Search Results

Search found 7634 results on 306 pages for 'preg replace'.

Page 298/306 | < Previous Page | 294 295 296 297 298 299 300 301 302 303 304 305  | Next Page >

  • ASp.Net Mvc 1.0 Dynamic Images Returned from Controller taking 154 seconds+ to display in IE8, firef

    - by julian guppy
    I have a curious problem with IE, IIS 6.0 dynamic PNG files and I am baffled as to how to fix.. Snippet from Helper (this returns the URL to the view for requesting the images from my Controller. string url = LinkBuilder.BuildUrlFromExpression(helper.ViewContext.RequestContext, helper.RouteCollection, c = c.FixHeight(ir.Filename, ir.AltText, "FFFFFF")); url = url.Replace("&", "&"); sb.Append(string.Format("<removed id=\"TheImage\" src=\"{0}\" alt=\"\" /", url)+Environment.NewLine); This produces a piece of html as follows:- img id="TheImage" src="/ImgText/FixHeight?sFile=Images%2FUser%2FJulianGuppy%2FMediums%2Fconservatory.jpg&backgroundColour=FFFFFF" alt="" / brackets missing because i cant post an image... even though I dont want to post an image I jsut want to post the markup... sigh Snippet from Controller ImgTextController /// <summary> /// This function fixes the height of the image /// </summary> /// <param name="sFile"></param> /// <param name="alternateText"></param> /// <param name="backgroundColour"></param> /// <returns></returns> [AcceptVerbs(HttpVerbs.Get)] public ActionResult FixHeight(string sFile, string alternateText, string backgroundColour) { #region File if (string.IsNullOrEmpty(sFile)) { return new ImgTextResult(); } // MVC specific change to prepend the new directory if (sFile.IndexOf("Content") == -1) { sFile = "~/Content/" + sFile; } // open the file System.Drawing.Image img; try { img = System.Drawing.Image.FromFile(Server.MapPath(sFile)); } catch { img = null; } // did we fail? if (img == null) { return new ImgTextResult(); } #endregion File #region Width // Sort out the width from the image passed to me Int32 nWidth = img.Width; #endregion Width #region Height Int32 nHeight = img.Height; #endregion Height // What is the ideal height given a width of 2100 this should be 1400. var nIdealHeight = (int)(nWidth / 1.40920096852); // So is the actual height of the image already greater than the ideal height? Int32 nSplit; if (nIdealHeight < nHeight) { // Yes, do nothing, well i need to return the iamge... nSplit = 0; } else { // rob wants to not show the white at the top or bottom, so if we were to crop the image how would be do it // 1. Calculate what the width should be If we dont adjust the heigt var newIdealWidth = (int)(nHeight * 1.40920096852); // 2. This newIdealWidth should be smaller than the existing width... so work out the split on that Int32 newSplit = (nWidth - newIdealWidth) / 2; // 3. Now recrop the image using 0-nHeight as the height (i.e. full height) // but crop the sides so that its the correct aspect ration var newRect = new Rectangle(newSplit, 0, newIdealWidth, nHeight); img = CropImage(img, newRect); nHeight = img.Height; nWidth = img.Width; nSplit = 0; } // No, so I want to place this image on a larger canvas and we do this by Creating a new image to be the size that we want System.Drawing.Image canvas = new Bitmap(nWidth, nIdealHeight, PixelFormat.Format24bppRgb); Graphics g = Graphics.FromImage(canvas); #region Color // Whilst we can set the background colour we shall default to white if (string.IsNullOrEmpty(backgroundColour)) { backgroundColour = "FFFFFF"; } Color bc = ColorTranslator.FromHtml("#" + backgroundColour); #endregion Color // Filling the background (which gives us our broder) Brush backgroundBrush = new SolidBrush(bc); g.FillRectangle(backgroundBrush, -1, -1, nWidth + 1, nIdealHeight + 1); // draw the image at the position var rect = new Rectangle(0, nSplit, nWidth, nHeight); g.DrawImage(img, rect); return new ImgTextResult { Image = canvas, ImageFormat = ImageFormat.Png }; } My ImgTextResult is a class that returns an Action result for me but embedding the image from a memory stream into the response.outputstream. snippet from my ImageResults /// <summary> /// Execute the result /// </summary> /// <param name="context"></param> public override void ExecuteResult(ControllerContext context) { // output context.HttpContext.Response.Clear(); context.HttpContext.Response.ContentType = "image/png"; try { var memStream = new MemoryStream(); Image.Save(memStream, ImageFormat.Png); context.HttpContext.Response.BinaryWrite(memStream.ToArray()); context.HttpContext.Response.Flush(); context.HttpContext.Response.Close(); memStream.Dispose(); Image.Dispose(); } catch (Exception ex) { string a = ex.Message; } } Now all of this works locally and lovely, and indeed all of this works on my production server BUT Only for Firefox, Safari, Chrome (and other browsers) IE has a fit and decides that it either wont display the image or it does display the image after approx 154seconds of waiting..... I have made sure my HTML is XHTML compliant, I have made sure I am getting no Routing errors or crashes in my event log on the server.... Now obviously I have been a muppet and have done something wrong... but what I cant fathom is why in development all works fine, and in production all non IE browsers also work fine, but IE 8 using IIS 6.0 production server is having some kind of problem in returning this PNG and I dont have an error to trace... so what I am looking for is guidance as to how I can debug this problem.

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • VB.NET - using textfile as source for menus and textboxes

    - by Kenny Bones
    Hi, this is probably a bit tense and I'm not sure if this is possible at all. But basically, I'm trying to create a small application which contains alot of PowerShell-code which I want to run in an easy matter. I've managed to create everything myself and it does work. But all of the PowerShell code is manually hardcoded and this gives me a huge disadvantage. What I was thinking was creating some sort of dynamic structure where I can read a couple of text files (possible a numerous amount of text files) and use these as the source for both the comboboxes and the richtextbox which provovides as the string used to run in PowerShell. I was thinking something like this: Combobox - "Choose cmdlet" - Use "menucode.txt" as source Richtextbox - Use "code.txt" as source But, the thing is, Powershell snippets need a few arguments in order for them to work. So I've got a couple of comboboxes and a few textboxes which provides as input for these arguments. And this is done manually as it is right now. So rewriting this small application should also search the textfile for some keywords and have the comboboxes and textboxes to replace those keywords. And I'm not sure how to do this. So, would this requre a whole lot of textfiles? Or could I use one textfile and separate each PowerShell cmdlet snippets with something? Like some sort of a header? Right now, I've got this code at the eventhandler (ComboBox_SelectedIndexChanged) If ComboBoxFunksjon.Text = "Set attribute" Then TxtBoxUsername.Visible = True End If If chkBoxTextfile.Checked = True Then If txtboxBrowse.Text = "" Then MsgBox("You haven't choses a textfile as input for usernames") End If LabelAttribute.Visible = True LabelUsername.Visible = False ComboBoxAttribute.Visible = True TxtBoxUsername.Visible = False txtBoxCode.Text = "$users = Get-Content " & txtboxBrowse.Text & vbCrLf & "foreach ($a in $users)" & vbCrLf & "{" & vbCrLf & "Set-QADUser -Identity $a -ObjectAttributes @{" & ComboBoxAttribute.SelectedItem & "='" & TxtBoxValue.Text & "'}" & vbCrLf & "}" If ComboBoxAttribute.SelectedItem = "Outlook WebAccess" Then TxtBoxValue.Visible = False CheckBoxValue.Visible = True CheckBoxValue.Text = "OWA Enabled?" txtBoxCode.Text = "$users = Get-Content " & txtboxBrowse.Text & vbCrLf & "foreach ($a in $users)" & vbCrLf & "{" & vbCrLf & "Set-CASMailbox -Identity $a -OWAEnabled" & " " & "$" & CheckBoxValue.Checked & " '}" & vbCrLf & "}" End If If ComboBoxAttribute.SelectedItem = "MobileSync" Then TxtBoxValue.Visible = False CheckBoxValue.Visible = True CheckBoxValue.Text = "MobileSync Enabled?" Dim value If CheckBoxValue.Checked = True Then value = "0" Else value = "7" End If txtBoxCode.Text = "$users = Get-Content " & txtboxBrowse.Text & vbCrLf & "foreach ($a in $users)" & vbCrLf & "{" & vbCrLf & "Set-QADUser -Identity $a -ObjectAttributes @{msExchOmaAdminWirelessEnable='" & value & " '}" & vbCrLf & "}" End If Else LabelAttribute.Visible = True LabelUsername.Visible = True ComboBoxAttribute.Visible = True txtBoxCode.Text = "Set-QADUser -Identity " & TxtBoxUsername.Text & " -ObjectAttributes @{" & ComboBoxAttribute.SelectedItem & "='" & TxtBoxValue.Text & " '}" If ComboBoxAttribute.SelectedItem = "Outlook WebAccess" Then TxtBoxValue.Visible = False CheckBoxValue.Visible = True CheckBoxValue.Text = "OWA Enabled?" txtBoxCode.Text = "Set-CASMailbox " & TxtBoxUsername.Text & " -OWAEnabled " & "$" & CheckBoxValue.Checked End If If ComboBoxAttribute.SelectedItem = "MobileSync" Then TxtBoxValue.Visible = False CheckBoxValue.Visible = True CheckBoxValue.Text = "MobileSync Enabled?" Dim value If CheckBoxValue.Checked = True Then value = "0" Else value = "7" End If txtBoxCode.Text = "Set-QADUser " & TxtBoxUsername.Text & " -ObjectAttributes @{msExchOmaAdminWirelessEnable='" & value & "'}" End If End If Now, this snippet above lets me either use a text file as a source for each username used in the powershell snippet. Just so you know :) And I know, this is probably coded as stupidly as it gets. But it does work! :)

