Search Results

Search found 4119 results on 165 pages for 'bebe 17'.

Page 29/165 | < Previous Page | 25 26 27 28 29 30 31 32 33 34 35 36  | Next Page >

  • Can PHP be run in Apache via mod_php and mod_fcgi side by side?

    - by Mario Parris
    I have an existing installation of Apache (2.2.10 Windows x86) using mod_php and PHP 5.2.6. Can I run another site in a virtual host using FastCGI and a different version of PHP, while stilling running the main site in mod_php? I've made an attempt, but when I add my FCGI settings to the virtual host container, Apache is unable to restart. httpd.conf mod_php settings: LoadModule php5_module "C:\PHP\php-5.2.17-Win32-VC6-x86\php5apache2_2.dll" AddHandler application/x-httpd-php .php PHPIniDir "C:\PHP\php-5.2.17-Win32-VC6-x86" httpd-vhosts.conf fastcgi settings: <VirtualHost *:80> DocumentRoot "C:/Inetpub/wwwroot/site-b/source/public" ServerName local.siteb.com ServerAlias local.siteb.com SetEnv PHPRC "C:\PHP\php-5.3.5-nts-Win32-VC6-x86\php.ini" FcgidInitialEnv PHPRC "C:\PHP\php-5.3.5-nts-Win32-VC6-x86" FcgidWrapper "C:\PHP\php-5.3.5-nts-Win32-VC6-x86\php-cgi.exe" .php AddHandler fcgid-script .php </VirtualHost> <Directory "C:/Inetpub/wwwroot/site-b/source/public"> Options Indexes FollowSymLinks Includes ExecCGI AllowOverride All Order allow,deny Allow from all </Directory>

    Read the article

  • round off and displaying the values

    - by S.PRATHIBA
    Hi all, I have the following code: import java.io.; import java.sql.; import java.math.; import java.lang.; public class Testd1{ public static void main(String[] args) { System.out.println("Sum of the specific column!"); Connection con = null; int m=1; double sum,sum1,sum2; int e[]; e=new int[100]; int p; int decimalPlaces = 5; for( int i=0;i< e.length;i++) { e[i]=0; } double b2,c2,d2,u2,v2; int i,j,k,x,y; double mat[][]=new double[10][10]; try { Class.forName("com.mysql.jdbc.Driver"); con = DriverManager.getConnection ("jdbc:mysql://localhost:3306/prathi","root","mysql"); try{ Statement st = con.createStatement(); ResultSet res = st.executeQuery("SELECT Service_ID,SUM(consumer_feedback) FROM consumer1 group by Service_ID"); while (res.next()){ int data=res.getInt(1); System.out.println(data); System.out.println("\n\n"); int c1 = res.getInt(2); e[m]=res.getInt(2); if(e[m]<0) e[m]=0; m++; System.out.print(c1); System.out.println("\t\t"); } sum=e[1]+e[2]+e[3]+e[4]+e[5]; System.out.println("\n \n The sum is" +sum); for( p=21; p<=25; p++) { if(e[p] != 0) e[p]=e[p]/(int)sum; //I have type casted sum to get output BigDecimal bd1 = new BigDecimal(e[p]); bd1 = bd1.setScale(decimalPlaces, BigDecimal.ROUND_HALF_UP); // setScale is immutable e[p] = bd1.intValue(); System.out.println("\n\n The normalized value is" +e[p]); mat[4][p-21]=e[p]; } } catch (SQLException s){ System.out.println("SQL statement is not executed!"); } } catch (Exception e1){ e1.printStackTrace(); } } } I have a table named consumer1.After calculating the sum i am getting the values as follows mysql select Service_ID,sum(consumer_feedback) from consumer1 group by Service_ ID; Service_ID sum(consumer_feedback) 31 17 32 0 33 60 34 38 35 | 38 In my program I am getting the sum for each Service_ID correctly.But,after normalization ie while I am calculating 17/153=0.111 I am getting the normalized value is 0.I want the normalized values to be displayed correctly after rounding off.My output is as follows C:javac Testd1.java C:java Testd1 Sum of the specific column! 31 17 32 0 33 60 34 38 35 38 The sum is153.0 The normalized value is0 The normalized value is0 The normalized value is0 The normalized value is0 The normalized value is0 But,after normalization i want to get 17/153=0.111 I am getting the normalized value is 0.I want these values to be rounded off.

    Read the article

  • Nginx no longer servers uwsgi application behind HAProxy - Looks for static file instead

