Search Results

Search found 3194 results on 128 pages for 'unchecked conversion'.

Page 29/128 | < Previous Page | 25 26 27 28 29 30 31 32 33 34 35 36  | Next Page >

  • 500 MB Avi video from CD lagging/glitching when reproduced

    - by Caki Esther
    I created an extra cd with Nero Burning that contains both audio tracks (I can hear them correctly) and a .avi presentation (pretty big one, 540 MB on a 700 MB cd). The audio is fine but the problem is that when the video is played from the cd (with whatever media player: Windows Media Player, VLC, etc..) it lags/glitches/stutters. I'd like the video to be smooth, how should I burn the video to reduce this effect? I mean: what kind of compression/format and why?

    Read the article

  • convert video to images

    - by Liam
    How can I convert a video file to a sequence of images, for example one frame every N seconds. Can mplayer or ffmpeg do this? I have used MPlayer to grab screenshots manually but I would like to automate this for a long video.

    Read the article

  • Is there a good, free way to fix broken/corrupt .wmv files?

    - by chbtn
    I've recovered some files from an hdd that weren't supposed to be deleted in the first place, but they have seeking problems/crash the players. Since they have the right size, I'm thinking it might be a problem of corrupt index/header, so I'm trying to find a way to fix them. It's easy to find examples on how to fix corrupt .avi files with mencoder, but .wmv seems trickier. Also, I realize there might not be a way to fix these files, but I figure I might as well as try. As far as players go, I've tried opening it with vlc/mplayer/windows media player. I can use anything on Windows XP/7 and Ubuntu, as long as it's free. Since the files are 200mb+ and there are quite a few, I don't think trial software would work.

    Read the article

  • PowerISO for Mac can't convert .img

    - by None
    I have a bootable .img file that I want to convert to a bootable .iso file. I downloaded poweriso for Mac and used this command: poweriso convert MyOS.img -o MyOS.iso -ot iso which returned this output: PowerISO Copyright(C) 2004-2008 PowerISO Computing, Inc Type poweriso -? for help MyOS.img: The file format is invalid or unsupported. I thought PowerISO could convert .img to .iso. Was I incorrect, or did I use the wrong commands or something like that?

    Read the article

  • Convert text to table

    - by Quattro
    I would like convert text into a table. Here is a link to the text http://www.tcdb.org/public/tcdb Short example: >gnl|TC-DB|A0CIB0|1.A.17.3.1 Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1 MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI >gnl|TC-DB|A0CS82|9.B.82.1.5 Chromosome undetermined scaffold_26, whole genome shotgun sequence - Paramecium tetraurelia. MIIEEQIEEKMIYKAIHRVKVNYQKKIDRYILYKKSRWFFNLLLMLLYAYRIQNIGGFYI VTYIYCVYQLQLLIDYFTPLGLPPVNLEDEEEDDDQFQNDFSELPTTLSNKNELNDKEFR PLLRTTSEFKVWQKSVFSVIFAYFCTYIPIWDIPVYWPFLFCYFFVIVGMSIRKYIKHMK KYGYTILDFTKKK I wanted to have columns for example delimited with pipe | or ; |>gnl|TC-DB|A0CIB0|1.A.17.3.1| Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1| MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI I am working with Windows and I don't know how to do it I just know every row starts with > I want to substitute the first whitespace in a row with a delimiter like | or ; after the first regular expression new line in a row, I want also a delimiter everything between the regular expression first new line and > should go into a new column (it's a sequence of a protein)

    Read the article

  • Convert file from VOC to MP3

    - by Thomas
    I would like to convert a sound file (from a digital voice recorder) with the extension .voc to an .mp3 file or some other common sound files. I am on Windows 7 64 bit. I have tried the program voc2wav but it gives me an error message saying that the program isn't 64 bit. The program has to be free and able to run without installing. (The voice recorder did come with a program that I could install, but I would like to avoid that).

    Read the article

  • creating video from set of images on windows with java language [on hold]

    - by Atif
    I am stuck in making video from set of images, i am using ffmpeg tool on windows platform with java language, for single image it is converting into mp4 but for the set of images it gets failed, i have converted single % to double % with doube quotes but unsuccessful ffmpeg -r 1/5 -i "D:\novoworkspace\MGram\src\biz\novosol\mgram\main\img%%04d.jpg" -c:v libx264 -r 30 -pix_fmt yuv420p D:\novoworkspace\MGram\src\biz\novosol\mgram\main\video.mp4 Above is the exact command i tried from the command line as well from the java language with getRuntime() method. Environment is widows please suggest is it possibe under windows or I have to use some alternative Thanks Atif

    Read the article

  • Importer or converter for ClarisWorks cwk format?