    Read the article

  • nivo slider and drop down menu doesnt work in IE

    - by venom
    Does anyone has any idea why drop down menu in IE disappear under nivo slider? tried to play with z-index, didn't help, i also know that drop down menus dissappear under flash content, but this is not the case(wmode=transparent) as far as i know the nivo slider uses just jquery, no flash. here is the html: <table> <tr height="50"><td colspan="2" align="right" class="bottom_menu"> <ul id="nav" class="dropdown dropdown-horizontal" > <li><a href="/index.cfm?fuseaction=home.logout" class="dir" style="border:0 !important;" >Çikis</a></li> <li><a href="/index.cfm?fuseaction=objects2.list_basket" class="dir">Sepetim</a></li> <li><a href="/index.cfm?fuseaction=objects2.me" class="dir">Sirketim</a> <ul> <li><a href="/index.cfm?fuseaction=objects2.list_opportunities">Firsatlar</a></li> <li><a href="/index.cfm?fuseaction=objects2.form_add_partner">Sirkete Kullanici Ekle</a></li> <li><a href="/index.cfm?fuseaction=objects2.form_upd_my_company">Kullanici Yönetimi</a></li> <li><a href="/index.cfm?fuseaction=objects2.list_analyses">Analizler</a></li> <li><a href="/index.cfm?fuseaction=objects2.list_extre">Hesap Ekstresi</a></li> <li><a href="/index.cfm?fuseaction=objects2.popup_add_online_pos" target="_blank">Sanal Pos</a></li> </ul> </li> </ul> </td></tr> </table> <div id="banner"> <img src="/documents/templates/projedepo/l_top.gif" style="z-index:1;position:absolute; left:0; top:0;" width="24px" height="24px" border="0" /> <img src="/documents/templates/projedepo/r_top.gif" style="z-index:1;position:absolute; right:0; top:0;" width="24px" height="24px" border="0" /> <img src="/documents/templates/projedepo/l_bottom.gif" style="z-index:1;position:absolute; left:0; bottom:0;" width="24px" height="24px" border="0" /> <img src="/documents/templates/projedepo/r_bottom.gif" style="z-index:1;position:absolute; right:0; bottom:0;" width="24px" height="24px" border="0" /> <div class="banner_img"> <link rel="stylesheet" href="/documents/templates/projedepo/banner/nivo-slider.css" type="text/css" media="screen" /> <link rel="stylesheet" href="/documents/templates/projedepo/banner/style.css" type="text/css" media="screen" /> <div id="slider" class="nivoSlider"> <img title="#1" src="/documents/templates/projedepo/banner/canon.jpg" alt="" /> <img title="#2" src="/documents/templates/projedepo/banner/indigovision.jpg" alt="" /> </div> <div id="1" class="nivo-html-caption"> <a href="/index.cfm?fuseaction=objects2.detail_product&product_id=612&stock_id=612"><img src="/documents/templates/projedepo/banner/daha_fazlasi.jpg" border="0" /></a> </div> <div id="2" class="nivo-html-caption"> <a href="/index.cfm?fuseaction=objects2.detail_product&product_id=630&stock_id=630"><img src="/documents/templates/projedepo/banner/daha_fazlasi.jpg" border="0" /></a> </div> <script type="text/javascript" src="/JS/jquery.nivo.slider.pack.js"></script> <script type="text/javascript"> $(window).load(function() { $('#slider').nivoSlider({ effect:'random', //Specify sets like: 'fold,fade,sliceDown' slices:15, animSpeed:1000, //Slide transition speed pauseTime:10000, startSlide:0, //Set starting Slide (0 index) directionNav:true, //Next & Prev directionNavHide:true, //Only show on hover controlNav:true, //1,2,3... controlNavThumbs:false, //Use thumbnails for Control Nav controlNavThumbsFromRel:false, //Use image rel for thumbs controlNavThumbsSearch: '.jpg', //Replace this with... controlNavThumbsReplace: '_thumb.jpg', //...this in thumb Image src keyboardNav:true, //Use left & right arrows pauseOnHover:true, //Stop animation while hovering manualAdvance:false, //Force manual transitions captionOpacity:1.0, //Universal caption opacity beforeChange: function(){}, afterChange: function(){}, slideshowEnd: function(){}, //Triggers after all slides have been shown lastSlide: function(){}, //Triggers when last slide is shown afterLoad: function(){} //Triggers when slider has loaded }); }); </script> </div> </div> Here is css for dropdown menu: http://www.micae.com/documents/templates/projedepo/default.css http://www.micae.com/documents/templates/projedepo/default.advanced.css http://www.micae.com/documents/templates/projedepo/dropdown.css and for nivo slider: http://www.micae.com/documents/templates/projedepo/banner/style.css http://www.micae.com/documents/templates/projedepo/banner/nivo-slider.css and for banner divs: #banner { position:relative; width:980px; height:435px; background:#fff; margin-bottom:20px; margin-top:-1px; color:#000; z-index:60; } .banner_img { padding:8px;position:absolute;z-index:2; } and the javascript by default, jquery and nivo slider http://www.micae.com/JS/jquery.nivo.slider.pack.js

    Read the article

  • another question about OpenGL ES rendering to texture

    - by ensoreus
    Hello, pros and gurus! Here is another question about rendering to texture. The whole stuff is all about saving texture between passing image into different filters. Maybe all iPhone developers knows about Apple's sample code with OpenGL processing where they used GL filters(functions), but pass into them the same source image. I need to edit an image by passing it sequentelly with saving the state of the image to edit. I am very noob in OpenGL, so I spent increadibly a lot of to solve the issue. So, I desided to create 2 FBO's and attach source image and temporary image as a textures to render in. Here is my init routine: glEnableClientState(GL_VERTEX_ARRAY); glEnableClientState(GL_TEXTURE_COORD_ARRAY); glEnable(GL_TEXTURE_2D); glPixelStorei(GL_UNPACK_ALIGNMENT, 1); glGetIntegerv(GL_FRAMEBUFFER_BINDING_OES, (GLint *)&SystemFBO); glImage = [self loadTexture:preparedImage]; //source image for (int i = 0; i < 4; i++) { fullquad[i].s *= glImage->s; fullquad[i].t *= glImage->t; flipquad[i].s *= glImage->s; flipquad[i].t *= glImage->t; } tmpImage = [self loadEmptyTexture]; //editing image glGenFramebuffersOES(1, &tmpImageFBO); glBindFramebufferOES(GL_FRAMEBUFFER_OES, tmpImageFBO); glFramebufferTexture2DOES(GL_FRAMEBUFFER_OES, GL_COLOR_ATTACHMENT0_OES, GL_TEXTURE_2D, tmpImage->texID, 0); GLenum status = glCheckFramebufferStatusOES(GL_FRAMEBUFFER_OES); if(status != GL_FRAMEBUFFER_COMPLETE_OES) { NSLog(@"failed to make complete tmp framebuffer object %x", status); } glBindTexture(GL_TEXTURE_2D, 0); glBindFramebufferOES(GL_FRAMEBUFFER_OES, 0); glGenRenderbuffersOES(1, &glImageFBO); glBindFramebufferOES(GL_FRAMEBUFFER_OES, glImageFBO); glFramebufferTexture2DOES(GL_FRAMEBUFFER_OES, GL_COLOR_ATTACHMENT0_OES, GL_TEXTURE_2D, glImage->texID, 0); status = glCheckFramebufferStatusOES(GL_FRAMEBUFFER_OES) ; if(status != GL_FRAMEBUFFER_COMPLETE_OES) { NSLog(@"failed to make complete cur framebuffer object %x", status); } glBindTexture(GL_TEXTURE_2D, 0); glBindFramebufferOES(GL_FRAMEBUFFER_OES, 0); When user drag the slider, this routine invokes to apply changes -(void)setContrast:(CGFloat)value{ contrast = value; if(flag!=mfContrast){ NSLog(@"contrast: dumped"); flag = mfContrast; glBindFramebufferOES(GL_FRAMEBUFFER_OES, glImageFBO); glClearColor(1,1,1,1); glClear(GL_COLOR_BUFFER_BIT|GL_DEPTH_BUFFER_BIT); glMatrixMode(GL_PROJECTION); glLoadIdentity(); glOrthof(0, 512, 0, 512, -1, 1); glMatrixMode(GL_MODELVIEW); glLoadIdentity(); glScalef(512, 512, 1); glBindTexture(GL_TEXTURE_2D, tmpImage->texID); glViewport(0, 0, 512, 512); glVertexPointer(2, GL_FLOAT, sizeof(V2fT2f), &fullquad[0].x); glTexCoordPointer(2, GL_FLOAT, sizeof(V2fT2f), &fullquad[0].s); glDrawArrays(GL_TRIANGLE_STRIP, 0, 4); glBindFramebufferOES(GL_FRAMEBUFFER_OES, 0); } glBindFramebufferOES(GL_FRAMEBUFFER_OES,tmpImageFBO); glClearColor(0,0,0,1); glClear(GL_COLOR_BUFFER_BIT); glEnable(GL_TEXTURE_2D); glActiveTexture(GL_TEXTURE0); glMatrixMode(GL_PROJECTION); glLoadIdentity(); glOrthof(0, 512, 0, 512, -1, 1); glMatrixMode(GL_MODELVIEW); glLoadIdentity(); glScalef(512, 512, 1); glBindTexture(GL_TEXTURE_2D, glImage->texID); glViewport(0, 0, 512, 512); [self contrastProc:fullquad value:contrast]; glBindFramebufferOES(GL_FRAMEBUFFER_OES, 0); [self redraw]; } Here are two cases: if it is the same filter(edit mode) to use, I bind tmpFBO to draw into tmpImage texture and edit glImage texture. contrastProc is a pure routine from Apples's sample. If it is another mode, than I save edited image by drawing tmpImage texture in source texture glImage, binded with glImageFBO. After that I call redraw: glBindFramebufferOES(GL_FRAMEBUFFER_OES, SystemFBO); glClear(GL_COLOR_BUFFER_BIT | GL_DEPTH_BUFFER_BIT); glMatrixMode(GL_PROJECTION); glLoadIdentity(); glOrthof(0, kTexWidth, 0, kTexHeight, -1, 1); glMatrixMode(GL_MODELVIEW); glLoadIdentity(); glScalef(kTexWidth, kTexHeight, 1); glBindTexture(GL_TEXTURE_2D, glImage->texID); glViewport(0, 0, kTexWidth, kTexHeight); glVertexPointer(2, GL_FLOAT, sizeof(V2fT2f), &flipquad[0].x); glTexCoordPointer(2, GL_FLOAT, sizeof(V2fT2f), &flipquad[0].s); glDrawArrays(GL_TRIANGLE_STRIP, 0, 4); glBindFramebufferOES(GL_FRAMEBUFFER_OES, 0); And here it binds visual framebuffer and dispose glImage texture. So, the result is VERY aggresive filtering. Increasing contrast volume by just 0.2 brings image to state that comparable with 0.9 contrast volume in Apple's sample code project. I miss something obvious, I guess. Interesting, if I disabple line glBindTexture(GL_TEXTURE_2D, glImage->texID); in setContrast routine it brings no effect. At all. If I replace tmpImageFBO with SystemFBO to draw glImage directly on display(and disabling redraw invoking line), all works fine. Please, HELP ME!!! :(

