Search Results

Search found 1145 results on 46 pages for 'pipe'.

Page 28/46 | < Previous Page | 24 25 26 27 28 29 30 31 32 33 34 35  | Next Page >

• Routing traffic to a specific NIC in Windows

  - by Stoicpoet

  I added a 10GB NIC to a SQL server which is connected over to a backend storage using ISCSI. I would like to force traffic going to a certain IP address/host to use the 10gb NIC, while all other traffic should continue to use the 1GB NIC. The 10gb nic is configured using a private network. So far I have added a entry in the host file to the host…

  Read the article

• Under *nix, how can I find a string within a file within a directory ?

  - by roberto

  Hi all. I'm using ubuntu linux, and I use bash from with a terminal emulator every day for many tasks. I would like to know how to find a string or a substring within a file that is within a particular directory. If I was knew the file which contained my target substring, I would just cat the file and pipe it through grep, thus: cat file |…

  Read the article

• Improve efficiency when using parallel to read from compressed stream

  - by Yoga

  Is another question extended from the previous one [1] I have a compressed file and stream them to feed into a python program, e.g. bzcat data.bz2 | parallel --no-notice -j16 --pipe python parse.py > result.txt The parse.py can read from stdin continusuoly and print to stdout My ec2 instance is 16 cores but from the top command it is…

  Read the article

• Convert text to table

  - by Quattro

  I would like convert text into a table. Here is a link to the text http://www.tcdb.org/public/tcdb Short example: >gnl|TC-DB|A0CIB0|1.A.17.3.1 Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1 MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM…

  Read the article

• How to avoid Remove-Item PowerShell errors "process cannot access the file"?

  - by Michael Freidgeim

  We are using TfsDeployer and PowerShell script to remove the folders ising Remove-Item before deployment of a new version. Sometimes the PS script failed with the error Remove-Item : Cannot remove item Services\bin: The process cannot access the file Services\bin' because it is being used by another proc Get-ChildItem -Path…

  Read the article

• Enter response once prompt returns?

  - by mjb

  It's neither a secure idea nor one I'd recommend elsewhere, but I have a situation when occasionally it takes a while for my Ansible ad-hoc command to respond. I'd love to pipe or args or whatever is needed to push the required text into the prompt so I can walk away and know it will finish. Ex: $ ansible all -m shell -a…

  Read the article

• Problem accessing MICROSOFT##SSEE database (Error: 18456, Severity: 14, State: 16.)

  - by Philipp Schmid

  After an unexpected server shutdown due to a power failure, I can no longer connect to the internal windows database MICROSOFT##SSEE which is hosting Central Admin for my SBS 2008 server. The log shows: Error: 18456, Severity: 14, State: 16. Login failed for user 'NT AUTHORITY\NETWORK SERVICE'. [CLIENT: <named…

  Read the article

• What does this error mean (Can't create TCP/IP socket (24))?

  - by user105196

  I have web server with OS RHEL 6.2 and Mysql 5.5.23 on another server and the web server can read from Mysql server without problem, but some time I got this error: [Sun Sep 23 06:13:07 2012] [error] [client XXXXX] DBI connect('XXXX:192.168.1.2:3306','XXX',...) failed: Can't create TCP/IP socket (24) at…

  Read the article

• Searching Multiple Terms

  - by nevets1219

  I know that grep -E 'termA|termB' files allows me to search multiple files for termA OR termB. What I would like to do instead is search for termA AND termB. They do not have to be on the same line as long as the two terms exists within the same file. Essentially a "search within result" feature. I know…

  Read the article

• No COM1 port on hyper-v

  - by MPX

  I just made a fresh Windows 8.1 install and am trying to set-up a VM for kernel debugging. Therefore, I need to create a serial link to debug the VM using windbg. Usually I just simply add a new COM port and use it as a named pipe. However, I can't find any way to add this hardware. There is nothing…

  Read the article

• Is there a way for me to test my [closed]

  - by Jimi

  I have a home network with a cheap-o little router with a development server and a few devices hooked up to it. I am finding that backups of my server are taking FOREVER (a week for 60gb) running backups renders my internet connection useless from any other box int he house. I have maxed out the pipe…

  Read the article

• How to determine if my router is causing a bottleneck in uploads?

