Search Results

Search found 18713 results on 749 pages for 'suggestions wanted'.

Page 295/749 | < Previous Page | 291 292 293 294 295 296 297 298 299 300 301 302  | Next Page >

• How to emulate a domain name - Webmin Setup

  - by theonlylos

  I am currently working on a client project where they are using a custom CMS which relies on having the specific domains configured for it to work properly. So in English, that means that when I try running the site on my test environment, the entire website fails because it isn't located on the primary domain (and I'm pretty sure the domain is hard coded since there's no control panel to adjust the file locations). Anyway what I wanted to ask is whether it is possible to use my test environment URL but have Apache and the DNS emulate my clients website URL locally, rather than calling the actual name servers. Right now I have a virtual host setup in Apache but I am not sure where to go from there. Any assistance is greatly appreciated.

  Read the article

• Program keeping encrypted files.

  - by Giorgi

  I am looking for a program which will encrypt files specified by me and allow me to view/edit/delete those files without creating a virtual disk. I do not want to have virtual disk as a domain administrator can access it so truecrypt is not the possibility. One possibility is to use winrar with password protected archive but winrar serves a different goal so it is not very user friendly for this purpose. If it's possible it would be nice if the program does not creates temp files while I open the files. Any suggestions?

  Read the article

• Installer can't create shortcuts - Vista Home Premium

  - by teponta

  Suddenly, whenever I try to install something new on my system, all goes well until it gets to the point of creating Start Menu icons. At this point, I get an alert saying that the installer doesn't have permission to access the Start Menu folder, and my only options are Ignore, which just keeps triggering the same alert, and Cancel, which totally undoes the installation. I've tried disabling UAC (which is a feature I detest anyway), and running the installer as administrator from a R-click. Neither works. I also have 8 subfolders under my c:\users folder with various names, som of which I can look into and some which I cant. I have no idea where all this stuff came from, since I have a personal PC for home use and nobody uses it but me. Any suggestions, anyone? Thanx, T.E.Ponta

  Read the article

• "Disk boot failure" error after installing Windows 7 on SSD

  - by Tony_Henrich

  I have a system with 3 SATA drives which runs fine. Got a new SSD drive and wanted to install a fresh Windows-7 on it. So I removed the boot drive and replaced it with the SSD drive. Installed Windows and when it was done, rebooted and now I get "Disk boot failure. Insert system disk and press enter" error message. I reinstall again and still same message. Removed the SSD and put back the original drive and I got the same message!! I checked the BIOS and things look good. Something is wrong. Two questions: 1- Why isn't the new Windows booting from the SSD? 2- Why isn't the machine booting using the previous working configuration anymore, after removing the SSD? I did connect it during the second Windows installation but it was the last drive in the SATA connector. Would Windows installer mess with its MBR sector?

  Read the article

• Snort monitoring of spanning interface

  - by aHunter

  I have configured a Cisco 3500 switch with a port SPAN and have my snort node (fedora 13) plugged into it. I am running snort as a daemon and have configured a rule to log all tcp traffic but I am only seeing traffic with a destination of the snort node. I know that the SPAN port is working and wanted to know if there is a specific option that I needed to start snort with in order for it to pickup all the traffic? Or is there something that I have missed here? Many thanks.

  Read the article

• rsync synchronizing files only without creating folders on destination

  - by Vincent

  Is it possible with rsync to not create directories on destination? Imagine I have that source : a/ a/x.txt b/ b/y.txt And that I have this destination : a/ a/z.txt The wanted result of rsync source destination : a/ a/x.txt a/z.txt Of course my real situation involves thousand files/folders structure and I don't want solutions involving explicit list of synced folders, which I can do. I'm looking for a clean way just to prevent any folder creation on destination. By exclude or filtering... That could even be something outside rsync, like a hack with permissions if rsync can't do this... For information, this is really easy to get this kind of situations, in my case I have: A server with 2 disks, let's say A & B. And a local drive C. I usually use rsync to sync (and merge) remote A & B into local C. Then sometimes I just want to sync back some C files into A and B. (Just new Files... not non-existing folders on destination)

  Read the article

• Redirecting and Remapping with mod_rewrite

  - by Droid646197

  First of all, am new to doing back-end server admin.. I have a main website being served on at certain IP. I have a blog address that lives on another IP, which was used on wordpress.com. When a user typed in blog.domain.com it would resolve to the Wordpress.com site. Since coming on board (two months) they wanted me to bring the blog in house. So, I set up a wordpress install at domain.com/blog. I would like blog.domain.com (different ip) to resolve to domain.com/blog but still using blog.domain.com is this possible with Apache and mod_rewrite?