    - by Ralph
    We implemented our web application using web2py. It consists of several modules offering a REST API at various resources (e.g. /dids, /replicas, ...). The API is used by clients implementing requests.py. My problem is that our web app works fine if it's behind HAProxy and hosted by Apache using mod_wsgi. It also works fine if the clients interact with nginx directly. It doesn't work though when using HAProxy in front of nginx. My guess is that HAProxy somehow modifies the request and thus nginx behaves differently i.e. looking for a static file instead of calling the WSGI container. Unfortunately I can't figure out what's exactly going (wr)on(g). Here are the relevant config sections of these three component's config files. At least I guess they are interesting. If you miss anything, please let me know. 1) haproxy.conf frontend app-lb bind loadbalancer:443 ssl crt /etc/grid-security/hostcertkey.pem default_backend nginx-servers mode http backend nginx-servers balance leastconn option forwardfor server nginx-01 nginx-server-int-01.domain.com:80 check 2) nginx.conf: sendfile off; #tcp_nopush on; keepalive_timeout 65; include /etc/nginx/conf.d/*.conf; server { server_name nginx-server-int-01.domain.com; root /path/to/app/; location / { uwsgi_pass unix:///tmp/app.sock; include uwsgi_params; uwsgi_read_timeout 600; # Requests can run for a serious long time } 3) uwsgi.ini [uwsgi] chdir = /path/to/app/ chmod-socket = 777 no-default-app = True socket = /tmp/app.sock manage-script-name = True mount = /dids=did.py mount = /replicas=replica.py callable = application Now when I let my clients go against nginx-server-int-01.domain.com everything is fine. In the access.log of nginx lines like these are appearing: 128.142.XXX.XX0 - - [23/Aug/2014:01:29:20 +0200] "POST /dids/attachments HTTP/1.1" 201 17 "-" "python-requests/2.3.0 CPython/2.6.6 Linux/2.6.32-358.23.2.el6.x86_64" "-" 128.142.XXX.XX0 - - [23/Aug/2014:01:29:20 +0200] "POST /dids/attachments HTTP/1.1" 201 17 "-" "python-requests/2.3.0 CPython/2.6.6 Linux/2.6.32-358.23.2.el6.x86_64" "-" 128.142.XXX.XX0 - - [23/Aug/2014:01:29:20 +0200] "POST /dids/user.ogueta/cnt_mc12_8TeV.16304.stream_name_too_long.other.notype.004202218365415e990b9997ea859f20.user/dids HTTP/1.1" 201 17 "-" "python-requests/2.3.0 CPython/2.6.6 Linux/2.6.32-358.23.2.el6.x86_64" "-" 128.142.XXX.XX0 - - [23/Aug/2014:01:29:20 +0200] "POST /replicas/list HTTP/1.1" 200 5282 "-" "python-requests/2.3.0 CPython/2.6.6 Linux/2.6.32-358.23.2.el6.x86_64" "-" 128.142.XXX.XX0 - - [23/Aug/2014:01:29:20 +0200] "POST /replicas/list HTTP/1.1" 200 5094 "-" "python-requests/2.3.0 CPython/2.6.6 Linux/2.6.32-358.23.2.el6.x86_64" "-" 128.142.XXX.XX0 - - [23/Aug/2014:01:29:20 +0200] "POST /replicas/list HTTP/1.1" 200 528 "-" "python-requests/2.3.0 CPython/2.6.6 Linux/2.6.32-358.23.2.el6.x86_64" "-" 128.142.XXX.XX0 - - [23/Aug/2014:01:29:21 +0200] "GET /dids/mc13_14TeV/dids/search?project=mc13_14TeV&stream_name=%2Adummy&type=dataset&datatype=NTUP_SMDYMUMU HTTP/1.1" 401 73 "-" "python-requests/2.3.0 CPython/2.6.6 Linux/2.6.32-358.23.2.el6.x86_64" "-" 128.142.XXX.XX0 - - [23/Aug/2014:01:29:21 +0200] "POST /replicas/list HTTP/1.1" 200 713 "-" "python-requests/2.3.0 CPython/2.6.6 Linux/2.6.32-358.23.2.el6.x86_64" "-" 128.142.XXX.XX0 - - [23/Aug/2014:01:29:21 +0200] "POST /dids/attachments HTTP/1.1" 201 17 "-" "python-requests/2.3.0 CPython/2.6.6 Linux/2.6.32-358.23.2.el6.x86_64" "-" But when I switch the clients to go against HAProxy (loadbalancer.domain.com:443), the error.log of nginx shows lines like these: 2014/08/23 01:26:01 [error] 1705#0: *21231 open() "/usr/share/nginx/html/dids/attachments" failed (2: No such file or directory), client: 128.142.XXX.XX1, server: localhost, request: "POST /dids/attachments HTTP/1.1", host: "loadbalancer.domain.com" 2014/08/23 01:26:02 [error] 1705#0: *21232 open() "/usr/share/nginx/html/replicas/list" failed (2: No such file or directory), client: 128.142.XXX.XX1, server: localhost, request: "POST /replicas/list HTTP/1.1", host: "loadbalancer.domain.com" 2014/08/23 01:26:02 [error] 1705#0: *21233 open() "/usr/share/nginx/html/dids/attachments" failed (2: No such file or directory), client: 128.142.XXX.XX1, server: localhost, request: "POST /dids/attachments HTTP/1.1", host: "loadbalancer.domain.com" 2014/08/23 01:26:02 [error] 1705#0: *21234 open() "/usr/share/nginx/html/replicas/list" failed (2: No such file or directory), client: 128.142.XXX.XX1, server: localhost, request: "POST /replicas/list HTTP/1.1", host: "loadbalancer.domain.com" 2014/08/23 01:26:02 [error] 1705#0: *21235 open() "/usr/share/nginx/html/dids/attachments" failed (2: No such file or directory), client: 128.142.XXX.XXX, server: localhost, request: "POST /dids/attachments HTTP/1.1", host: "loadbalancer" 2014/08/23 01:26:02 [error] 1705#0: *21238 open() "/usr/share/nginx/html/replicas/list" failed (2: No such file or directory), client: 128.142.XXX.XXX, server: localhost, request: "POST /replicas/list HTTP/1.1", host: "loadbalancer.domain.com" 2014/08/23 01:26:02 [error] 1705#0: *21239 open() "/usr/share/nginx/html/dids/attachments" failed (2: No such file or directory), client: 128.142.XXX.XXX, server: localhost, request: "POST /dids/attachments HTTP/1.1", host: "loadbalancer.domain.com" 2014/08/23 01:26:02 [error] 1705#0: *21242 open() "/usr/share/nginx/html/replicas/list" failed (2: No such file or directory), client: 128.142.XXX.XXX, server: localhost, request: "POST /replicas/list HTTP/1.1", host: "loadbalancer.domain.com" 2014/08/23 01:26:02 [error] 1705#0: *21244 open() "/usr/share/nginx/html/dids/attachments" failed (2: No such file or directory), client: 128.142.XXX.XXX, server: localhost, request: "POST /dids/attachments HTTP/1.1", host: "loadbalancer.domain.com" As you can see, that request looks the same, only the client IP changed, from the client's host to the one from loadbalancer.domain.com. But due to what ever reasons ngxin seems to assume that it is a static file to be served which eventually results in the file not found message. I searched the web for multiple hours already, but without much luck so far. Any help is very much appreciated. Cheers, Ralph

    Read the article

  • Which versions of C++ redistributables can I remove?

    - by Marnix
    I have a number of Microsoft Visual C++ 2005 and 2008 Redistributable and I would like to know which ones are safe to remove, because there are actually more than 10 installed on my computers. Microsoft Visual C++ 2005 ATL Update kb973923 - x64 8.0.50727.4053 Microsoft Visual C++ 2005 Redistributable Microsoft Visual C++ 2005 (x64) Microsoft Visual C++ 2008 ATL Update kb973924 - x64 9.0.30729.4148 Microsoft Visual C++ 2008 Redistributable - x64 9.0.30729.17 Microsoft Visual C++ 2008 Redistributable - x86 9.0.30729.17 Microsoft Visual C++ 2008 Redistributable - x86 9.0.30729.4148 Microsoft Visual C++ 2008 Redistributable - x86 9.0.30729.4974 Microsoft Visual C++ 2010 x64 Runtime - 10.0.30319 It could be that these versions are all different, but a confirmation of that is fine for me as well. Thanks in advance. PS. I'm using an x64 machine one windows 7.