    Read the article

  • C++ Sentinel/Count Controlled Loop beginning programming

    - by Bryan Hendricks
    Hello all this is my first post. I'm working on a homework assignment with the following parameters. Piecework Workers are paid by the piece. Often worker who produce a greater quantity of output are paid at a higher rate. 1 - 199 pieces completed $0.50 each 200 - 399 $0.55 each (for all pieces) 400 - 599 $0.60 each 600 or more $0.65 each Input: For each worker, input the name and number of pieces completed. Name Pieces Johnny Begood 265 Sally Great 650 Sam Klutz 177 Pete Precise 400 Fannie Fantastic 399 Morrie Mellow 200 Output: Print an appropriate title and column headings. There should be one detail line for each worker, which shows the name, number of pieces, and the amount earned. Compute and print totals of the number of pieces and the dollar amount earned. Processing: For each person, compute the pay earned by multiplying the number of pieces by the appropriate price. Accumulate the total number of pieces and the total dollar amount paid. Sample Program Output: Piecework Weekly Report Name Pieces Pay Johnny Begood 265 145.75 Sally Great 650 422.50 Sam Klutz 177 88.5 Pete Precise 400 240.00 Fannie Fantastic 399 219.45 Morrie Mellow 200 110.00 Totals 2091 1226.20 You are required to code, compile, link, and run a sentinel-controlled loop program that transforms the input to the output specifications as shown in the above attachment. The input items should be entered into a text file named piecework1.dat and the ouput file stored in piecework1.out . The program filename is piecework1.cpp. Copies of these three files should be e-mailed to me in their original form. Read the name using a single variable as opposed to two different variables. To accomplish this, you must use the getline(stream, variable) function as discussed in class, except that you will replace the cin with your textfile stream variable name. Do not forget to code the compiler directive #include < string at the top of your program to acknowledge the utilization of the string variable, name . Your nested if-else statement, accumulators, count-controlled loop, should be properly designed to process the data correctly. The code below will run, but does not produce any output. I think it needs something around line 57 like a count control to stop the loop. something like (and this is just an example....which is why it is not in the code.) count = 1; while (count <=4) Can someone review the code and tell me what kind of count I need to introduce, and if there are any other changes that need to be made. Thanks. [code] //COS 502-90 //November 2, 2012 //This program uses a sentinel-controlled loop that transforms input to output. #include <iostream> #include <fstream> #include <iomanip> //output formatting #include <string> //string variables using namespace std; int main() { double pieces; //number of pieces made double rate; //amout paid per amount produced double pay; //amount earned string name; //name of worker ifstream inFile; ofstream outFile; //***********input statements**************************** inFile.open("Piecework1.txt"); //opens the input text file outFile.open("piecework1.out"); //opens the output text file outFile << setprecision(2) << showpoint; outFile << name << setw(6) << "Pieces" << setw(12) << "Pay" << endl; outFile << "_____" << setw(6) << "_____" << setw(12) << "_____" << endl; getline(inFile, name, '*'); //priming read inFile >> pieces >> pay >> rate; // ,, while (name != "End of File") //while condition test { //begining of loop pay = pieces * rate; getline(inFile, name, '*'); //get next name inFile >> pieces; //get next pieces } //end of loop inFile.close(); outFile.close(); return 0; }[/code]

    Read the article

  • jQuery programming style?

    - by Sam Dufel
    I was recently asked to fix something on a site which I haven't worked on before. I haven't really worked with jQuery that much, but I figured I'd take a look and see if I could fix it. I've managed to mostly clear up the problem, but I'm still horrified at the way they chose to build this site. On document load, they replace the click() method of every anchor tag and form element with the same massive function. When clicked, that function then checks if the tag has one of a few different attributes (non-standard attributes, even), and does a variety of different tasks depending on what attributes exist and what their values are. Some hyperlinks have an attribute on them called 'ajaxrel', which makes the click() function look for another (hidden) hyperlink with an ID specified by the ajaxrel attribute, and then calls the click() function for that other hyperlink (which was also modified by this same click() function). On the server side, all the php files are quite long and have absolutely no indentation. This whole site has been a nightmare to debug. Is this standard jQuery practice? This navigation scheme seems terrible. Does anyone else actually use jQuery this way? I'd like to start incorporating it into my projects, but looking at this site is giving me a serious headache. Here's the click() function for hyperlinks: function ajaxBoxA(theElement, urltosend, ajaxbox, dialogbox) { if ($(theElement).attr("href") != undefined) var urltosend = $(theElement).attr("href"); if ($(theElement).attr('toajaxbox') != undefined) var ajaxbox = $(theElement).attr('toajaxbox'); // check to see if dialog box is called for. if ($(theElement).attr('dialogbox') != undefined) var dialogbox = $(theElement).attr('dialogbox'); var dodialog = 0; if (dialogbox != undefined) { // if dialogbox doesn't exist, then flag to create dialog box. var isDiaOpen = $('[ajaxbox="' + ajaxbox + '"]').parent().parent().is(".ui-dialog-container"); dodialog = 1; if (isDiaOpen) { dodialog = 0; } dialogbox = parseUri(dialogbox); dialogoptions = { close: function () { // $("[id^=hierarchy]",this).NestedSortableDestroy(); $(this).dialog('destroy').remove() } }; for ( var keyVar in dialogbox['queryKey'] ) eval( "dialogoptions." + keyVar + " = dialogbox['queryKey'][keyVar]"); }; $("body").append("<div id='TB_load'><img src='"+imgLoader.src+"' /></div>"); $('#TB_load').show(); if (urltosend.search(/\?/) > 0) { urltosend = urltosend + "&-ajax=1"; } else { urltosend = urltosend + "?-ajax=1"; } if ($('[ajaxbox="' + ajaxbox + '"]').length) { $('[ajaxbox="' + ajaxbox + '"]').each( function () { $(this).empty(); }); }; $.ajax({ type: "GET", url: urltosend, data: "", async: false, dataType: "html", success: function (html) { var re = /^<toajaxbox>(.*?)<\/toajaxbox>+(.*)/; if (re.test(html)) { var match = re.exec(html); ajaxbox = match[1]; html = Right(html, String(html).length - String(match[1]).length); } var re = /^<header>(.*?)<\/header>+(.*)/; if (re.test(html)) { var match = re.exec(html); window.location = match[1]; return false; } if (html.length > 0) { var newHtml = $(html); if ($('[ajaxbox="' + ajaxbox + '"]').length) { $('[ajaxbox="' + ajaxbox + '"]').each( function () { $(this).replaceWith(newHtml).ready( function () { ajaxBoxInit(newHtml) if (window.ajaxboxsuccess) ajaxboxsuccess(newHtml); }); }); if ($('[ajaxdialog="' + ajaxbox + '"]').length = 0) { if (dodialog) $(newHtml).wrap("<div class='flora ui-dialog-content' ajaxdialog='" + ajaxbox + "' style='overflow:auto;'></div>").parent().dialog(dialogoptions); } } else { $("body").append(newHtml).ready( function () { ajaxBoxInit(newHtml); if (window.ajaxboxsuccess) ajaxboxsuccess(newHtml); }); if (dodialog) $(newHtml).wrap("<div class='flora ui-dialog-content' ajaxdialog='" + ajaxbox + "' style='overflow:auto;'></div>").parent().dialog(dialogoptions); } } var rel = $(theElement).attr('ajaxtriggerrel'); if (rel != undefined) $('a[ajaxrel="' + rel + '"]').click(); tb_remove(); return false; }, complete: function () { $("#TB_load").remove(); } }); return false; }