    - by Justin Dearing
    I have several ClarisWorks documents (*.CWK) that I'd like to import into a more modern format like Microsoft Word or Open Office. It seems Star Office can apparently open cwk files, but the product is discontinued and cannot be downloaded any more. There has been a feature request to add a cwk importer to OpenOffice since 2002, so I doubt that OpenOffice will support cwk files any time soon. Are there any utilities that can open a cwk file besides ClarisWorks itself?

    Read the article

  • Flatten Word document

    - by user126389
    I have a document with some precise formatting, created in Word. This doc was converted to PDF for distribution. Now the original is lost, and reconverting to Word using a PDF to word add-on from Microsoft results in many text boxes in the new DOC file. How can I 'flatten' this to remove the text boxes and retain most of the formatting in order to update the contents? Recreating the original formatting would take a long time.

    Read the article

  • How to run a command from anywhere in Mac OS X

    - by pabloruiz55
    I need to use a command for converting my images to pvrtc. It is located in /Developer/Platforms/iPhoneOS.platform/Developer/usr/bin/texturetool. Right now I have to be inside that folder to be able to use the command. How can I set it up so I can run this command from anywhere? Thanks

    Read the article

  • PDF - re/generate image using stream content

    - by tom_tap
    I have pdf file with 8 content streams (bytes) which behave like image layers (but they are not layers that I can turn off/on in Adobe Reader). I would like to extract these images separately, because they overlap each other (thus I am not able to "Take a Snapshot" or "Copy File to Clipboard"). So now I have these streams in below format: <Start Stream> q 599.7601 0 0 71.99921 5951.03423 4282.48177 cm /Im0 Do Q q 599.7601 0 0 71.99921 5951.03432 4210.48177 cm /Im1 Do Q q 599.7601 0 0 71.99921 5951.03441 4138.48177 cm /Im2 Do [...] My question is: how to use these data to generate or regenerate these images to be able to save it as raster or vector file? I have already tried pstoedit, but it doesn't work properly beacuse of these multi streams. Same with PDFedit.

    Read the article

  • ffmpeg - creating DNxHD MFX files with alphas

    - by Hugh
    I'm struggling with something in FFMpeg at the moment... I'm trying to make DNxHD 1080p/24, 36Mb/s MXF files from a sequence of PNG files. My current command-line is: ffmpeg -y -f image2 -i /tmp/temp.%04d.png -s 1920x1080 -r 24 -vcodec dnxhd -f mxf -pix_fmt rgb32 -b 36Mb /tmp/temp.mxf To which ffmpeg gives me the output: Input #0, image2, from '/tmp/temp.%04d.png': Duration: 00:00:01.60, start: 0.000000, bitrate: N/A Stream #0.0: Video: png, rgb32, 1920x1080, 25 tbr, 25 tbn, 25 tbc Output #0, mxf, to '/tmp/temp.mxf': Stream #0.0: Video: dnxhd, yuv422p, 1920x1080, q=2-31, 36000 kb/s, 90k tbn, 24 tbc Stream mapping: Stream #0.0 -> #0.0 [mxf @ 0x1005800]unsupported video frame rate Could not write header for output file #0 (incorrect codec parameters ?) There are a few things in here that concern me: The output stream is insisting on being yuv422p, which doesn't support alpha. 24fps is an unsupported video frame rate? I've tried 23.976 too, and get the same thing. I then tried the same thing, but writing to a quicktime (still DNxHD, though) with: ffmpeg -y -f image2 -i /tmp/temp.%04d.png -s 1920x1080 -r 24 -vcodec dnxhd -f mov -pix_fmt rgb32 -b 36Mb /tmp/temp.mov This gives me the output: Input #0, image2, from '/tmp/1274263259.28098.%04d.png': Duration: 00:00:01.60, start: 0.000000, bitrate: N/A Stream #0.0: Video: png, rgb32, 1920x1080, 25 tbr, 25 tbn, 25 tbc Output #0, mov, to '/tmp/1274263259.28098.mov': Stream #0.0: Video: dnxhd, yuv422p, 1920x1080, q=2-31, 36000 kb/s, 90k tbn, 24 tbc Stream mapping: Stream #0.0 -> #0.0 Press [q] to stop encoding frame= 39 fps= 9 q=1.0 Lsize= 7177kB time=1.62 bitrate=36180.8kbits/s video:7176kB audio:0kB global headers:0kB muxing overhead 0.013636% Which obviously works, to a certain extent, but still has the issue of being yuv422p, and therefore losing the alpha. If I'm going to QuickTime, then I can get what I need using Shake, but my main aim here is to be able to generate .mxf files. Any thoughts? Thanks