    Read the article

  • Tab stacking in Firefox

    - by Meghan
    I often use multiple tabs (30 or more). Since I upgraded to Firefox 17, the addon that I had been using to allow tab stacking is no longer compatible. (I believe Tab Mix Plus was the add-on). I'm not interested in changing the color of my tabs or having them listed down the left side of my window. I'd like to have them all along the top of the window in rows. Does anyone know an add-on compatible with Firefox 17?

    Read the article

  • apc.stat causes 500 internal server error

    - by Legit
    When I turn off apc.stat it causes a 500 internal server error. I checked the apache error_log and it's something about: [Tue Jun 26 10:02:59 2012] [error] [client 127.0.0.1] PHP Warning: require(): Filename cannot be empty in /var/www/site1/public/index.php on line 17 [Tue Jun 26 10:02:59 2012] [error] [client 127.0.0.1] PHP Fatal error: require(): Failed opening required '' (include_path='.:/usr/share/pear:/usr/share/php') in /var/www/site1/public/index.php on line 17 I checked that line and here's what it contains: require('./wp-blog-header.php'); I don't see anything wrong with it. Here's my current APC config: APC version: 3.1.10 PHP Version: 5.4.4 How do I resolve this error when i disable apc.stat?

    Read the article

  • SVN Server not responding

    - by Rob Forrest
    I've been bashing my head against a wall with this one all day and I would greatly appreciate a few more eyes on the problem at hand. We have an in-house SVN Server that contains all live and development code for our website. Our live server can connect to this and get updates from the repository. This was all working fine until we migrated the SVN Server from a physical machine to a vSphere VM. Now, for some reason that continues to fathom me, we can no longer connect to the SVN Server. The SVN Server runs CentOS 6.2, Apache and SVN 1.7.2. SELinux is well and trully disabled and the problem remains when iptables is stopped. Our production server does run an older version of CentOS and SVN but the same system worked previously so I don't think that this is the issue. Of note, if I have iptables enabled, using service iptables status, I can see a single packet coming in and being accepted but the production server simply hangs on any svn command. If I give up waiting and do a CTRL-C to break the process I get a "could not connect to server". To me it appears to be something to do with the SVN Server rejecting external connections but I have no idea how this would happen. Any thoughts on what I can try from here? Thanks, Rob Edit: Network topology Production server sits externally to our in-house SVN server. Our IPCop (?) firewall allows connections from it (and it alone) on port 80 and passes the connection to the SVN Server. The hardware is all pretty decent and I don't doubt that its doing its job correctly, especially as iptables is seeing the new connections. subversion.conf (in /etc/httpd/conf.d) LoadModule dav_svn_module modules/mod_dav_svn.so <Location /repos> DAV svn SVNPath /var/svn/repos <LimitExcept PROPFIND OPTIONS REPORT> AuthType Basic AuthName "SVN Server" AuthUserFile /var/svn/svn-auth Require valid-user </LimitExcept> </Location> ifconfig eth0 Link encap:Ethernet HWaddr 00:0C:29:5F:C8:3A inet addr:172.16.0.14 Bcast:172.16.0.255 Mask:255.255.255.0 inet6 addr: fe80::20c:29ff:fe5f:c83a/64 Scope:Link UP BROADCAST RUNNING MULTICAST MTU:1500 Metric:1 RX packets:32317 errors:0 dropped:0 overruns:0 frame:0 TX packets:632 errors:0 dropped:0 overruns:0 carrier:0 collisions:0 txqueuelen:1000 RX bytes:2544036 (2.4 MiB) TX bytes:143207 (139.8 KiB) netstat -lntp Active Internet connections (only servers) Proto Recv-Q Send-Q Local Address Foreign Address State PID/Program name tcp 0 0 0.0.0.0:3306 0.0.0.0:* LISTEN 1484/mysqld tcp 0 0 0.0.0.0:111 0.0.0.0:* LISTEN 1135/rpcbind tcp 0 0 0.0.0.0:22 0.0.0.0:* LISTEN 1351/sshd tcp 0 0 127.0.0.1:631 0.0.0.0:* LISTEN 1230/cupsd tcp 0 0 127.0.0.1:25 0.0.0.0:* LISTEN 1575/master tcp 0 0 0.0.0.0:58401 0.0.0.0:* LISTEN 1153/rpc.statd tcp 0 0 0.0.0.0:5672 0.0.0.0:* LISTEN 1626/qpidd tcp 0 0 :::139 :::* LISTEN 1678/smbd tcp 0 0 :::111 :::* LISTEN 1135/rpcbind tcp 0 0 :::80 :::* LISTEN 1615/httpd tcp 0 0 :::22 :::* LISTEN 1351/sshd tcp 0 0 ::1:631 :::* LISTEN 1230/cupsd tcp 0 0 ::1:25 :::* LISTEN 1575/master tcp 0 0 :::445 :::* LISTEN 1678/smbd tcp 0 0 :::56799 :::* LISTEN 1153/rpc.statd iptables --list -v -n (when iptables is stopped) Chain INPUT (policy ACCEPT 0 packets, 0 bytes) pkts bytes target prot opt in out source destination Chain FORWARD (policy ACCEPT 0 packets, 0 bytes) pkts bytes target prot opt in out source destination Chain OUTPUT (policy ACCEPT 0 packets, 0 bytes) pkts bytes target prot opt in out source destination iptables --list -v -n (when iptables is running, after one attempted svn connection) Chain INPUT (policy ACCEPT 68 packets, 6561 bytes) pkts bytes target prot opt in out source destination 19 1304 ACCEPT all -- * * 0.0.0.0/0 0.0.0.0/0 state RELATED,ESTABLISHED 0 0 ACCEPT icmp -- * * 0.0.0.0/0 0.0.0.0/0 0 0 ACCEPT all -- lo * 0.0.0.0/0 0.0.0.0/0 0 0 ACCEPT tcp -- * * 0.0.0.0/0 0.0.0.0/0 state NEW tcp dpt:22 1 60 ACCEPT tcp -- * * 0.0.0.0/0 0.0.0.0/0 state NEW tcp dpt:80 0 0 ACCEPT tcp -- * * 0.0.0.0/0 0.0.0.0/0 state NEW tcp dpt:80 0 0 ACCEPT udp -- * * 0.0.0.0/0 0.0.0.0/0 state NEW udp dpt:80 Chain FORWARD (policy ACCEPT 0 packets, 0 bytes) pkts bytes target prot opt in out source destination Chain OUTPUT (policy ACCEPT 17 packets, 1612 bytes) pkts bytes target prot opt in out source destination tcpdump 17:08:18.455114 IP 'production server'.43255 > 'svn server'.local.http: Flags [S], seq 3200354543, win 5840, options [mss 1380,sackOK,TS val 2011458346 ecr 0,nop,wscale 7], length 0 17:08:18.455169 IP 'svn server'.local.http > 'production server'.43255: Flags [S.], seq 629885453, ack 3200354544, win 14480, options [mss 1460,sackOK,TS val 816478 ecr 2011449346,nop,wscale 7], length 0 17:08:19.655317 IP 'svn server'.local.http > 'production server'k.43255: Flags [S.], seq 629885453, ack 3200354544, win 14480, options [mss 1460,sackOK,TS val 817679 ecr 2011449346,nop,wscale 7], length 0