    Read the article

  • ListView not showing up in fragment

    - by aindurti
    When I insert a listview in a fragment in my application, it doesn't show up after I populate it with items. In fact, the application crashes due to a NullPointerException. Can anybody help me? Here is the detail activity from which I show the fragments. package com.example.sample; import android.content.Intent; import android.os.Bundle; import android.support.v4.app.Fragment; import android.support.v4.app.FragmentTransaction; import android.support.v4.app.NavUtils; import android.widget.ArrayAdapter; import android.widget.ListView; import com.actionbarsherlock.app.ActionBar; import com.actionbarsherlock.app.ActionBar.Tab; import com.actionbarsherlock.app.SherlockFragmentActivity; import com.actionbarsherlock.view.MenuItem; /** * An activity representing a single Course detail screen. This activity is only * used on handset devices. On tablet-size devices, item details are presented * side-by-side with a list of items in a {@link CourseListActivity}. * <p> * This activity is mostly just a 'shell' activity containing nothing more than * a {@link CourseDetailFragment}. */ public class CourseDetailActivity extends SherlockFragmentActivity { @Override protected void onCreate(Bundle savedInstanceState) { super.onCreate(savedInstanceState); setContentView(R.layout.activity_course_detail); // Show the Up button in the action bar. ActionBar actionBar = getSupportActionBar(); actionBar.setDisplayHomeAsUpEnabled(true); actionBar.setNavigationMode(ActionBar.NAVIGATION_MODE_TABS); // initiating both tabs and set text to it. ActionBar.Tab assignTab = actionBar.newTab().setText("Assignments"); ActionBar.Tab schedTab = actionBar.newTab().setText("Schedule"); ActionBar.Tab contactTab = actionBar.newTab().setText("Contact"); // Create three fragments to display content Fragment assignFragment = new Assignments(); Fragment schedFragment = new Schedule(); Fragment contactFragment = new Contact(); assignTab.setTabListener(new MyTabsListener(assignFragment)); schedTab.setTabListener(new MyTabsListener(schedFragment)); contactTab.setTabListener(new MyTabsListener(contactFragment)); actionBar.addTab(assignTab); actionBar.addTab(schedTab); actionBar.addTab(contactTab); ListView listView = (ListView) findViewById(R.id.assignlist); String[] values = new String[] { "Android", "iPhone", "WindowsMobile", "Blackberry", "WebOS", "Ubuntu", "Windows7", "Max OS X", "Linux", "OS/2" }; // First paramenter - Context // Second parameter - Layout for the row // Third parameter - ID of the TextView to which the data is written // Forth - the Array of data ArrayAdapter<String> adapter = new ArrayAdapter<String>(this, android.R.layout.simple_list_item_1, android.R.id.text1, values); // Assign adapter to ListView listView.setAdapter(adapter); } @Override public boolean onOptionsItemSelected(MenuItem item) { switch (item.getItemId()) { case android.R.id.home: // This ID represents the Home or Up button. In the case of this // activity, the Up button is shown. Use NavUtils to allow users // to navigate up one level in the application structure. For // more details, see the Navigation pattern on Android Design: // // http://developer.android.com/design/patterns/navigation.html#up-vs-back // NavUtils.navigateUpTo(this, new Intent(this, CourseListActivity.class)); return true; } return super.onOptionsItemSelected(item); } class MyTabsListener implements ActionBar.TabListener { public Fragment fragment; public Fragment fragment2; public MyTabsListener(Fragment fragment) { this.fragment = fragment; } @Override public void onTabReselected(Tab tab, FragmentTransaction ft) { } @Override public void onTabSelected(Tab tab, FragmentTransaction ft) { ft.replace(R.id.main_across, fragment); } @Override public void onTabUnselected(Tab tab, FragmentTransaction ft) { ft.remove(fragment); } } } The fragment that I am currently trying to get working is called the Assignments fragment. As you can see in the CourseDetailActvity, I populate smaple items in the listview to see if it the listview shows up. The fragment gets inflated properly, but when I try to add items to the listview, the application crashes! Here is the logcat. 11-17 11:54:28.037: E/AndroidRuntime(282): FATAL EXCEPTION: main 11-17 11:54:28.037: E/AndroidRuntime(282): java.lang.RuntimeException: Unable to start activity ComponentInfo{com.example.sample/com.example.sample.CourseDetailActivity}: java.lang.NullPointerException 11-17 11:54:28.037: E/AndroidRuntime(282): at android.app.ActivityThread.performLaunchActivity(ActivityThread.java:2663) 11-17 11:54:28.037: E/AndroidRuntime(282): at android.app.ActivityThread.handleLaunchActivity(ActivityThread.java:2679) 11-17 11:54:28.037: E/AndroidRuntime(282): at android.app.ActivityThread.access$2300(ActivityThread.java:125) 11-17 11:54:28.037: E/AndroidRuntime(282): at android.app.ActivityThread$H.handleMessage(ActivityThread.java:2033) 11-17 11:54:28.037: E/AndroidRuntime(282): at android.os.Handler.dispatchMessage(Handler.java:99) 11-17 11:54:28.037: E/AndroidRuntime(282): at android.os.Looper.loop(Looper.java:123) 11-17 11:54:28.037: E/AndroidRuntime(282): at android.app.ActivityThread.main(ActivityThread.java:4627) 11-17 11:54:28.037: E/AndroidRuntime(282): at java.lang.reflect.Method.invokeNative(Native Method) 11-17 11:54:28.037: E/AndroidRuntime(282): at java.lang.reflect.Method.invoke(Method.java:521) 11-17 11:54:28.037: E/AndroidRuntime(282): at com.android.internal.os.ZygoteInit$MethodAndArgsCaller.run(ZygoteInit.java:868) 11-17 11:54:28.037: E/AndroidRuntime(282): at com.android.internal.os.ZygoteInit.main(ZygoteInit.java:626) 11-17 11:54:28.037: E/AndroidRuntime(282): at dalvik.system.NativeStart.main(Native Method) 11-17 11:54:28.037: E/AndroidRuntime(282): Caused by: java.lang.NullPointerException 11-17 11:54:28.037: E/AndroidRuntime(282): at com.example.sample.CourseDetailActivity.onCreate(CourseDetailActivity.java:66) 11-17 11:54:28.037: E/AndroidRuntime(282): at android.app.Instrumentation.callActivityOnCreate(Instrumentation.java:1047) 11-17 11:54:28.037: E/AndroidRuntime(282): at android.app.ActivityThread.performLaunchActivity(ActivityThread.java:2627) 11-17 11:54:28.037: E/AndroidRuntime(282): ... 11 more

    Read the article

  • spring mvc forward to jsp

    - by jerluc
    I currently have my web.xml configured to catch 404s and send them to my spring controller which will perform a search given the original URL request. The functionality is all there as far as the catch and search go, however the trouble begins to arise when I try to return a view. <bean class="org.springframework.web.servlet.view.ContentNegotiatingViewResolver" p:order="1"> <property name="mediaTypes"> <map> <entry key="json" value="application/json" /> <entry key="jsp" value="text/html" /> </map> </property> <property name="defaultContentType" value="application/json" /> <property name="favorPathExtension" value="true" /> <property name="viewResolvers"> <list> <bean class="org.springframework.web.servlet.view.BeanNameViewResolver" /> <bean id="viewResolver" class="org.springframework.web.servlet.view.InternalResourceViewResolver"> <property name="prefix" value="/WEB-INF/jsp/" /> <property name="suffix" value="" /> </bean> </list> </property> <property name="defaultViews"> <list> <bean class="org.springframework.web.servlet.view.json.MappingJacksonJsonView" /> </list> </property> <property name="ignoreAcceptHeader" value="true" /> </bean> This is a snippet from my MVC config file. The problem lies in resolving the view's path to the /WEB-INF/jsp/ directory. Using a logger in my JBoss setup, I can see that when I test this search controller by going to a non-existent page, the following occurs: Server can't find the request Request is sent to 404 error page (in this case my search controller) Search controller performs search Search controller returns view name (for this illustration, we'll assume test.jsp is returned) Based off of server logger, I can see that org.springframework.web.servlet.view.JstlView is initialized once my search controller returns the view name (so I can assume it is being picked up correctly by the InternalResourceViewResolver) Server attempts to return content to browser resulting in a 404! A couple things confuse me about this: I'm not 100% sure why this isn't resolving when test.jsp clearly exists under the /WEB-INF/jsp/ directory. Even if there was some other problem, why would this result in a 404? Shouldn't a 404 error page that results in another 404 theoretically create an infinite loop? Thanks for any help or pointers! Controller class [incomplete]: @Controller public class SiteMapController { //-------------------------------------------------------------------------------------- @Autowired(required=true) private SearchService search; @Autowired(required=true) private CatalogService catalog; //-------------------------------------------------------------------------------------- @RequestMapping(value = "/sitemap", method = RequestMethod.GET) public String sitemap (HttpServletRequest request, HttpServletResponse response) { String forwardPath = ""; try { long startTime = System.nanoTime() / 1000000; String pathQuery = (String) request.getAttribute("javax.servlet.error.request_uri"); Scanner pathScanner = new Scanner(pathQuery).useDelimiter("\\/"); String context = pathScanner.next(); List<ProductLightDTO> results = new ArrayList<ProductLightDTO>(); StringBuilder query = new StringBuilder(); String currentValue; while (pathScanner.hasNext()) { currentValue = pathScanner.next().toLowerCase(); System.out.println(currentValue); if (query.length() > 0) query.append(" AND "); if (currentValue.contains("-")) { query.append("\""); query.append(currentValue.replace("-", " ")); query.append("\""); } else { query.append(currentValue + "*"); } } //results.addAll(this.doSearch(query.toString())); System.out.println("Request: " + pathQuery); System.out.println("Built Query:" + query.toString()); //System.out.println("Result size: " + results.size()); long totalTime = (System.nanoTime() / 1000000) - startTime; System.out.println("Total TTP: " + totalTime + "ms"); if (results == null || results.size() == 0) { forwardPath = "home.jsp"; } else if (results.size() == 1) { forwardPath = "product.jsp"; } else { forwardPath = "category.jsp"; } } catch (Exception ex) { System.err.println(ex); } System.out.println("Returning view: " + forwardPath); return forwardPath; } }