  - by Jimi

  I have a home network with a cheap-o little router with a development server and a few devices hooked up to it. I am finding that backups of my server are taking FOREVER (a week for 60gb) running backups renders my internet connection useless from any other box int he house. I have maxed out the pipe…

  Read the article

• Delphi Speech recognition delphi

  - by XBasic3000

  I need create a programatic equivalent using delphi language... or could someone post a link on how to do grammars in peech recogniton using the delphi. sorry for my english... XML Grammar Sample(s): <GRAMMAR> <!-- Create a simple "hello world" rule --> <RULE…

  Read the article

• Supporting Piping (A Useful Hello World)

  - by blastthisinferno

  I am trying to write a collection of simple C++ programs that follow the basic Unix philosophy by: Make each program do one thing well. Expect the output of every program to become the input to another, as yet unknown, program. I'm having an issue trying to get the output of one to be the…

  Read the article

• No-Weld Multi-Monitor Stand Crafted From Sturdy Metal Framing

  - by Jason Fitzpatrick

  As far as DIY stands for multiple monitors go, this design has to be the sturdiest and least difficult to construct model we’ve seen in some time. Read on to see how one DIYer cleverly crafted a solid metal triple monitor stand with no welding involved. Tinker and gamer Opteced wanted a new…

  Read the article

• Errors Code: /var/cache/apt/archives/linux-image-3.8.0-19-generic_3.8.0-19.30~precise1_amd64.deb

  - by user286682

  $ sudo apt-get dist-upgrade Reading package lists... Done Building dependency tree Reading state information... Done Calculating upgrade... Done The following packages will be upgraded: linux-image-3.8.0-19-generic 1 upgraded, 0 newly installed, 0 to remove and 0 not upgraded. 6…

  Read the article

• unmet dependencies and broken count>0 problem

  - by Simon

  I tried installing fbreader, following all the steps, but ended up with unmet dependencies, i also think a file is referenced in two locations at once and hence killing it.. any ideas how I can fix it? i've done alot of research and tried: simon@simon-Studio-1558:~$ sudo apt-get -f…

  Read the article

• GPLv2 - Multiple AI chess engines to bypass GPL

  - by Dogbert

  I have gone through a number of GPL-related questions, the most recent being this one: http://stackoverflow.com/questions/3248823/legal-question-about-the-gpl-license-net-dlls/3249001#3249001 I'm trying to see how this would work, so bear with me. I have a simple GUI interface for…

  Read the article

• Sesame OData Browser updated

  - by Fabrice Marguerie

  Since the first preview of Sesame was published, I've been working on improving it with new features.Today, I've published an update that provides the following: Support for hyperlinks (URLs and email addresses) Improved support for the OData format. More OData producers are…

  Read the article

• Shockwave Flash crashes with Chromium and Firefox

  - by Stephan

  Since updating to Ubuntu 13.10, Shockwave Flash does not work in Chromium or Firefox. Both show a "Shockwave Flash has crashed" dialog. Chromium 29.0.1547.65 After loading a page with a Flash video, I get this warning on the console twice: NVIDIA: could not open the device…

  Read the article

• Can Ubuntu-One be installed on Ubuntu 10.04?

  - by crivello

  I have installed ubuntu-one by the several ways on a 10.04-TLS, it appears on my System Preference Ubuntu One. however, Clicking one it , nothing happens. On a terminal, the command : ~$ ubuntuone-launch doe not working too, and the following command ~$…

  Read the article

• Per-vertex animation with VBOs: VBO per character or VBO per animation?

  - by charstar

  Goal To leverage the richness of well vetted animation tools such as Blender to do the heavy lifting for a small but rich set of animations. I am aware of additive pose blending like that from Naughty Dog and similar techniques but I would prefer to expend a…

  Read the article

• Cannot install extensions required for GNOME Shell themes

  - by Soham Chowdhury

  I keep getting this output: soham@fortress:~$ sudo apt-get install gnome-shell-extensions gnome-tweak-tool Reading package lists... Done Building dependency tree Reading state information... Done gnome-tweak-tool is already the…

  Read the article

• Can I override fonts installed by ttf-mscorefonts-installer, prefer Liberation fonts?

  - by conner_bw

  I had to apt-get install ttf-mscorefonts-installer on Ubuntu 12.04/12.10. The short version is I need to pipe PDF files out of an application that requires these fonts for certain glyphs. The problem, after running this command, is that the fonts in my web…

  Read the article

• CodePlex Daily Summary for Sunday, October 21, 2012

  CodePlex Daily Summary for Sunday, October 21, 2012Popular ReleasesBlogEngine.NET: BlogEngine.NET 2.7 RC: Cheap ASP.NET Hosting - $4.95/Month - Click Here!! Click Here for More Info Cheap ASP.NET Hosting - $4.95/Month - Click Here! dot This is a Release…

  Read the article

< Previous Page | 24 25 26 27 28 29 30 31 32 33 34 35  | Next Page >