    Read the article

  • Configure TCP/IP to use DHCP and a Static IP Address at the Same Time

    - by Tiago
    My computer is configured to obtain a IP address automatically using DHCP. It only has one network adapter. How to configure an additional static IP address? I found a tutorial for Windows XP, but the procedure didn't work for Windows 7. Is it possible to configure two IP addresses on Windows 7, one being static e another being dynamic? How? The dynamic address I got now is 10.17.11.162. The static IP is 10.17.30.19. The network mask is the same: 255.255.224.0. Both work independently, but I don't know how to use both at the same time.

    Read the article

  • Building boost 1.42 on FreeBSD 6.3

    - by Ivan Perekluyev
    Hi, i need to build mapnik on freebsd 6.3, but port marked as 'broken', so i forced to build it from source. With boost 1.41 (which is in ports) mapnik doesn't build. somewhere in internet, i found that mapnik successfully builded with boost 1.42. So, i download patch from wiki.freebsd.org/BoostPortingProject andd apply it: wget http://alexanderchuranov.com/boost-port/boost-from-1.41-to-1.42-2010-02-16-17-11.diff cd /usr/ports patch -p0 -i ~/boost-from-1.41-to-1.42-2010-02-16-17-11.diff after that, i trying to install boost-all metaport, but its failed. cd devel/boost-all make install 2>&1 | tee build.log tail -n 100 build.log > short_build.log Build.log (attention, 5m !): dl.dropbox.com/u/7365614/build.log Short build log: http://paste.pocoo.org/show/224474/ Thanks!

    Read the article

  • iptables drop packet by hex string match

    - by Flint
    I got this packet captured with tcpdump but I'm not sure how to use the --hex-string param to match the packet. Can someone show me how to do it? 11:18:26.614537 IP (tos 0x0, ttl 17, id 19245, offset 0, flags [DF], proto UDP (17), length 37) x.x.187.207.1234 > x.x.152.202.6543: [no cksum] UDP, length 9 0x0000: f46d 0425 b202 000a b853 22cc 0800 4500 .m.%.....S"...E. 0x0010: 0025 4b2d 4000 1111 0442 5ebe bbcf 6701 .%[email protected]^...g. 0x0020: 98ca 697d 6989 0011 0000 ffff ffff 5630 ..i}i.........V0 0x0030: 3230 3300 0000 0000 0000 0000 203.........

    Read the article

  • Build and migrated to software raid (mdadm) on GPT disk, now can't assemble array

    - by John H
    mdadm, gpt issues, unrecognized partitions. Simplified question: How do I get mdadm to recognize GPT partitions? I have been attempting to convert/copy my Ubuntu 11.10 OS from a single drive to software raid 1. I have done similar in the past, but in this case, I was adding in a drive that has been configured for GPT and I tried to work with that without fully looking into the implications. Currently, I have a non-booting mdadm RAID 1 array of /dev/md127 (the OS assigned that and it keeps picking up). I am booting off of live USB keys, currently System Rescue CD from sysresccd. While gdisk and parted can see all the partitions, most of the OS utilities do not, including mdadm. My main goal is just to make the raid array accessible so I can get pull the data and start fresh (without using GPT). /dev/md127 /dev/sda /dev/sda1 <- GPT type partition /dev/sda1 <- exists within the GPT part, member of md127 /dev/sda2 <- exists within the GPT part, empty /dev/sdb /dev/sdb1 <- GPT type partition /dev/sdb1 <- exists within the GPT part, member of md127 History: POINT A: The original OS was install on sda (actually /dev/sda6). I used a the Ubuntu live usb to add sdb. I got warning from fdisk about GPT so I used gdisk to create a raid partition (sdb1) and mdadm to create a raid1 mirror with a missing drive. I had many issues getting this working (including being unable to get grub to install) but I eventually got it to boot using grub on sda and /dev/md127 off of sdb. So at point A, I had copied my OS from sda6 to md127 on sdb. I then booted into a rescue mode and attempted to get a bootloader onto sdb, which failed. I then discovered my mistake: I had installed the raid onto sdb instead of sdb1, essentially overwriting the sdb1 partition. POINT B: I now had two copies of my data- one on md127/sdb, and one on sda. I destroyed data on sda and created a new GPT table on sda. I then created sda1 for the raid array, and sda2 for a scratch partition. I added sda1 into the raid array and let it rebuild. md127 now covered /dev/sdb and /dev/sda1 as fully active and synced. POINT C: I rebooted onto linux rescue again and was still able to access the raid array. I then removed /dev/sdb from the array and created /dev/sdb1 for the raid. I added sdb1 to the array and let it sync. I was able to mount and access /dev/md127 without issues. Once it completed, both /dev/sda1 and /dev/sdb1 were GPT partitions and actively syncing. POINT D (current): I rebooted again to test if the array would boot and grub failed to load. I booted off of my live thumb drive and found that I can no longer assemble the raid array. mdadm doesn't see the required partitions. -- root@freshdesk /root % uname -a Linux freshdesk 3.0.24-std251-amd64 #2 SMP Sat Mar 17 12:08:55 UTC 2012 x86_64 AMD Athlon(tm) II X4 645 Processor AuthenticAMD GNU/Linux === /proc/partitions and parted look good: root@freshdesk /root % cat /proc/partitions major minor #blocks name 7 0 301788 loop0 8 0 976762584 sda 8 1 732579840 sda1 8 2 244181703 sda2 8 16 732574584 sdb 8 17 732573543 sdb1 8 32 7876607 sdc 8 33 7873349 sdc1 (parted) print all Model: ATA ST31000528AS (scsi) Disk /dev/sda: 1000GB Sector size (logical/physical): 512B/512B Partition Table: gpt Number Start End Size File system Name Flags 1 1049kB 750GB 750GB ext4 2 750GB 1000GB 250GB Linux/Windows data Model: ATA SAMSUNG HD753LJ (scsi) Disk /dev/sdb: 750GB Sector size (logical/physical): 512B/512B Partition Table: gpt Number Start End Size File system Name Flags 1 1049kB 750GB 750GB ext4 Linux RAID raid Model: SanDisk SanDisk Cruzer (scsi) Disk /dev/sdc: 8066MB Sector size (logical/physical): 512B/512B Partition Table: msdos Number Start End Size Type File system Flags 1 31.7kB 8062MB 8062MB primary fat32 boot, lba === # no sda2, and I double the sdb1 is the one shown in parted root@freshdesk /root % blkid /dev/loop0: TYPE="squashfs" /dev/sda1: UUID="75dd6c2d-f0a8-4302-9da4-792cc7d72355" TYPE="ext4" /dev/sdc1: LABEL="PENDRIVE" UUID="1102-3720" TYPE="vfat" /dev/sdb1: UUID="2dd89f15-65bb-ff88-e368-bf24bd0fce41" TYPE="linux_raid_member" root@freshdesk /root % mdadm -E /dev/sda1 mdadm: No md superblock detected on /dev/sda1. # this is probably a result of me attempting to force the array up, putting superblocks on the GPT partition root@freshdesk /root % mdadm -E /dev/sdb1 /dev/sdb1: Magic : a92b4efc Version : 0.90.00 UUID : 2dd89f15:65bbff88:e368bf24:bd0fce41 Creation Time : Fri Mar 30 19:25:30 2012 Raid Level : raid1 Used Dev Size : 732568320 (698.63 GiB 750.15 GB) Array Size : 732568320 (698.63 GiB 750.15 GB) Raid Devices : 2 Total Devices : 2 Preferred Minor : 127 Update Time : Sat Mar 31 12:39:38 2012 State : clean Active Devices : 1 Working Devices : 2 Failed Devices : 1 Spare Devices : 1 Checksum : a7d038b3 - correct Events : 20195 Number Major Minor RaidDevice State this 2 8 17 2 spare /dev/sdb1 0 0 8 1 0 active sync /dev/sda1 1 1 0 0 1 faulty removed 2 2 8 17 2 spare /dev/sdb1 === root@freshdesk /root % mdadm -A /dev/md127 /dev/sda1 /dev/sdb1 mdadm: no recogniseable superblock on /dev/sda1 mdadm: /dev/sda1 has no superblock - assembly aborted root@freshdesk /root % mdadm -A /dev/md127 /dev/sdb1 mdadm: cannot open device /dev/sdb1: Device or resource busy mdadm: /dev/sdb1 has no superblock - assembly aborted