    Read the article

  • Replacing objects, handling clones, dealing with write logs

    - by Alix
    Hi everyone, I'm dealing with a problem I can't figure out how to solve, and I'd love to hear some suggestions. [NOTE: I realise I'm asking several questions; however, answers need to take into account all of the issues, so I cannot split this into several questions] Here's the deal: I'm implementing a system that underlies user applications and that protect shared objects from concurrent accesses. The application programmer (whose application will run on top of my system) defines such shared objects like this: public class MyAtomicObject { // These are just examples of fields you may want to have in your class. public virtual int x { get; set; } public virtual List<int> list { get; set; } public virtual MyClassA objA { get; set; } public virtual MyClassB objB { get; set; } } As you can see they declare the fields of their class as auto-generated properties (auto-generated means they don't need to implement get and set). This is so that I can go in and extend their class and implement each get and set myself in order to handle possible concurrent accesses, etc. This is all well and good, but now it starts to get ugly: the application threads run transactions, like this: The thread signals it's starting a transaction. This means we now need to monitor its accesses to the fields of the atomic objects. The thread runs its code, possibly accessing fields for reading or writing. If there are accesses for writing, we'll hide them from the other transactions (other threads), and only make them visible in step 3. This is because the transaction may fail and have to roll back (undo) its updates, and in that case we don't want other threads to see its "dirty" data. The thread signals it wants to commit the transaction. If the commit is successful, the updates it made will now become visible to everyone else. Otherwise, the transaction will abort, the updates will remain invisible, and no one will ever know the transaction was there. So basically the concept of transaction is a series of accesses that appear to have happened atomically, that is, all at the same time, in the same instant, which would be the moment of successful commit. (This is as opposed to its updates becoming visible as it makes them) In order to hide the write accesses in step 2, I clone the accessed field (let's say it's the field list) and put it in the transaction's write log. After that, any time the transaction accesses list, it will actually be accessing the clone in its write log, and not the global copy everyone else sees. Like this, any changes it makes will be done to the (invisible) clone, not to the global copy. If in step 3 the commit is successful, the transaction should replace the global copy with the updated list it has in its write log, and then the changes become visible for everyone else at once. It would be something like this: myAtomicObject.list = updatedCloneOfListInTheWriteLog; Problem #1: possible references to the list. Let's say someone puts a reference to the global list in a dictionary. When I do... myAtomicObject.list = updatedCloneOfListInTheWriteLog; ...I'm just replacing the reference in the field list, but not the real object (I'm not overwriting the data), so in the dictionary we'll still have a reference to the old version of the list. A possible solution would be to overwrite the data (in the case of a list, empty the global list and add all the elements of the clone). More generically, I would need to copy the fields of one list to the other. I can do this with reflection, but that's not very pretty. Is there any other way to do it? Problem #2: even if problem #1 is solved, I still have a similar problem with the clone: the application programmer doesn't know I'm giving him a clone and not the global copy. What if he puts the clone in a dictionary? Then at commit there will be some references to the global copy and some to the clone, when in truth they should all point to the same object. I thought about providing a wrapper object that contains both the cloned list and a pointer to the global copy, but the programmer doesn't know about this wrapper, so they're not going to use the pointer at all. The wrapper would be like this: public class Wrapper<T> : T { // This would be the pointer to the global copy. The local data is contained in whatever fields the wrapper inherits from T. private T thisPtr; } I do need this wrapper for comparisons: if I have a dictionary that has an entry with the global copy as key, if I look it up with the clone, like this: dictionary[updatedCloneOfListInTheWriteLog] I need it to return the entry, that is, to think that updatedCloneOfListInTheWriteLog and the global copy are the same thing. For this, I can just override Equals, GetHashCode, operator== and operator!=, no problem. However I still don't know how to solve the case in which the programmer unknowingly inserts a reference to the clone in a dictionary. Problem #3: the wrapper must extend the class of the object it wraps (if it's wrapping MyClassA, it must extend MyClassA) so that it's accepted wherever an object of that class (MyClass) would be accepted. However, that class (MyClassA) may be final. This is pretty horrible :$. Any suggestions? I don't need to use a wrapper, anything you can think of is fine. What I cannot change is the write log (I need to have a write log) and the fact that the programmer doesn't know about the clone. I hope I've made some sense. Feel free to ask for more info if something needs some clearing up. Thanks so much!

    Read the article

  • Improving HTML scrapper efficiency with pcntl_fork()

    - by Michael Pasqualone
    With the help from two previous questions, I now have a working HTML scrapper that feeds product information into a database. What I am now trying to do is improve efficiently by wrapping my brain around with getting my scrapper working with pcntl_fork. If I split my php5-cli script into 10 separate chunks, I improve total runtime by a large factor so I know I am not i/o or cpu bound but just limited by the linear nature of my scraping functions. Using code I've cobbled together from multiple sources, I have this working test: <?php libxml_use_internal_errors(true); ini_set('max_execution_time', 0); ini_set('max_input_time', 0); set_time_limit(0); $hrefArray = array("http://slashdot.org", "http://slashdot.org", "http://slashdot.org", "http://slashdot.org"); function doDomStuff($singleHref,$childPid) { $html = new DOMDocument(); $html->loadHtmlFile($singleHref); $xPath = new DOMXPath($html); $domQuery = '//div[@id="slogan"]/h2'; $domReturn = $xPath->query($domQuery); foreach($domReturn as $return) { $slogan = $return->nodeValue; echo "Child PID #" . $childPid . " says: " . $slogan . "\n"; } } $pids = array(); foreach ($hrefArray as $singleHref) { $pid = pcntl_fork(); if ($pid == -1) { die("Couldn't fork, error!"); } elseif ($pid > 0) { // We are the parent $pids[] = $pid; } else { // We are the child $childPid = posix_getpid(); doDomStuff($singleHref,$childPid); exit(0); } } foreach ($pids as $pid) { pcntl_waitpid($pid, $status); } // Clear the libxml buffer so it doesn't fill up libxml_clear_errors(); Which raises the following questions: 1) Given my hrefArray contains 4 urls - if the array was to contain say 1,000 product urls this code would spawn 1,000 child processes? If so, what is the best way to limit the amount of processes to say 10, and again 1,000 urls as an example split the child work load to 100 products per child (10 x 100). 2) I've learn that pcntl_fork creates a copy of the process and all variables, classes, etc. What I would like to do is replace my hrefArray variable with a DOMDocument query that builds the list of products to scrape, and then feeds them off to child processes to do the processing - so spreading the load across 10 child workers. My brain is telling I need to do something like the following (obviously this doesn't work, so don't run it): <?php libxml_use_internal_errors(true); ini_set('max_execution_time', 0); ini_set('max_input_time', 0); set_time_limit(0); $maxChildWorkers = 10; $html = new DOMDocument(); $html->loadHtmlFile('http://xxxx'); $xPath = new DOMXPath($html); $domQuery = '//div[@id=productDetail]/a'; $domReturn = $xPath->query($domQuery); $hrefsArray[] = $domReturn->getAttribute('href'); function doDomStuff($singleHref) { // Do stuff here with each product } // To figure out: Split href array into $maxChilderWorks # of workArray1, workArray2 ... workArray10. $pids = array(); foreach ($workArray(1,2,3 ... 10) as $singleHref) { $pid = pcntl_fork(); if ($pid == -1) { die("Couldn't fork, error!"); } elseif ($pid > 0) { // We are the parent $pids[] = $pid; } else { // We are the child $childPid = posix_getpid(); doDomStuff($singleHref); exit(0); } } foreach ($pids as $pid) { pcntl_waitpid($pid, $status); } // Clear the libxml buffer so it doesn't fill up libxml_clear_errors(); But what I can't figure out is how to build my hrefsArray[] in the master/parent process only and feed it off to the child process. Currently everything I've tried causes loops in the child processes. I.e. my hrefsArray gets built in the master, and in each subsequent child process. I am sure I am going about this all totally wrong, so would greatly appreciate just general nudge in the right direction.

    Read the article

  • Jquery mobile page structure

    - by Die 20
    I built a jquery mobile site a while back and I have recently been expanding on it and noticing performance issues. I believe it is because I constructed the site using a multi-page set up where a single php file houses the following pages: **ALL_PAGES.PHP** <html> <head> /* external css and js files */ </head> <body> <div date-role="page" id="main"> <div class="page_link"> page 1 </div> <div class="page_link"> page 2 </div> <div class="page_link"> page 3 </div> </div> <div date-role="page" id="page 1"> <div class="page_link"> main </div> <div class="page_link"> page 2 </div> <div class="page_link"> page 3 </div> </div> <div date-role="page" id="page 2"> <div class="page_link"> main </div> <div class="page_link"> page 1 </div> <div class="page_link"> page 3 </div> </div> <div date-role="page" id="page 3"> <div class="page_link"> main </div> <div class="page_link"> page 1 </div> <div class="page_link"> page 2 </div> </div> </body> </html> **end ALL_PAGES.PHP ** I want to break away from this multi-page setup on one php file, and move to a setup where each page is a separate php file. To accomplish this I took the html from each page and moved it to its own php page. Then I added href links in replace of the mobile.change() functions I used for the "page_link" classes. **MAIN.PHP** <html> <head> external css and js files </head> <body> <div date-role="page" id="page 1"> <a href="/main.php"> main </a> <a href="/page_2.php"> page 2 </a> <a href="/page_3.php"> page 3 </a> </div> </body> </html> **end MAIN.PHP** **PAGE_1.PHP** <div date-role="page" id="page 1"> <a href="/main.php"> main </a> <a href="/page_2.php"> page 2 </a> <a href="/page_3.php"> page 3 </a> </div> **end PAGE_1.PHP** **PAGE_2.PHP** <div date-role="page" id="page 2"> <a href="/main.php"> main </a> <a href="/page_1.php"> page 1 </a> <a href="/page_3.php"> page 3 </a> </div> **end PAGE_2.PHP** **PAGE_3.PHP** <div date-role="page" id="page 3"> <a href="/main.php"> main </a> <a href="/page_1.php"> page 1 </a> <a href="/page_2.php"> page 2 </a> </div> **end PAGE_3.PHP** The site works fine except when the user hits the refresh button in the browser. When that happens each page loses access to any external css and js files located on the main page. I am fairly new to JQM so any advice would be helpful.