  Read the article

• Windows boot iso file without press any key

  - by gln

  I'm trying to make an iso file which will boot without any key-press from the user. In Windows iso files, when booting from a cd, there is a message "press any key to boot from cd" which will wait for 5-10 seconds and then, if there is no key-press, it will boot from HD. I searched the web for how to remove this message, and do not press any key and all the answers were "delete bootfix.bin" from the iso. I edited the iso (I've tried several iso files) to remove the bootfix.bin, but now the iso is not correct. Do you have any suggestions?

  Read the article

• How to verify if my copy operation is complete in Windows 7?

  - by Tim

  Yesterday, I was leaving some job of copying a directory to run overnight. This morning however, I found the computer had restarted because of Windows Update or something. I was wondering if there is some way to check if the copy is complete? One way I guess would be check the last modified time of the copy, and when the system restarted. But I was wondering where to find the time when the system restarted? I was also wondering if where to find some logging files that have the records. I know Event Viewer, but don't know where to find within it. Other methods are welcome too. I also would like to hear suggestions for other ways to accomplish the copy instead of just simple copy and paste. Thanks and regards!

  Read the article

• Running a script at startup as root?

  - by Usman Ajmal

  Hi i developed a script which I set to run at startup i.e. when the Desktop appears. In the script I mounted a partition using sudo mount /dev/sda1 /mnt &> result.txt After executing script a file named result.txt was created which contained sudo: no tty present and no askpass program specified In other words the mounting failed. If I run the script using sudo ./myProgram i don't face this problem and the drive gets mounted successfully. Any suggestions please....

  Read the article

• CPU/RAM usage log over a period of time to file on CentOS

  - by joel_gil

  Hi everyone Im looking for an app pr line of code that could let me observe a process, save the info in a number of variable and then put the gathered info on a file. Ive been trying with variations of top but no luck. I am running several CentOS virtual servers, VM is 2gb ram 2 processor. Maybe a script that works over a specified amount of time while writing lines with the info on a text file so at the end i can have a sort of table with the data. The thing is Im going to stress test the server and I would like to have the data to make some statistics. Any comments and suggestions are most welcome.

  Read the article

• Convert text to table

  - by Quattro

  I would like convert text into a table. Here is a link to the text http://www.tcdb.org/public/tcdb Short example: >gnl|TC-DB|A0CIB0|1.A.17.3.1 Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1 MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI >gnl|TC-DB|A0CS82|9.B.82.1.5 Chromosome undetermined scaffold_26, whole genome shotgun sequence - Paramecium tetraurelia. MIIEEQIEEKMIYKAIHRVKVNYQKKIDRYILYKKSRWFFNLLLMLLYAYRIQNIGGFYI VTYIYCVYQLQLLIDYFTPLGLPPVNLEDEEEDDDQFQNDFSELPTTLSNKNELNDKEFR PLLRTTSEFKVWQKSVFSVIFAYFCTYIPIWDIPVYWPFLFCYFFVIVGMSIRKYIKHMK KYGYTILDFTKKK I wanted to have columns for example delimited with pipe | or ; |>gnl|TC-DB|A0CIB0|1.A.17.3.1| Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1| MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI I am working with Windows and I don't know how to do it I just know every row starts with > I want to substitute the first whitespace in a row with a delimiter like | or ; after the first regular expression new line in a row, I want also a delimiter everything between the regular expression first new line and > should go into a new column (it's a sequence of a protein)

  Read the article

• How can I tell what command is running on the remote end of an ssh connection?