    Read the article

  • Excel trendline accuracy

    - by Rook
    This is a problem I have every once in a while, and it annoys me tremendously, beacuse I have always to recheck every trendline I get. An example: r L (mm) 30,00 97,0 60,00 103,2 90,00 106,0 110,00 101,0 125,00 88,0 140,00 62,0 148,00 36,7 152,50 17,0 Upon drawing a trendline (using 3rd order polynomial regression type) with r on the x axis, and L on the y one, Excel will give the formula y = -0,0002x³ + 0,0341x² - 1,8979x + 128,73 with R² = 0,994. If I interpolate values using that formula for the same values of r as the ones the formula was derived from, I get r y (mm) 30,00 97,083 60,00 94,416 90,00 88,329 110,00 66,371 125,00 33,68 140,00 -17,416 148,00 -53,5912 152,50 -76,97725 which are quite different? Why does this happen? What is the reason for it?

    Read the article

  • syslog ip ranges to specific files using `rsyslog`

    - by Mike Pennington
    I have many Cisco / JunOS routers and switches that send logs to my Debian server, which uses rsyslogd. How can I configure rsyslogd to send these router / switch logs to a specific file, based on their source IP address? I do not want to pollute general system logs with these entries. For instance: all routers in Chicago (source ip block: 172.17.25.0/24) to only log to /var/log/net/chicago. all routers in Dallas (source ip block 172.17.27.0/24) to only log to /var/log/net/dallas. Finally, these logs should be rotated daily for up to 30 days and compressed. NOTE: I am answering my own question

    Read the article

  • NFS share access - Permission denied

    - by rgngl
    I'm trying to share a directory on my NAS device(WD Mybook WE) with NFS to another machine on my local network. The directory on the NAS device looks like this: drwxr-x--- 15 git git 4096 Nov 17 01:05 git/ And id's of the user git on the NAS device is like this: [root@myhost DataVolume]# id git uid=505(git) gid=505(git) I played with many different parameters in the /etc/exports file and this is what I got there currently: /DataVolume/git 192.168.0.20(async,rw,no_root_squash,no_subtree_check) On the client side I have the user git and group git with the same id's to match the ones on the server. user@myclient:~$ id git uid=505(git) gid=505(git) groups=505(git) I mount the directory with: sudo mount myhost:/DataVolume/git -t nfs git/ and the mounted directory looks like: drwxr-x--- 15 git git 4096 Nov 17 01:05 git After these steps I can't seem to cd to that directory with any user, including git and root. I am getting a Permission denied error. Thanks in advance for any help.

    Read the article

  • Xen 4.1 host (dom0) with blktap disks ("tap:aio:") not connecting

    - by Manwe
    Problem using blktap with xen-4.1 running Ubuntu Precise stock kernel with dom0 xen-4.1. I get: [ 5.580106] XENBUS: Waiting for devices to initialise: 295s...290s. ... [ 300.580288] XENBUS: Timeout connecting to device: device/vbd/51713 (local state 3, remote state 1) And some syslog lines: May 17 13:07:30 localhost logger: /etc/xen/scripts/blktap: add XENBUS_PATH=backend/tap/10/51713 May 17 13:07:31 localhost logger: /etc/xen/scripts/blktap: Writing backend/tap/10/51713/hotplug-status connected to xenstore. with tap:aio: disk lines. file:/ works. disk = [ 'tap:aio:/data/root.img,xvda1,w', ] Problem exists with lucid and precises domU kernels and both guests work in Ubuntu hardy dom0 Host 64bit 2.6.24-28-xen xen-3.3 3.2.0-24-generic #37-Ubuntu SMP Wed Apr 25 08:43:22 UTC 2012 x86_64 x86_64 x86_64 GNU/Linux Distributor ID: Ubuntu Description: Ubuntu 12.04 LTS Release: 12.04 Codename: precise

    Read the article

  • Can't access network share with name defined in hosts file

    - by Einar Egilsson
    I have a network share on a machine that I can only reach by IP address. I then defined an alias for the IP in my hosts file so I could use that instead of the IP but then I can't log on to the share, I just get the logon prompt again and again. So basically this: \\172.17.0.48\SomeShare works but this \\myalias\SomeShare doesn't. myalias is defined in c:\windows\system32\drivers\etc\hosts as 172.17.0.48 myalias And I can use the alias for remote desktop without problems. Can anyone tell me why this doesn't work for fileshares?