    Read the article

  • how to use TinyMCE(rich text editor) in google-maps info window..

    - by zjm1126
    this is the demo rar file:http://omploader.org/vM3U1bA when i drag the red block to the google-maps ,it will be changed to a marker, and it will has TinyMCE when you click the info window, but my program is : it can not be written when i click it the second time, the first time: the second time(can not be written): and my code is : <!DOCTYPE html PUBLIC "-//WAPFORUM//DTD XHTML Mobile 1.0//EN" "http://www.wapforum.org/DTD/xhtml-mobile10.dtd"> <html xmlns="http://www.w3.org/1999/xhtml" > <head> <meta http-equiv="Content-Type" content="text/html; charset=UTF-8"> <meta name="viewport" content="width=device-width,minimum-scale=0.3,maximum-scale=5.0,user-scalable=yes"> </head> <body onload="initialize()" onunload="GUnload()"> <style type="text/css"> *{ margin:0; padding:0; } </style> <!--<div style="width:100px;height:100px;background:blue;"> </div>--> <div id="map_canvas" style="width: 500px; height: 300px;"></div> <div class=b style="width: 20px; height: 20px;background:red;position:absolute;left:700px;top:200px;"></div> <div class=b style="width: 20px; height: 20px;background:red;position:absolute;left:700px;top:200px;"></div> <script src="jquery-1.4.2.js" type="text/javascript"></script> <script type="text/javascript" src="tiny_mce.js"></script> <script src="jquery-ui-1.8rc3.custom.min.js" type="text/javascript"></script> <script src="http://maps.google.com/maps?file=api&amp;v=2&amp;key=ABQIAAAA-7cuV3vqp7w6zUNiN_F4uBRi_j0U6kJrkFvY4-OX2XYmEAa76BSNz0ifabgugotzJgrxyodPDmheRA&sensor=false"type="text/javascript"></script> <script type="text/javascript"> var aFn; //********** function initialize() { if (GBrowserIsCompatible()) { var map = new GMap2(document.getElementById("map_canvas")); var center=new GLatLng(39.9493, 116.3975); map.setCenter(center, 13); aFn=function(x,y){ var point =new GPoint(x,y) point = map.fromContainerPixelToLatLng(point); //console.log(point.x+" "+point.y) var marker = new GMarker(point,{draggable:true}); var a=$( '<form method="post" action="" style="height:100px;overflow:hidden;width:220px;">'+ '<textarea id="" class="mce" name="content" cols="22" rows="5" style="border:none">sss</textarea>'+ '</form>') a.click(function(){ // }) GEvent.addListener(marker, "click", function() { marker.openInfoWindowHtml(a[0]); }); /****************** GEvent.addListener(marker, 'click', function() { marker.openInfoWindowHtml('<div contentEditable="true" ' + 'style="height: 100px; overflow: auto;">' + 'wwww</div>'); }); ***************/ map.addOverlay(marker); /********** var marker = new GMarker(point, {draggable: true}); GEvent.addListener(marker, "dragstart", function() { map.closeInfoWindow(); }); GEvent.addListener(marker, "dragend", function() { marker.openInfoWindowHtml("????..."); }); map.addOverlay(marker); //*/ } $(".b").draggable({ revert: true, revertDuration: 0 }); $("#map_canvas").droppable({ drop: function(event,ui) { //console.log(ui.offset.left+' '+ui.offset.top) aFn(event.pageX-$("#map_canvas").offset().left,event.pageY-$("#map_canvas").offset().top); } }); } } //********** $(".mce").live("click", function(){ var once=0; mce(); }); function mce(once){ if(once)return; tinyMCE.init({ // General options mode : "textareas", theme : "advanced", plugins : "safari,pagebreak,style,layer,table,save,advhr,advimage,advlink,emotions,iespell,inlinepopups,insertdatetime,preview,media,searchreplace,print,contextmenu,paste,directionality,fullscreen,noneditable,visualchars,nonbreaking,xhtmlxtras,template", // Theme options theme_advanced_buttons1 : "bold,forecolor,|,justifyleft,justifycenter,justifyright,|,fontsizeselect", theme_advanced_buttons2 : "", theme_advanced_buttons3 : "", theme_advanced_buttons4 : "", theme_advanced_toolbar_location : "top", theme_advanced_toolbar_align : "left", theme_advanced_statusbar_location : "bottom", theme_advanced_resizing : true, // Example content CSS (should be your site CSS) content_css : "css/example.css", // Drop lists for link/image/media/template dialogs template_external_list_url : "js/template_list.js", external_link_list_url : "js/link_list.js", external_image_list_url : "js/image_list.js", media_external_list_url : "js/media_list.js", // Replace values for the template plugin template_replace_values : { username : "Some User", staffid : "991234" } }); once=1; } //********** </script> </body> </html>

    Read the article

  • How to detect crashing tabed webbrowser and handle it?

    - by David Eaton
    I have a desktop application (forms) with a tab control, I assign a tab and a new custom webrowser control. I open up about 10 of these tabs. Each one visits about 100 - 500 different pages. The trouble is that if 1 webbrowser control has a problem it shuts down the entire program. I want to be able to close the offending webbrowser control and open a new one in it's place. Is there any event that I need to subscribe to catch a crashing or unresponsive webbrowser control ? I am using C# on windows 7 (Forms), .NET framework v4 =============================================================== UPDATE: 1 - The Tabbed WebBrowser Example Here is the code I have and How I use the webbrowser control in the most basic way. Create a new forms project and name it SimpleWeb Add a new class and name it myWeb.cs, here is the code to use. using System; using System.Collections.Generic; using System.Linq; using System.Text; using System.Windows.Forms; using System.Security.Policy; namespace SimpleWeb { //inhert all of webbrowser class myWeb : WebBrowser { public myWeb() { //no javascript errors this.ScriptErrorsSuppressed = true; //Something we want set? AssignEvents(); } //keep near the top private void AssignEvents() { //assign WebBrowser events to our custom methods Navigated += myWeb_Navigated; DocumentCompleted += myWeb_DocumentCompleted; Navigating += myWeb_Navigating; NewWindow += myWeb_NewWindow; } #region Events //List of events:http://msdn.microsoft.com/en-us/library/system.windows.forms.webbrowser_events%28v=vs.100%29.aspx //Fired when a new windows opens private void myWeb_NewWindow(object sender, System.ComponentModel.CancelEventArgs e) { //cancel all popup windows e.Cancel = true; //beep to let you know canceled new window Console.Beep(9000, 200); } //Fired before page is navigated (not sure if its before or during?) private void myWeb_Navigating(object sender, System.Windows.Forms.WebBrowserNavigatingEventArgs args) { } //Fired after page is navigated (but not loaded) private void myWeb_Navigated(object sender, System.Windows.Forms.WebBrowserNavigatedEventArgs args) { } //Fired after page is loaded (Catch 22 - Iframes could be considered a page, can fire more than once. Ads are good examples) private void myWeb_DocumentCompleted(System.Object sender, System.Windows.Forms.WebBrowserDocumentCompletedEventArgs args) { } #endregion //Answer supplied by mo. (modified)? public void OpenUrl(string url) { try { //this.OpenUrl(url); this.Navigate(url); } catch (Exception ex) { MessageBox.Show("Your App Crashed! Because = " + ex.ToString()); //MyApplication.HandleException(ex); } } //Keep near the bottom private void RemoveEvents() { //Remove Events Navigated -= myWeb_Navigated; DocumentCompleted -= myWeb_DocumentCompleted; Navigating -= myWeb_Navigating; NewWindow -= myWeb_NewWindow; } } } On Form1 drag a standard tabControl and set the dock to fill, you can go into the tab collection and delete the pre-populated tabs if you like. Right Click on Form1 and Select "View Code" and replace it with this code. using System; using System.Collections.Generic; using System.ComponentModel; using System.Data; using System.Drawing; using System.Linq; using System.Text; using System.Windows.Forms; using mshtml; namespace SimpleWeb { public partial class Form1 : Form { public Form1() { InitializeComponent(); //Load Up 10 Tabs for (int i = 0; i <= 10; i++) { newTab("Test_" + i, "http://wwww.yahoo.com"); } } private void newTab(string Title, String Url) { //Create a new Tab TabPage newTab = new TabPage(); newTab.Name = Title; newTab.Text = Title; //create webbrowser Instance myWeb newWeb = new myWeb(); //Add webbrowser to new tab newTab.Controls.Add(newWeb); newWeb.Dock = DockStyle.Fill; //Add New Tab to Tab Pages tabControl1.TabPages.Add(newTab); newWeb.OpenUrl(Url); } } } Save and Run the project. Using the answer below by mo. , you can surf the first url with no problem, but what about all the urls the user clicks on? How do we check those? I prefer not to add events to every single html element on a page, there has to be a way to run the new urls thru the function OpenUrl before it navigates without having an endless loop. Thanks.