  - by user268385

  Tl;dr - how do I find the name of the command (eg $BASH_COMMAND) running on the remote end of an ssh connection? ... My example setup is two tmux vertical panes, LH pane runs a local vim session with vertical split, RH pane runs an ssh session running vim, again with a vertical split. Using tmux-navigator I can navigate from left to right over the first 3 vim buffers, but the 4th (far right hand one) is inaccessible. The reason for this is that tmux-navigator tests the value of 'pane_current_command' and compares it to 'vim' before deciding which keystrokes to dispatch. On the right hand tmux pane, the current command is 'ssh' and not 'vim'. What I want to do is test for (pane_current_command =~ 'ssh'), and if so, examine the command that is running on the far side of the connection? I cannot find a way to get hold of this, so any suggestions would be welcome? For information, the problem is almost the same as this one, but without the nested tmux sessions: https://github.com/christoomey/vim-tmux-navigator/issues/12

  Read the article

• SQL Server database constantly restarting

  - by Michael Itzoe

  We have SQL Server 2008 Express installed on a Windows 2003 server. Looking at the event log, one of the databases appears to be restarting anywhere from every couple seconds to every 15 to 30 minutes. This server hosts about half a dozen databases; the problem is with only one. This database is also the onle one comprised of multiple schemas (not just dbo). There are thousands of events going back several months. There doesn't seem to be any affect on the website using the database, nor does any data appear to be corrupted or compromised. I'm not a DBA, so I don't even know where to look for causes to this. Any suggestions?

  Read the article

• Upgrade Subversion 1.6 to 1.7 on CentOS? (can't find yum repository)

  - by user743919

  I want to upgrade my SVN Server from 1.6 to 1.7. Unfortunately I can't find anything on the internet how to do this with yum. I have checked rpmforge-extras but it has only svn 1.6 and not 1.7 I wanted to update with yum because this is the most secure way for me. I'm not an experienced Linux user. Is there a yum repository that contains 1.7 (subversion.x86_64 0:1.7.xxxxx.el5.rfx) I hope somebody can help me out? If there is non, perhaps a short explenation how to update with just step by step.

  Read the article

• Minimum rights to access the whole Users directory on another computer

  - by philipthegreat

  What is the minimum rights required to access the Users directory on another computer via an admin share? I have a batch file that writes some information to a few other computers using a path of \\%COMPUTERNAME%\c$\Users\%USERNAME%\AppData\Roaming. The batch files run under an unprivileged user (part of Domain Users only). How do I set appropriate rights so that service account can access the AppData\Roaming folder for every user on another computer? I'd like to give rights lower than Local Admin, which I know will work. Things I've attempted: As Domain Admin, attempted to give Modify rights to the C:\Users\ directory on the local computer. Error: Access Denied. Set the service account as Local Admin on the other computer. This works, but is against IT policy where I work. I'd like to accomplish this with rights lower than Local Admin. Any suggestions?

  Read the article

• Type 1 Hypervisor on the desktop

  - by Blazemore

  I have a powerful home PC, and I've used VirtualBox to run Linux distros in Windows (and vice versa). I'm interested in trying out a lightweight type 1 hypervisor to run all my operating systems (Windows 7, Debian, Arch) and was looking for suggestions of which to pick and how to implement this. From what I gather, a type 1 hypervisor is a lightweight OS which simply provides VM management functionality. Will I get reasonable performance under each guest OS? Can all the guest OSs have access to a shared data drive, or is is best to have a storage server in another guest OS and mount it over the virtual network? What about gaming, is this feasible, or will I realistically need to run Win7 on bare metal? I'd appreciate any input.

  Read the article

• Odd behavior of permissions and icons

  - by Urban

  After some virus had infected my Windows 7, I did a complete format and re-installed the OS. I was just installing applications and copying back some data when I noticed some shortcuts changing their icons to something I couldnt recognize (Yellow icons in the image below). Also, a few exe files which previously did not ask for User permission, are now asking for it. Wondering if this is an icon cache problem, I cleared the cache by deleting the IconCache.db in AppData/Local but the problem still persists. Although I did a full system scan with MS Security Essentials, I'm not sure if this is another virus or some other problem. I would appreciate any suggestions you might have. Edit: Now even Firefox needs permissions to launch. It's icon hasnt changed, but it's got the 'shield' overlay on it like the other yellow icons.