    Read the article

  • Backup virtual hard disk

    - by Harshil Sharma
    I have a VM created in VMWare Player. It's VHD is currently sized 17 GB, split among multiple 2 GB files. The host OS is Windows 8. I use CrashPlan in host OS for file backup. The problem is, whenever I use the VM, CrashPlan detects all parth of VHD as altered and backs up the 17 GB VHD. WHat I want is a software that can run on host OS (Windows 8), treat the VHD as a physical hard disk and create incremental backups of the VHD, includeing all files, programs and the OS

    Read the article

  • Apache returns 403 Forbidden for alternative port vhost

    - by Wesley
    I'm having an issue getting vhosts to work on Apache 2.2, Debian 6. I have two VirtualHosts, one on port 80 and one on port 8888. The port 80 one has been created automatically by DirectAdmin, the 8888 is a custom one. It's configuration is as follows. <VirtualHost *:8888 > DocumentRoot /home/user/public_html/development ServerName www.myserver.nl ServerAlias myserver.nl <Directory "/home/user/public_html/development"> Options +Indexes +FollowSymLinks +MultiViews AllowOverride All Order Allow,deny Allow from all </Directory> </VirtualHost> Of course I also have a NameVirtualHost *:8888 The port 80 DocumentRoot is /home/user/public_html/production, which is perfectly accessible and works like a charm. The port 8888 docroot of /home/user/public_html/development is 403 forbidden though. I have compared the permissions for both folders. They seem fine to me. drwxr-xr-x 2 root root 4096 Aug 17 16:14 development drwxr-xr-x 4 root root 4096 Aug 18 04:29 production Also, the index.php file which is supposed to display when accessing through port 8888, located in /development/: -rwxr-xr-x 1 root root 41 Aug 17 16:14 index.html I have looked at my error_log and found many of the following entries, only being added to the log file when accessing through port 8888. [Sat Aug 18 04:35:09 2012] [error] [client 27.32.156.232] Symbolic link not allowed or link target not accessible: /home/user/public_html /home/user/public_html is a symbolic link that refers to /home/user/domains/mydomain/public_html. The symbolic link has the following permissions: lrwxrwxrwx 1 admin admin 29 Aug 17 15:56 public_html -> ./domains/mydomain/public_html I'm at a loss. It seems that everything is readable or executable. I've set the Directory to FollowSymLinks in the httpd.conf file, but that doesn't seem to make a difference. If I change that directory tag to <Directory "/home/admin/public_html"> (so it has FollowSymLinks on that as well) it still does not work. Any help is greatly appreciated. If I need to post more information, let me know. I'm pretty much a beginner at this stuff. .. .. UPDATE: I ended up changing the configuration to directly go to the actual path of the files, avoiding the public_html symlink altogether. That worked. Thanks for the suggestions folks. DocumentRoot /home/user/domains/mydomain/public_html/development instead of DocumentRoot /home/user/public_html/development

    Read the article

  • Error in eclipse on run android project

    - by Larz
    I am trying to get a simple hello world android project working in eclipse using an android emulator. I have been using the examples on developer.android.com. I actually did have a hello world app working. I then modified it's xml files to have a text input field and a button as in the second example shows on that site. This failed to run on the emulator. I then went back and tried to create another simple hello world project, but it fails to run. The console says "Waiting for HOME ('android.process.acore') to be launched, but nothing happens or sometimes a messenger in the emulator says "unfortunately Android Wear has stopped". Below is a sample error filter on the log file. I find trying to debug this is something new to me and I am not sure the best way to go about it. I am just trying to learn some basic android developer skills. 05-30 16:19:07.336: E/SELinux(469): SELinux: Loaded file_contexts from /file_contexts, 05-30 16:19:07.336: E/SELinux(469): digest= 05-30 16:19:07.376: E/SELinux(469): b0 05-30 16:19:07.376: E/SELinux(469): 4b 05-30 16:19:07.756: E/SELinux(469): 03 05-30 16:19:07.756: E/SELinux(469): 4a 05-30 16:19:07.826: E/SELinux(469): 73 05-30 16:19:07.886: E/SELinux(469): ab 05-30 16:19:07.886: E/SELinux(469): 6d 05-30 16:19:07.896: E/SELinux(469): 46 05-30 16:19:07.896: E/SELinux(469): b4 05-30 16:19:07.896: E/SELinux(469): a5 05-30 16:19:07.896: E/SELinux(469): 73 05-30 16:19:07.896: E/SELinux(469): 8a 05-30 16:19:07.896: E/SELinux(469): ee 05-30 16:19:07.896: E/SELinux(469): ac 05-30 16:19:07.906: E/SELinux(469): 68 05-30 16:19:07.906: E/SELinux(469): ff 05-30 16:19:07.906: E/SELinux(469): 04 05-30 16:19:07.906: E/SELinux(469): dc 05-30 16:19:07.906: E/SELinux(469): b8 05-30 16:19:07.906: E/SELinux(469): a2 05-30 16:19:11.806: E/SensorManager(511): sensor or listener is null 05-30 16:19:16.196: E/BluetoothAdapter(378): Bluetooth binder is null 05-30 16:19:16.206: E/BluetoothAdapter(378): Bluetooth binder is null 05-30 16:19:17.186: E/WVMExtractor(54): Failed to open libwvm.so: dlopen failed: library "libwvm.so" not found 05-30 16:19:17.776: E/AudioCache(54): Error 1, -2147483648 occurred 05-30 16:19:17.796: E/SoundPool(378): Unable to load sample: (null) 05-30 16:19:18.536: E/AudioCache(54): Error 1, -2147483648 occurred 05-30 16:19:18.546: E/SoundPool(378): Unable to load sample: (null)

    Read the article

  • Updating ATI HD 5970 Graphics card - version errors?