    Read the article

  • Javascript: selfmade methods not working correctly

    - by hdr
    Hi everyone, I tried to figure this out for some days now, I tried to use my own object to sort of replace the global object to reduce problems with other scripts (userscripts, chrome extensions... that kind of stuff). However I can't get things to work for some reason. I tried some debugging with JSLint, the developer tools included in Google Chrome, Firebug and the integrated schript debugger in IE8 but there is no error that explains why it doesn't work at all in any browser I tried. I tried IE 8, Google Chrome 10.0.612.3 dev, Firefox 3.6.13, Safari 5.0.3 and Opera 11. So... here is the code: HTML: <!DOCTYPE HTML> <html manifest="c.manifest"> <head> <meta http-equiv="X-UA-Compatible" content="IE=edge,chrome=1"> <meta charset="utf-8"> <!--[if IE]> <script type="text/javascript" src="http://ajax.googleapis.com/ajax/libs/chrome-frame/1/CFInstall.min.js"></script> <script src="https://ie7-js.googlecode.com/svn/version/2.1(beta4)/IE9.js">IE7_PNG_SUFFIX=".png";</script> <![endif]--> <!--[if lt IE 9]> <script src="js/lib/excanvas.js"></script> <script src="https://html5shiv.googlecode.com/svn/trunk/html5.js"></script> <![endif]--> <script src="js/data.js"></script> </head> <body> <div id="controls"> <button onclick="MYOBJECTis.next()">Next</button> </div> <div id="textfield"></div> <canvas id="game"></canvas> </body> </html> Javascript: var that = window, it = document, k = Math.floor; var MYOBJECTis = { aresizer: function(){ // This method looks like it doesn't work. // It should automatically resize all the div elements and the body. // JSLint: no error (execpt for "'window' is not defined." which is normal since // JSLint does nor recognize references to the global object like "window" or "self" // even if you assume a browser) // Firebug: no error // Chrome dev tools: no error // IE8: that.documentElement.clientWidth is null or not an object "use strict"; var a = that.innerWidth || that.documentElement.clientWidth, d = that.innerHeight || that.documentElement.clientHeight; (function() { for(var b = 0, c = it.getElementsByTagName("div");b < c.length;b++) { c.style.width = k(c.offsetWidth) / 100 * k(a); c.style.height = k(c.offsetHight) / 100 * k(d); } }()); (function() { var b = it.getElementsByTagName("body"); b.width = a; b.height = d; }()); }, next: function(){ // This method looks like it doesn't work. // It should change the text inside a div element // JSLint: no error (execpt for "'window' is not defined.") // Firebug: no error // Chrome dev tools: no error // IE8: no error (execpt for being painfully slow) "use strict"; var b = it.getElementById("textfield"), a = [], c; switch(c !== typeof Number){ case true: a[1] = ["HI"]; c = 0; break; case false: return Error; default: b.innerHtml = a[c]; c+=1; } } }; // auto events (function(){ "use strict"; that.onresize = MYOBJECTis.aresizer(); }()); If anyone can help me out with this I would very much appreciate it. EDIT: To answer the question what's not working I can just say that no method I showed here is working at all and I don't know the cause of the problem. I also tried to clean up some of the code that has most likely nothing to do with it. Additional information is in the comments inside the code.

    Read the article

  • Javascript game with css position

    - by newb125505
    I am trying to make a very simple helicopter game in javascript and I'm currently using css positions to move the objects. but I wanted to know if there was a better/other method for moving objects (divs) when a user is pressing a button here's a code i've got so far.. <!DOCTYPE html PUBLIC "-//W3C//DTD XHTML 1.0 Transitional//EN" "http://www.w3.org/TR/xhtml1/DTD/xhtml1-transitional.dtd"> <html xmlns="http://www.w3.org/1999/xhtml"> <head> <meta http-equiv="Content-Type" content="text/html; charset=utf-8" /> <title>Game 2 helicopter</title> <script type="text/javascript"> function num(x){ return parseInt(x.replace(/([^0-9]+)/g,'')); } function getPos(x, y){ var inum=Math.floor(Math.random()*(y+1-x)) + x; inum=inum; return inum; } function setTop(x,y){ x.style.top = y+'px'; } function setBot(x,y){ x.style.bottom = y+'px'; } function setLeft(x,y){ x.style.left = y+'px'; } function setRight(x,y){ x.style.right = y+'px'; } function getTop(x){ return num(x.style.top); } function getBot(x){ return num(x.style.bottom); } function getLeft(x){ return num(x.style.left); } function getRight(x){ return num(x.style.right); } function moveLeft(x,y){ var heli = document.getElementById('heli'); var obj = document.getElementById('obj'); var poss = [20,120,350,400]; var r_pos = getPos(1,4); var rand_pos = poss[r_pos]; xleft = getLeft(x)-y; if(xleft>0){ xleft=xleft; } else{ xleft=800; setTop(x,rand_pos); } setLeft(x,xleft); setTimeout(function(){moveLeft(x,y)},10); checkGame(heli,obj); } var heli; var obj; function checkGame(x,y){ var obj_right = getLeft(x) + 100; var yt = getTop(y); var yb = (getTop(y)+100); if(getTop(x) >= yt && getTop(x) <= yb && obj_right==getLeft(y)){ endGame(); } } function func(){ var x = document.getElementById('heli'); var y = document.getElementById('obj'); alert(getTop(x)+' '+getTop(y)+' '+(getTop(y)+200)); } function startGame(e){ document.getElementById('park').style.display='block'; document.getElementById('newgame').style.display='none'; heli = document.getElementById('heli'); obj = document.getElementById('obj'); hp = heli.style.top; op = obj.style.top; setTop(heli,20); setLeft(heli,20); setLeft(obj,800); setTop(obj,20); moveLeft(obj,5); } function newGameLoad(){ document.getElementById('park').style.display='none'; document.getElementById('newgame').style.display='block'; } function gamePos(e){ heli = document.getElementById('heli'); obj = document.getElementById('obj'); var keynum; var keychar; var numcheck; if(window.event){ // IE keynum = e.keyCode; } else if(e.which){ // Netscape/Firefox/Opera keynum = e.which; } keychar = String.fromCharCode(keynum); // up=38 down=40 left=37 right=39 /*if(keynum==37){ //left tl=tl-20; db.style.left = tl + 'px'; } if(keynum==39){ //right //stopPos(); tl=tl+20; db.style.left = tl + 'px'; }*/ curb = getTop(heli); if(keynum==38){ //top setTop(heli,curb-10); //alert(curb+10); } if(keynum==40){ //bottom setTop(heli,curb+10); //alert(curb-10); } } function endGame(){ clearTimeout(); newGameLoad(); } </script> <style type="text/css"> .play{position:absolute;color:#fff;} #heli{background:url(http://classroomclipart.com/images/gallery/Clipart/Transportation/Helicopter/TN_00-helicopter2.jpg);width:150px;height:59px;} #obj{background:red;width:20px;height:200px;} .park{height:550px;border:5px solid brown;border-left:none;border-right:none;} #newgame{display:none;} </style> </head> <body onload="startGame();" onkeydown="gamePos(event);"> <div class="park" id="park"> <div id="heli" class="play"></div> <div id="obj" class="play"></div> </div> <input type="button" id="newgame" style="position:absolute;top:25%;left:25%;" onclick="startGame();" value="New Game" /> </body> </html>

    Read the article

  • c#: sms appears to have been sent, but stuck in phone outbox

    - by I__
    i wrote code to send an SMS using my gsm phone which is attached to the computer through com port. the code is below. the problem is i do see that it is in the outbox of the phone and it actually appears to have been sent, but when i contact the recipient they say that i have not received the message. i test the phone, and i create and send a message using only the phone and it works perfectly, however when i do this with my code, it APPEARS to have been sent, and i am getting all the correct AT COMMAND responses from the phone, but the message is actually NOT sent. here is the code: using System; using System.Collections.Generic; using System.ComponentModel; using System.Data; using System.Drawing; using System.Linq; using System.Text; using System.Windows.Forms; using System.Threading; using System.IO.Ports; namespace WindowsFormsApplication1 { public partial class Form1 : Form { SerialPort serialPort1; int m_iTxtMsgState = 0; const int NUM_MESSAGE_STATES = 4; const string RESERVED_COM_1 = "COM1"; const string RESERVED_COM_4 = "COM4"; public Form1() { InitializeComponent(); this.Closing += new CancelEventHandler(Form1_Closing); } private void Form1_Load(object sender, EventArgs e) { serialPort1 = new SerialPort(GetUSBComPort()); if (serialPort1.IsOpen) { serialPort1.Close(); } serialPort1.Open(); //ThreadStart myThreadDelegate = new ThreadStart(ReceiveAndOutput); //Thread myThread = new Thread(myThreadDelegate); //myThread.Start(); this.serialPort1.DataReceived += new SerialDataReceivedEventHandler(sp_DataReceived); } private void Form1_Closing(object sender, System.ComponentModel.CancelEventArgs e) { serialPort1.Close(); } private void SendLine(string sLine) { serialPort1.Write(sLine); sLine = sLine.Replace("\u001A", ""); consoleOut.Text += sLine; } public void DoWork() { ProcessMessageState(); } public void ProcessMessageState() { switch (m_iTxtMsgState) { case 0: m_iTxtMsgState = 1; SendLine("AT\r\n"); //NOTE: SendLine must be the last thing called in all of these! break; case 1: m_iTxtMsgState = 2; SendLine("AT+CMGF=1\r\n"); break; case 2: m_iTxtMsgState = 3; SendLine("AT+CMGW=" + Convert.ToChar(34) + "+9737387467" + Convert.ToChar(34) + "\r\n"); break; case 3: m_iTxtMsgState = 4; SendLine("A simple demo of SMS text messaging." + Convert.ToChar(26)); break; case 4: m_iTxtMsgState = 5; break; case 5: m_iTxtMsgState = NUM_MESSAGE_STATES; break; } } private string GetStoredSMSID() { return null; } /* //i dont think this part does anything private void serialPort1_DataReceived_1(object sender, System.IO.Ports.SerialDataReceivedEventArgs e) { string response = serialPort1.ReadLine(); this.BeginInvoke(new MethodInvoker(() => textBox1.AppendText(response + "\r\n"))); } */ void sp_DataReceived(object sender, SerialDataReceivedEventArgs e) { try { Thread.Sleep(500); char[] msg; msg = new char[613]; int iNumToRead = serialPort1.BytesToRead; serialPort1.Read(msg, 0, iNumToRead); string response = new string(msg); this.BeginInvoke(new MethodInvoker(() => textBox1.AppendText(response + "\r\n"))); serialPort1.DiscardInBuffer(); if (m_iTxtMsgState == 4) { int pos_cmgw = response.IndexOf("+CMGW:"); string cmgw_num = response.Substring(pos_cmgw + 7, 4); SendLine("AT+CMSS=" + cmgw_num + "\r\n"); //stop listening to messages received } if (m_iTxtMsgState < NUM_MESSAGE_STATES) { ProcessMessageState(); } } catch { } } private void button1_Click(object sender, EventArgs e) { m_iTxtMsgState = 0; DoWork(); } private void button2_Click(object sender, EventArgs e) { string[] sPorts = SerialPort.GetPortNames(); foreach (string port in sPorts) { consoleOut.Text += port + "\r\n"; } } private string GetUSBComPort() { string[] sPorts = SerialPort.GetPortNames(); foreach (string port in sPorts) { if (port != RESERVED_COM_1 && port != RESERVED_COM_4) { return port; } } return null; } }

