Search Results

Search found 4119 results on 165 pages for 'bebe 17'.

Page 30/165 | < Previous Page | 26 27 28 29 30 31 32 33 34 35 36 37  | Next Page >

• Convert text to table

  - by Quattro

  I would like convert text into a table. Here is a link to the text http://www.tcdb.org/public/tcdb Short example: >gnl|TC-DB|A0CIB0|1.A.17.3.1 Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1 MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM…

  Read the article

• wireless printer - entering WPA - is there a quicker way?

  - by camcam

  I have a wireless printer (Brother DCP-585CW). The wireless setup instruction says I should enter the WPA key to the printer. The key is entered using up and down buttons on the printer. So, I am supposed to enter 64 characters using up and down buttons. To enter 1 character, it takes on average (24+10)/2 = 17 times pressing the button…

  Read the article

• PDF files are opening in Firefox, undesiredly

  - by root

  PDF files have suddenly started to open within the browser windows of Firefox 17. The PDF files are being displayed with the Adobe Acrobat plugin, which is odd, since I have explicitly disabled the Adobe Acrobat plugin in Firefox. I would like for Firefox to show the download prompt when opening a PDF file, instead. I have disabled the…

  Read the article

• Get the screen height in Android

  - by Dan Bray

  How can I get the available height of the screen in Android? I need to the height minus the status bar / menu bar or any other decorations that might be on screen and I need it to work for all devices. Also, I need to know this in the onCreate function. I know this question has been asked before but I have already tried their solutions…

  Read the article

• Is there any script to do accounting for the proftpd's xferlog?

  - by Aseques

  I would like to convert from the xferlog format that proftpd uses into per user in/out bytes, to have a summary on how much traffic does each user use per month. The exact format is this: Thu Oct 17 12:47:05 2013 1 123.123.123.123 74852 /home/vftp/doc1.txt b _ i r user ftp 0 * c Thu Oct 17 12:47:06 2013 2 123.123.123.123 86321…

  Read the article

• Best monitor for reading

  - by wajed

  Will response rate make a difference? What is good brightness? What is a good contrast ratio? Definitely there are other things to look for, so please give me your opinion. Also, what screen size is good for reading? What size would you choose from 17-22? I'm thinking of getting one 17-19 for reading, and one 22 for movies. Or…

  Read the article

• WiX 3 Tutorial: Custom EULA License and MSI localization

  - by Mladen Prajdic

  In this part of the ongoing Wix tutorial series we’ll take a look at how to localize your MSI into different languages. We’re still the mighty SuperForm: Program that takes care of all your label color needs. :) Localizing the MSI With WiX 3.0 localizing an MSI is pretty much a simple and straightforward process. First let…

  Read the article

• Java Spotlight Episode 97: Shaun Smith on JPA and EclipseLink

  - by Roger Brinkley

  Interview with Java Champion Shaun Smith on JPA and EclipseLink. Right-click or Control-click to download this MP3 file. You can also subscribe to the Java Spotlight Podcast Feed to get the latest podcast automatically. If you use iTunes you can open iTunes and subscribe with this link:  Java Spotlight Podcast in…

  Read the article

• Java Spotlight Episode 99: Daniel Blaukopf on JavaFX for Embedded Systems

  - by Roger Brinkley

  Interview with  Daniel Blaukopf on JavaFX for Embedded Systems Right-click or Control-click to download this MP3 file. You can also subscribe to the Java Spotlight Podcast Feed to get the latest podcast automatically. If you use iTunes you can open iTunes and subscribe with this link:  Java Spotlight Podcast…

  Read the article

• Java Spotlight Episode 77: Donald Smith on the OpenJDK and Java

  - by Roger Brinkley

  Tweet An interview with Donald Smith about Java and OpenJDK. Joining us this week on the Java All Star Developer Panel are Dalibor Topic, Java Free and Open Source Software Ambassador and Arun Gupta, Java EE Guy. Right-click or Control-click to download this MP3 file. You can also…

  Read the article

• Install and upgrade strategies for Oracle Enterprise Manager 12c - Upcoming Webcasts with live demos

  - by Anand Akela

  At Oracle Open World 2011, we launched the Oracle Enterprise Manager 12c , the only complete cloud management solution for your enterprise cloud. With the new release of Oracle Enterprise Manager Cloud Control 12c, the installation and upgrade process has been enhanced to provide a fast and smooth install experience.…

  Read the article

• very long boot up with Ubuntu 10.04.4

  - by wt70707

  I installed Ubuntu 10.04.3 on Atom. Then I do the update and upgrade with: #apt-get update #apt-get upgrade #apt-get dist-upgrade The system can boot up now but in almost 2 minutes. After power on and system test, it will stop at "Verifying DMI pool data" for 10 seconds before the GRUB menu comes up. Then after…