    - by user55406
    I'm having an issue...My system specs is: Intel i7 960 6GM Corair XMS RAM ATI HD5970 graphics card Intel dx58so motherboard Cooler Master HAF 922 case 1.5TB Seagate hard drive Windows Vista x86 (32-bit). Here is my issue: when I go to AMD/ATI website to update my graphics card - it doesn't. when I type DxDiag and then click on display it tell me my version is 8.17.0 and its on 10.10.0 for the latest version. How can I get 8.17.0 too 10.10.0? I figure it would have done that after I updated the driver for my graphics card. Thanks.

    Read the article

  • How to copy symbolic links?

    - by Basilevs
    I have directory that contains some symbolic links: user@host:include$ find .. -type l -ls 4737414 0 lrwxrwxrwx 1 user group 13 Dec 9 13:47 ../k0607-lsi6/camac -> ../../include 4737415 0 lrwxrwxrwx 1 user group 14 Dec 9 13:49 ../k0607-lsi6/linux -> ../../../linux 4737417 0 lrwxrwxrwx 1 user group 12 Dec 9 13:57 ../k0607-lsi6/dfc -> ../../../dfc 4737419 0 lrwxrwxrwx 1 user group 17 Dec 9 13:57 ../k0607-lsi6/dfcommon -> ../../../dfcommon 4737420 0 lrwxrwxrwx 1 user group 19 Dec 9 13:57 ../k0607-lsi6/dfcommonxx -> ../../../dfcommonxx 4737421 0 lrwxrwxrwx 1 user group 17 Dec 9 13:57 ../k0607-lsi6/dfcompat -> ../../../dfcompat I need to copy them to the current directory. The resulting links should be independent from their prototypes and lead directly to their target objects. cp -s creates links to links that is not appropriate behavior. cp -s -L refuses to copy links to directories cp -s -L -r refuses to copy relative links to non-working directory What should I do?

    Read the article

  • e2fsck extremly slow, although enough memory exists

    - by kaefert
    I've got this external USB-Disk: kaefert@blechmobil:~$ lsusb -s 2:3 Bus 002 Device 003: ID 0bc2:3320 Seagate RSS LLC As can be seen in this dmesg output, there are some problems that prevents that disk from beeing mounted: kaefert@blechmobil:~$ dmesg | grep sdb [ 114.474342] sd 5:0:0:0: [sdb] 732566645 4096-byte logical blocks: (3.00 TB/2.72 TiB) [ 114.475089] sd 5:0:0:0: [sdb] Write Protect is off [ 114.475092] sd 5:0:0:0: [sdb] Mode Sense: 43 00 00 00 [ 114.475959] sd 5:0:0:0: [sdb] Write cache: enabled, read cache: enabled, doesn't support DPO or FUA [ 114.477093] sd 5:0:0:0: [sdb] 732566645 4096-byte logical blocks: (3.00 TB/2.72 TiB) [ 114.501649] sdb: sdb1 [ 114.502717] sd 5:0:0:0: [sdb] 732566645 4096-byte logical blocks: (3.00 TB/2.72 TiB) [ 114.504354] sd 5:0:0:0: [sdb] Attached SCSI disk [ 116.804408] EXT4-fs (sdb1): ext4_check_descriptors: Checksum for group 3976 failed (47397!=61519) [ 116.804413] EXT4-fs (sdb1): group descriptors corrupted! So I went and fired up my favorite partition manager - gparted, and told it to verify and repair the partition sdb1. This made gparted call e2fsck (version 1.42.4 (12-Jun-2012)) e2fsck -f -y -v /dev/sdb1 Although gparted called e2fsck with the "-v" option, sadly it doesn't show me the output of my e2fsck process (bugreport https://bugzilla.gnome.org/show_bug.cgi?id=467925 ) I started this whole thing on Sunday (2012-11-04_2200) evening, so about 48 hours ago, this is what htop says about it now (2012-11-06-1900): PID USER PRI NI VIRT RES SHR S CPU% MEM% TIME+ Command 3704 root 39 19 1560M 1166M 768 R 98.0 19.5 42h56:43 e2fsck -f -y -v /dev/sdb1 Now I found a few posts on the internet that discuss e2fsck running slow, for example: http://gparted-forum.surf4.info/viewtopic.php?id=13613 where they write that its a good idea to see if the disk is just that slow because maybe its damaged, and I think these outputs tell me that this is not the case in my case: kaefert@blechmobil:~$ sudo hdparm -tT /dev/sdb /dev/sdb: Timing cached reads: 3562 MB in 2.00 seconds = 1783.29 MB/sec Timing buffered disk reads: 82 MB in 3.01 seconds = 27.26 MB/sec kaefert@blechmobil:~$ sudo hdparm /dev/sdb /dev/sdb: multcount = 0 (off) readonly = 0 (off) readahead = 256 (on) geometry = 364801/255/63, sectors = 5860533160, start = 0 However, although I can read quickly from that disk, this disk speed doesn't seem to be used by e2fsck, considering tools like gkrellm or iotop or this: kaefert@blechmobil:~$ iostat -x Linux 3.2.0-2-amd64 (blechmobil) 2012-11-06 _x86_64_ (2 CPU) avg-cpu: %user %nice %system %iowait %steal %idle 14,24 47,81 14,63 0,95 0,00 22,37 Device: rrqm/s wrqm/s r/s w/s rkB/s wkB/s avgrq-sz avgqu-sz await r_await w_await svctm %util sda 0,59 8,29 2,42 5,14 43,17 160,17 53,75 0,30 39,80 8,72 54,42 3,95 2,99 sdb 137,54 5,48 9,23 0,20 587,07 22,73 129,35 0,07 7,70 7,51 16,18 2,17 2,04 Now I researched a little bit on how to find out what e2fsck is doing with all that processor time, and I found the tool strace, which gives me this: kaefert@blechmobil:~$ sudo strace -p3704 lseek(4, 41026998272, SEEK_SET) = 41026998272 write(4, "\212\354K[_\361\3nl\212\245\352\255jR\303\354\312Yv\334p\253r\217\265\3567\325\257\3766"..., 4096) = 4096 lseek(4, 48404766720, SEEK_SET) = 48404766720 read(4, "\7t\260\366\346\337\304\210\33\267j\35\377'\31f\372\252\ffU\317.y\211\360\36\240c\30`\34"..., 4096) = 4096 lseek(4, 41027002368, SEEK_SET) = 41027002368 write(4, "\232]7Ws\321\352\t\1@[+5\263\334\276{\343zZx\352\21\316`1\271[\202\350R`"..., 4096) = 4096 lseek(4, 48404770816, SEEK_SET) = 48404770816 read(4, "\17\362r\230\327\25\346//\210H\v\311\3237\323K\304\306\361a\223\311\324\272?\213\tq \370\24"..., 4096) = 4096 lseek(4, 41027006464, SEEK_SET) = 41027006464 write(4, "\367yy>x\216?=\324Z\305\351\376&\25\244\210\271\22\306}\276\237\370(\214\205G\262\360\257#"..., 4096) = 4096 lseek(4, 48404774912, SEEK_SET) = 48404774912 read(4, "\365\25\0\21|T\0\21}3t_\272\373\222k\r\177\303\1\201\261\221$\261B\232\3142\21U\316"..., 4096) = 4096 ^CProcess 3704 detached around 16 of these lines every second, so 4 read and 4 write operations every second, which I don't consider to be a lot.. And finally, my question: Will this process ever finish? If those numbers from fseek (48404774912) represent bytes, that would be something like 45 gigabytes, with this beeing a 3 terrabyte disk, which would give me 134 days to go, if the speed stays constant, and he scans the disk like this completly and only once. Do you have some advice for me? I have most of the data on that disk elsewhere, but I've put a lot of hours into sorting and merging it to this disk, so I would prefer to getting this disk up and running again, without formatting it anew. I don't think that the hardware is damaged since the disk is only a few months and since I can't see any I/O errors in the dmesg output. UPDATE: I just looked at the strace output again (2012-11-06_2300), now it looks like this: lseek(4, 1419860611072, SEEK_SET) = 1419860611072 read(4, "3#\f\2447\335\0\22A\355\374\276j\204'\207|\217V|\23\245[\7VP\251\242\276\207\317:"..., 4096) = 4096 lseek(4, 43018145792, SEEK_SET) = 43018145792 write(4, "]\206\231\342Y\204-2I\362\242\344\6R\205\361\324\177\265\317C\334V\324\260\334\275t=\10F."..., 4096) = 4096 lseek(4, 1419860615168, SEEK_SET) = 1419860615168 read(4, "\262\305\314Y\367\37x\326\245\226\226\320N\333$s\34\204\311\222\7\315\236\336\300TK\337\264\236\211n"..., 4096) = 4096 lseek(4, 43018149888, SEEK_SET) = 43018149888 write(4, "\271\224m\311\224\25!I\376\16;\377\0\223H\25Yd\201Y\342\r\203\271\24eG<\202{\373V"..., 4096) = 4096 lseek(4, 1419860619264, SEEK_SET) = 1419860619264 read(4, ";d\360\177\n\346\253\210\222|\250\352T\335M\33\260\320\261\7g\222P\344H?t\240\20\2548\310"..., 4096) = 4096 lseek(4, 43018153984, SEEK_SET) = 43018153984 write(4, "\360\252j\317\310\251G\227\335{\214`\341\267\31Y\202\360\v\374\307oq\3063\217Z\223\313\36D\211"..., 4096) = 4096 So this number of the lseeks before the reads, like 1419860619264 are already a lot bigger, standing for 1.29 terabytes if the numbers are bytes, so it doesn't seem to be a linear progress on a big scale, maybe there are only some areas that need work, that have big gaps in between them. (times are in CET)