  Read the article

• dhcp client service won't start

  - by xyious

  I have a Laptop with 2 network interfaces and neither will get an IP address through dhcp. I found out that the dhcp client service didn't start. Upon manually starting it gives the error 2: File not found. I have checked that the files were there (both svchost and dhcpcore .dll), the local service account has read access to the system32 folder, the path in the registry is also correct and I can access the file. I have tried to netsh winsock reset and ip reset all. I have even added the local service account to the administrators group. sfc /scannow also came up clean. I have no idea what else I can try. Any suggestions are welcome. (side note it's a windows 7 32 bit, atheros wlan, deinstalled avira before any of the other troubleshooting)

  Read the article

• Toshiba Satellite A305-S6861 Display Problems

  - by brock029

  Well this is the first Laptop I have ever worked on with a dedicated video card. So, there is no video going to the laptops monitor or to an external. Ripped it apart found the gpu and now am stuck. I cant decide if its the gpu that has gone out or the motherboard. Any one have any suggestions? If it were a desktop I would throw in one of my spare video cards. Mainly I don't want to order the video card and eat the $50 if its the motherboard.

  Read the article

• Is there a free program that can detect which device on my network is causing lag?

  - by malfy

  I'm on a small business network, and rarely we experience really extreme latency. I have no idea what device might be causing the lag, and wanted to know if there was a piece of software that could detect it. I know about some softwares like wireshark, which maybe do what I'm asking? If so it's too complicated to understand. I run the program and I have no idea what I'm looking at, or what parameters to give it. So something that can monitor traffic, as well as describe it in such a way that even a not so network savvy individual can interpret.

  Read the article

• IE8 Stopped Keeping History

  - by BillP3rd

  Like the title says, apparently my IE8 has stopped keeping the history of pages I've visited. I've searched SU and Google and can't find anything that seems to describe what I'm seeing. I have IE set to retain history for 999 days (the maximum allowed): As you can see below, apart from today and last Thursday, IE appears to be oblivious to any activity more recent than three weeks ago. Clicking on either "Thursday" or "Today" reveals no recorded history, however. Very odd behavior. Finally, the history does extend back 30 weeks to when I built the computer, and there is recorded history for every week. I'd appreciate suggestions. NB. Windows 7 Ultimate, x64 (but 32-bit IE8).

  Read the article

• ssh asks for password despite ssh-copy-id

  - by Aliud Alius

  I've been using public key authentication on a remote server for some time now for remote shell use as well as for sshfs mounts. After forcing a umount of my sshfs directory, I noticed that ssh began to prompt me for a password. I tried purging the remote .ssh/authorized_keys from any mention the local machine, and I cleaned the local machine from references to the remote machine. I then repeated my ssh-copy-id, it prompted me for a password, and returned normally. But lo and behold, when I ssh to the remote server I am still prompted for a password. I'm a little confused as to what the issue could be, any suggestions?

  Read the article

• Can I use VT-D with a windows host for a VM?

  - by Journeyman Geek

  I've got a fairly beefy gaming system that I also run occational virtual machines on. It runs windows 8 and the built in hyper V virtual machine software at the moment and has a core i7 3770 (which unlike the unlocked model, should support VT-D), an Asus P8Z77V and a gforce 660 video card(also asus). I figure that if I could use VT-D I could add a cheap dedicated 3d card for a VM, in case I wanted somewhat more than the 'basics'. I know KVM and Xen support this to some level on linux, but can I do so on windows? I'm open to switching VM software if need be.

  Read the article

• Fastest booting Linux ditribution on a live-cd

  - by Avindra Goolcharan

  I'm looking for a linux distro with the following: Boots quickly, as fast as possible. Has expected tools such as file browser, a web browser, etc. Doesn't need to have extraneous recovery stuff such as partition editors, and what not. These are the tools I have and use already: ophcrack Ultimate Boot CD for Windows (UBCD4Win) chntpw (Offline NT Password and Registry Editor) Hiren's BootCD gparted or Parted Magic Ubuntu nubuntu Any and all suggestions are welcome :-) The primary objective is to get a quick booting linux distro that I can grab / delete / move / copy files with. Currently, I prefer using ophcrack, it boots in (relatively) fast and I can manipulate files well. The one that takes the longest is ubuntu of course.

  Read the article

< Previous Page | 291 292 293 294 295 296 297 298 299 300 301 302  | Next Page >