  Read the article

• DocumentDB - Another Azure NoSQL Storage Service

  - by Shaun

  Originally posted on: http://geekswithblogs.net/shaunxu/archive/2014/08/25/documentdb---another-azure-nosql-storage-service.aspxMicrosoft just released a bunch of new features for Azure on 22nd and one of them I was interested in most is DocumentDB, a document NoSQL database service on the cloud.   Quick…

  Read the article

• First Step Towards Rapid Enterprise Application Deployment

  - by Antoinette O'Sullivan

  Take Oracle VM Server for x86 training as a first step towards deploying enterprise applications rapidly. You have a choice between the following instructor-led training: Oracle VM with Oracle VM Server for x86 1-day Seminar. Take this course from your own desk on one of the 300 events on the…

  Read the article

• Global Indian Developer Summit (GIDS), JavaOne Moscow, Java Summit Chennai

  - by arungupta

  My whirlwind tour of Java EE and GlassFish starts next weekend and covers the following cities in the next 6 weeks: JavaOne and Oracle Develop, Moscow Global Indian Developer Summit, Bangalore Java Summit, Chennai JavaOne, Hyderabad OTN Developer Day, Pune OTN Developer Day, Istanbul Geecon, Poznan…

  Read the article

• Top Reasons to Take the MySQL Cluster Training

  - by Antoinette O'Sullivan

  Here are the top reasons to take the authorized MySQL Cluster training course: Take training which was developed by MySQL Cluster product team and delivered by the MySQL Cluster experts at Oracle Learn how to develop, deploy, manage and scale your MySQL Cluster applications more…

  Read the article

• Silverlight Cream for November 25, 2011 -- #1174

  - by Dave Campbell

  In this Issue: Michael Collier, Samidip Basu, Jesse Liberty, Dhananjay Kumar, and Michael Crump. Above the Fold: …

  Read the article

• Juju Openstack bundle: Can't launch an instance

  - by user281985

  Deployed bundle:~makyo/openstack/2/openstack, on top of 7 physical boxes and 3 virtual ones. After changing vip_iface strings to point to right devices, e.g., br0 instead of eth0, and defining "/mnt/loopback|30G", in Cinder's block-device string, am able to navigate through openstack…

  Read the article

• Devoxx UK JCP & Adopt-a-JSR activities

  - by Heather VanCura

  Devoxx UK starts this week!  The JCP Program is organizing many activities throughout the conference, including some tables in the Hackergarten area on 12-13 June.  Topics include Java EE, Data Grids, Java SE 8 (Lambdas and Date & Time API), Money & Currency API and…

  Read the article

• Building Publishing Pages in Code

  - by David Jacobus

  Originally posted on: http://geekswithblogs.net/djacobus/archive/2013/10/27/154478.aspxOne of the Mantras we developers try to follow: Ensure that the solution package we deliver to the client is complete.  We build Web Parts, Master Pages, Images, CSS files and other artifacts…

  Read the article

• Stuttgart 24.07. 16:30Uhr: Virtualisierung mit LDOMs in der Praxis

  - by Franz Haberhauer

  Mit einer Veranstaltung zum Thema ""Virtualisierung mit LDOMs in der Praxis" beginnen wir in der Oracle Geschäftstelle Stuttgart eine Veranstaltungsreihe Red Hardware Cafe rund um Themen aus der Praxis des Einsatzes von Oracle…

  Read the article

• How to reset display settings in XFCE \ Ubuntu 12.04 and also flgrx drivers

  - by Agent24

  I recently upgraded to Ubuntu 12.04 and since I hate unity I installed the Xubuntu package and am using XFCE instead. Since I have a Radeon HD5770 I also installed the fglrx drivers. This all went fine (aside from the fact that the post-release update fglrx drivers have an…

  Read the article

• Very slow write access to SSD disks on some Asus P8Z77 motherboards

  - by lenik

  I have Asus P8Z77-V LK motherboard, that ran Mint 13 (based on Ubuntu 12.04) just perfectly, but recently I've tried to install Mint 17 and noticed abysmal write performance. Write speed on SSD disk was about 1.5MB/sec, when it's supposed to be in 150-250MB/sec range. For…

  Read the article

• WP E Commerce Safe Mode restriction error [on hold]

  - by Mustafa Kamal

  I have my online shop, created with WP Ecommerce getting broken after I moved it to another server. I could be sure that the problem comes from WP Ecommerce because when I disable that plugin. Everything run as expected. This is the exact error message Warning:…

  Read the article

• Cannot log in to the desktop on ubuntu 11.10?

  - by Jichao

  The problem is, I could log in under the terminal, i could ifup eth0, i could do anything I want in the terminal, but if I use ctrl+alt+f7 goto the gnome login screen, after I input the correct password, the system just send me back to same login screen again. …

  Read the article

< Previous Page | 26 27 28 29 30 31 32 33 34 35 36 37  | Next Page >