    Read the article

  • Windows 7 Boot Loader - Remove 30 second waiting time

    - by derekhh
    I've installed Fedora 17 and Windows 7 on two different hard disks as a dual-boot system. The default boot loader is GRUB 2 maintained and configured in Fedora 17. When I startup and choose "Windows 7 bootloader (on /dev/sda1)" in GRUB 2, Windows 7 boot loader will appear, with only Windows 7 as the only choice and also the default operating system, with a 30 second waiting time if no input is detected. I'm trying to see if it is possible to remove this 30-second waiting time. I've tried to follow the instructions on the Web by configuring default operating system in the control panel but seems there is something wrong with it. I've also tried to use "bcdedit enum /all" but still receives error prompts. Update: Added my boot tab screen in msconfig.

    Read the article

  • Convert text to table

    - by Quattro
    I would like convert text into a table. Here is a link to the text http://www.tcdb.org/public/tcdb Short example: >gnl|TC-DB|A0CIB0|1.A.17.3.1 Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1 MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI >gnl|TC-DB|A0CS82|9.B.82.1.5 Chromosome undetermined scaffold_26, whole genome shotgun sequence - Paramecium tetraurelia. MIIEEQIEEKMIYKAIHRVKVNYQKKIDRYILYKKSRWFFNLLLMLLYAYRIQNIGGFYI VTYIYCVYQLQLLIDYFTPLGLPPVNLEDEEEDDDQFQNDFSELPTTLSNKNELNDKEFR PLLRTTSEFKVWQKSVFSVIFAYFCTYIPIWDIPVYWPFLFCYFFVIVGMSIRKYIKHMK KYGYTILDFTKKK I wanted to have columns for example delimited with pipe | or ; |>gnl|TC-DB|A0CIB0|1.A.17.3.1| Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1| MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI I am working with Windows and I don't know how to do it I just know every row starts with > I want to substitute the first whitespace in a row with a delimiter like | or ; after the first regular expression new line in a row, I want also a delimiter everything between the regular expression first new line and > should go into a new column (it's a sequence of a protein)

    Read the article

  • Printing Booklet Page Size in Adobe Reader 4-in-1

    - by Justin Nathanael Waters
    So I have a 70 page pdf document that I'm trying to condense to a small booklet. I tried creating a formula to manually to perform it but it got ugly fast. 35,36,34,37,17,54,16,55,33,38,32,39,15,56,14,57,31,40,30,41,13,58,12,59 29,42,28,43,11,60,10,61,27,44,26,45,9,62,8,63,25,46,24,47,7,64,6,65 23,48,22,49,5,66,4,67,21,50,20,51,3,68,2,69,19,52,18,53,1,70 Once I print the booklet I should be able to cut the sheets in half and set the bottom half behind the top and staple it for a simple book. Which means Page 1 should have pages 35,36,17,54,34,37,16,55 Page 2 should have pages 33,38,15,56,32,39,14,57 And several pages later Page 9 should have pages 19,52,1,70,18,53 But manually doing this is a headache and it seems like the booklet function should contain functionality that can perform this. I'm using a commercial Konica Minolta C452

    Read the article

< Previous Page | 25 26 27 28 29 30 31 32 33 34 35 36  | Next Page >