyCapt goes through a process of resizing the web page to the scroll width before taking a screen shot. That's extremely useful because you only get content and not much (if any) of the page's background. My challenge is trying to map a user's mouse X coordinates to the screen shot. Obviously users have different screen resolutions and have their browser window open to different sizes. The image below shows 3 examples with the same logo. Assume, for example, that the logo is 10 pixels to the left edge of the content area (in red). In each of these cases, and for any resolution, I need a JavaScript routine that will calculate that the logo's X coordinate is 10. Again, the challenge (I think) is differing resolutions. In the center-aligned examples, the logo's position, as measured from the left edge of the browser (in black), differs with changing browser size. The left-aligned example should be simple as the logo never moves as the screen resizes. Can anyone think of a way to calculate the scrollable width of a page? In other words, I'm looking for a JavaScript solution to calculate the minimum width of the browser window before a horizontal scroll bar shows up. Thanks for your help!

    Read the article

  • Background images and Logos

    - by clone1018
    Ok so I have a Background background-image: url('images/body.png'); now I want to overlay a Logo using background-image: url('images/logo.png'); but the Logo is behind the Background. I've tried z-index. But it doesn't help. Any ideas?

    Read the article

  • Strange layout behaviour

    - by andrii
    I am a little bit confused. Here is an small web page. There are two main div-s: top and mainBlock. First contain image. The problem is that firebug shows that div#top's height is equal to 0 and because of that the next div mainBlock moves up. If I would delete this peace of code: div#logo{ float: left; } everything will start working fine and div#mainBlock will be below the div#top. Could you, please, explain me how it works and how to avoid this in proper way? Here is my code: <!DOCTYPE html PUBLIC "-//W3C//DTD XHTML 1.0 Transitional//EN" "http://www.w3.org/TR/xhtml1/DTD/xhtml1-transitional.dtd"> <html xmlns="http://www.w3.org/1999/xhtml"> <head> <meta http-equiv="Content-Type" content="text/html; charset=UTF-8"/> <title>Paralab - Website &amp; interface design, web apps development, usability</title> <style text="text/css"> html, body{ } div#logo{ float: left; } #top{ width: 100%; } #mainBlock{ width:100%; } </style> </head> <body> <div id="top"> <div id="logo"> <img alt="logo" src="img/logo.png" /> </div> </div> <div id="mainBlock"> Contact Us </div> </body> </html>

    Read the article

  • MySQL SELECT Statment issue

    - by mouthpiec
    Hi, I have the following query which returns 2 tuples SELECT bar_id, bar_name, town_name, bar_telephone, subscription_type_id, type FROM towns, subscriptiontype, regions, bar LEFT JOIN barpictures bp ON bar.bar_id = bp.bar_id_fk WHERE town_id = town_id_fk AND bar.test_field = 0 AND subscription_type_id = subscription_type_id_fk AND region_id = region_id_fk AND (type like 'logo%' OR type IS NULL) The main difference between the tuples is that one has 'type' = logo and the other tuple has 'type' = logo_large. I need that instead of having two tuples, I need that I have 2 type attributes, one holding the "logo" and the other the "logo_large" eg bar_id, bar_name, town_name, bar_telephone, subscription_type_id, type1, type2 is this possible

    Read the article

  • how to dispaly image in grid view reading imageUrl from xml using sax parser in android

    - by Pramod kuamr
    thanks for answer but i am able to read xml file from url but i need if in xml imageUrl is there so show in grid view ..this is my xml file and read URL <?xml version="1.0" encoding="UTF-8"?> <channels> <channel> <name>ndtv</name> <logo>http://a3.twimg.com/profile_images/670625317/aam-logo--twitter.png</logo> <description>this is a news Channel</description> <rssfeed>ndtv.com</rssfeed> </channel> <channel> <name>star news</name> <logo>http://a3.twimg.com/profile_images/740897825/AndroidCast-350_normal.png</logo> <description>this is a newsChannel</description> <rssfeed>starnews.com</rssfeed> </channel> </channels>

    Read the article

  • wicket: how to add table background image

    - by vivmal
    Hi All Can anyone please tell me how to add table background image in wicket. Actually I've tried a lot like <table background="images/logo.jpg"> also <style>table {background-image: url('images/logo.jpg')}</style> also <table style="background-image: url('images/logo.jpg')"> But nothing works. Please help. Thanks in advance.

    Read the article

  • Using mod-rewrite to conditionally select existing file in a subdirectory based on Host header?

    - by Kevin Hakanson
    I'm working through a problem where I want to select a different static content file based on the incoming Host header. The simple example is a mapping from URLs to files like this: www.example.com/images/logo.gif - \images\logo.gif skin2.example.com/images/logo.gif - \images\skin2\logo.gif skin3.example.com/images/logo.gif - \images\skin3logo.gif I have this working with the following RewriteRules, but I don't like how I have to repeat myself so much. Each host has the same set of rules, and each RewriteCond and RewriteRule has the same path. I'd like to use the RewriteMap, but I don't know how to use it to map the %{HTTP_HOST} to the path. <VirtualHost *:80> DocumentRoot "C:/Program Files/Apache Software Foundation/Apache2.2/htdocs" ServerName www.example.com ServerAlias skin2.example.com ServerAlias skin3.example.com RewriteEngine On RewriteCond %{HTTP_HOST} skin2.example.com RewriteCond %{DOCUMENT_ROOT}$1/skin2/$2 -f RewriteRule ^(.*)/(.*) $1/skin2/$2 [L] RewriteCond %{HTTP_HOST} skin3.example.com RewriteCond %{DOCUMENT_ROOT}$1/skin3/$2 -f RewriteRule ^(.*)/(.*) $1/skin3/$2 [L] </VirtualHost> The concept behind the rules is if the same filename exists in a subdirectory for that host, use it instead of the direct targeted file. This uses host based subdirectories at the lowest level, and not a top level subdirectory to separate content.

    Read the article

< Previous Page | 23 24 25 26 27 28 29 30 31 32 33 34  | Next Page >