    Read the article

  • Convert video from .mp4 to .ogg

    - by Unknown
    I am using ffmpeg version 0.11.1 Copyright (c) 2000-2012 the FFmpeg developers . I need to convert a file .mp4, to .ogg format. I am on Mac OS X, and I have tried this so far: ffmpeg -i sample_mpeg4.mp4 -acodec vorbis -vcodec libtheora -f ogg output.ogv I am getting: Unknown encoder 'libtheora' ffmpeg -i sample_mpeg4.mp4 -acodec libvorbis -vcodec --enable-libtheora output.ogv I am getting: Unknown encoder '--enable-libtheora' ffmpeg -i sample_mpeg4.mp4 -acodec libvorbis -vcodec libtheora -f ogv output.ogv I am getting: [NULL @ 0x7f81bb00f800] Requested output format 'ogv' is not a suitable output format output.ogv: Invalid argument ffmpegtheora is not an option as it can not be install on the server.

    Read the article

  • How to convert a power point pdf to a pdf that is easy to read on kindle?

    - by SpaceTrucker
    I have several power point presentations as pdfs. I would like to read them on the original kindle in landscape format. When I read the original on the kindle then a single slide won't fit on the kindles display. I thought the easiest way to convert the pdf was to repring it with a pdf printer. However I don't know the paper size to use. I already tried using Calibre as suggested by this question. However the output is not usable because of formatting issues. So what paper size should I use for the pdf printer to reprint them in landscape format or are there any other tools I could use for that task?

    Read the article

  • How to convert a 1 page PDF to a 2 page per sheet PDF?

    - by mokasin
    I would like to print a PDF so that on the front of the first page are the first two pages, on the back the 3rd and 4th and so on. ----------------- ----------------- | | | | | | | | | | | | | 1 | 2 | | 3 | 4 | . . . | | | | | | |_______|_______| |_______|_______| page 1 - front page 1 - front Because my printer using Linux fails to support manual duplex printing I'd thought, maybe I could edit the pdf in a according way. But how?

    Read the article

  • How to train users converting from PC to Mac/Apple at a small non profit?

    - by Everette Mills
    Background: I am part of a team that provides volunteer tech support to a local non profit. We are in the position to obtain a grant to update almost all of our computers (many of them 5 to 7 year old machines running XP), provide laptops for users that need them, etc. We are considering switching our users from PC (WinXP) to Macs. The technical aspects of switching will not be an issue for the team. We are in the process of planning data conversions, machine setup, server changes, etc regardless of whether we switch to Macs or much newer PCs. About 1/4 of the staff uses or has access to a Mac at home, these users already understand the basics of using the equipment. We have another set of (generally younger) users that are technically savvy and while slightly inconvenienced and slowed for a few days should be able to switch over quickly. Finally, several members of the staff are older and have many issues using there computers today. We think in the long run switching to Macs may provide a better user experience, fewer IT headaches, and more effective use of computers. The questions we have is what resources and training (webpages, Books, online training materials or online courses) do you recommend that we provide to users to enable the switchover to happen smoothly. Especially, with a focus on providing different levels of training and support to users with different skill levels. If you have done this in your own organization, what steps were successful, what areas were less successful?

    Read the article

  • How can I reorder parts of a video file

    - by sandeep
    I have download a mkv movie file which gave me 3 files suffixed .001, .002, and .003. When i join them together with different tools like winrar, 7zip, hjsplit, concatenated file shows only last 40 min/1.22 hrs of the total length of the movie. If I play all the (.001, .002, .003) parts with vlc player, I can see that .003 is the first part of the video and .001 is the last part. Can anyone tell me how can join this parts of movie with correct position or how I can convert .003 file into .001 file.

    Read the article

  • Connecting Samsung Note 3 to Hitachi CPX3030WN via Samsung MHL 2.0 HD kit , Will there be video output? [on hold]

    - by Monolord's Knight
    I need the video output to projector. but nobody can assure me this may work or not. some says yes some says no.But they have no real experience. Some says an special android app is required for this. Depending on this answer, I will purchase Samsung MHL 2.0 cable . If it wont work it will be no use for me. I don't have a way to change my phone or projector. Just want to know will it work or not. Thanks

    Read the article

  • how can i edit my admission form which i filled wrong . their is no other form is avilable now ...what i do ??? [closed]

    - by user60065
    Hi, I am a 2nd year student in graduation. Recently I filled an admission form for final year admission but it came back to me after 2 days because I had entered wrong information. I want to edit the wrong information and I have scanned the form. I am looking for a good online site where I can upload the scanned document and convert same into an editable format. I don’t mind paying. If any can point to a good site will be great & thanks in advance

    Read the article

< Previous Page | 25 26 27 28 29 30 31 32 33 34 35 36  | Next Page >