    Read the article

  • No view for id for fragment

    - by guillaume
    I'm trying to use le lib SlidingMenu in my app but i'm having some problems. I'm getting this error: 11-04 15:50:46.225: E/FragmentManager(21112): No view found for id 0x7f040009 (com.myapp:id/menu_frame) for fragment SampleListFragment{413805f0 #0 id=0x7f040009} BaseActivity.java package com.myapp; import android.support.v4.app.FragmentTransaction; import android.os.Bundle; import android.support.v4.app.ListFragment; import android.view.Menu; import android.view.MenuItem; import com.jeremyfeinstein.slidingmenu.lib.SlidingMenu; import com.jeremyfeinstein.slidingmenu.lib.app.SlidingFragmentActivity; public class BaseActivity extends SlidingFragmentActivity { private int mTitleRes; protected ListFragment mFrag; public BaseActivity(int titleRes) { mTitleRes = titleRes; } @Override public void onCreate(Bundle savedInstanceState) { super.onCreate(savedInstanceState); setTitle(mTitleRes); // set the Behind View setBehindContentView(R.layout.menu_frame); if (savedInstanceState == null) { FragmentTransaction t = this.getSupportFragmentManager().beginTransaction(); mFrag = new SampleListFragment(); t.replace(R.id.menu_frame, mFrag); t.commit(); } else { mFrag = (ListFragment) this.getSupportFragmentManager().findFragmentById(R.id.menu_frame); } // customize the SlidingMenu SlidingMenu slidingMenu = getSlidingMenu(); slidingMenu.setMode(SlidingMenu.LEFT); slidingMenu.setTouchModeAbove(SlidingMenu.TOUCHMODE_FULLSCREEN); slidingMenu.setShadowWidthRes(R.dimen.slidingmenu_shadow_width); slidingMenu.setShadowDrawable(R.drawable.slidingmenu_shadow); slidingMenu.setBehindOffsetRes(R.dimen.slidingmenu_offset); slidingMenu.setFadeDegree(0.35f); slidingMenu.setMenu(R.layout.slidingmenu); getActionBar().setDisplayHomeAsUpEnabled(true); } @Override public boolean onOptionsItemSelected(MenuItem item) { switch (item.getItemId()) { case android.R.id.home: toggle(); return true; } return super.onOptionsItemSelected(item); } @Override public boolean onCreateOptionsMenu(Menu menu) { getMenuInflater().inflate(R.menu.main, menu); return true; } } menu.xml <?xml version="1.0" encoding="utf-8"?> <fragment xmlns:android="http://schemas.android.com/apk/res/android" android:name="com.myapp.SampleListFragment" android:layout_width="match_parent" android:layout_height="match_parent" > </fragment> menu_frame.xml <?xml version="1.0" encoding="utf-8"?> <FrameLayout xmlns:android="http://schemas.android.com/apk/res/android" android:id="@+id/menu_frame" android:layout_width="match_parent" android:layout_height="match_parent" /> SampleListFragment.java package com.myapp; import android.content.Context; import android.os.Bundle; import android.support.v4.app.ListFragment; import android.view.LayoutInflater; import android.view.View; import android.view.ViewGroup; import android.widget.ArrayAdapter; import android.widget.ImageView; import android.widget.TextView; public class SampleListFragment extends ListFragment { public View onCreateView(LayoutInflater inflater, ViewGroup container, Bundle savedInstanceState) { return inflater.inflate(R.layout.list, null); } public void onActivityCreated(Bundle savedInstanceState) { super.onActivityCreated(savedInstanceState); SampleAdapter adapter = new SampleAdapter(getActivity()); for (int i = 0; i < 20; i++) { adapter.add(new SampleItem("Sample List", android.R.drawable.ic_menu_search)); } setListAdapter(adapter); } private class SampleItem { public String tag; public int iconRes; public SampleItem(String tag, int iconRes) { this.tag = tag; this.iconRes = iconRes; } } public class SampleAdapter extends ArrayAdapter<SampleItem> { public SampleAdapter(Context context) { super(context, 0); } public View getView(int position, View convertView, ViewGroup parent) { if (convertView == null) { convertView = LayoutInflater.from(getContext()).inflate(R.layout.row, null); } ImageView icon = (ImageView) convertView.findViewById(R.id.row_icon); icon.setImageResource(getItem(position).iconRes); TextView title = (TextView) convertView.findViewById(R.id.row_title); title.setText(getItem(position).tag); return convertView; } } } MainActivity.java package com.myapp; import java.util.ArrayList; import beans.Tweet; import database.DatabaseHelper; import adapters.TweetListViewAdapter; import android.os.Bundle; import android.widget.ListView; public class MainActivity extends BaseActivity { public MainActivity(){ super(R.string.app_name); } @Override public void onCreate(Bundle savedInstanceState) { super.onCreate(savedInstanceState); setContentView(R.layout.activity_main); final ListView listview = (ListView) findViewById(R.id.listview_tweets); DatabaseHelper db = new DatabaseHelper(this); ArrayList<Tweet> tweets = db.getAllTweets(); TweetListViewAdapter adapter = new TweetListViewAdapter(this, R.layout.listview_item_row, tweets); listview.setAdapter(adapter); setSlidingActionBarEnabled(false); } } I don't understand why the view menu_frame is not found because I have a view with the id menu_frame and this view is a child of the layout menu_frame.

    Read the article

  • CSS issue with margin: auto

    - by user1702273
    Hi am having an issue with the margin auto of my website where i have a wrapper div with the width set to 1000px and the margins top and bottom to 0 and left and right to auto. I have a navigation menu in the side bar, where i used java script to replace the same div with different tables. when i click a link in the menu the wrapper shifts right some px and the comes to original, I don't want that action i want the wrapper to be static and not to vary at any time. how can i achieve that. when i set the margin to just 0, so problem with positioning. But i want the wrapper to be centered. Here is my css code: body { background-color:#E2E3E4; color:#333; margin:0; padding:0; font-size: 12px; } #wrapper { width:1000px; margin:0 auto; margin-bottom:10px; } #header1 { width:1000px; height:44px; margin:0 auto; background-color:#ED6B06; } #header2 { width:1000px; height:40px; margin:0 auto; border-bottom:1px solid #EDE9DE; } #header3 { width:1000px; height:40px; margin:0 auto; border-bottom:1px solid #EDE9DE; } #header2 p { margin:0 auto; font-size:20pt; color: #364395; font-smooth: auto; margin-left:15px; margin-top:5px; } #welcome { width:600px; float:left; padding:10px; margin:0 auto; } #status{ margin:0 auto; width:50px; float:right; padding:10px; margin-top:3px; margin-right:15px; } #content { width:780px; float:right; } #sidebar { width:150px; margin-top:15px; margin-left:10px; float:left; border-right:1px solid #EDE9DE; margin-bottom:25px; } #footer { clear:both; margin:0 auto; width:1000px; height:44px; border-top:1px solid #EDE9DE; } HTML: <html> <head> <link rel="stylesheet" type="text/css" href="style/style.css" media="screen" /> <title>Pearson Schools Management Portal</title> </head> <body id="home"> <div id="wrapper"> <?php include('includes/header1.php'); ?> <?php include('includes/header2.php'); ?> <?php include('includes/header3.php'); ?> <div id="content"> <h2>Welcome to Portal!</h2> </div> <!-- end #content --> <?php include('includes/sidebar.php'); ?> <?php include('includes/footer.php'); ?> </div> <!-- End #wrapper --> <link rel="stylesheet" type="text/css" media="screen" href="http://ajax.googleapis.com/ajax/libs/jqueryui/1.7.2/themes/base/jquery-ui.css"> <script type="text/javascript" src="http://code.jquery.com/jquery-latest.js"></script> <script type="text/javascript" src="http://jzaefferer.github.com/jquery-validation/jquery.validate.js"></script> <script type="text/javascript" src="https://ajax.googleapis.com/ajax/libs/jqueryui/1.8.16/jquery-ui.min.js"></script> <?php include('scripts/index_data.js'); ?> </body>

    Read the article

  • Does this language feature already exist?

    - by Pindatjuh
    I'm currently developing a new language for programming in a continuous environment (compare it to electrical engineering), and I've got some ideas on a certain language construction. Let me explain the feature by explanation and then by definition: x = a U b; Where x is a variable and a and b are other variables (or static values). This works like a union between a and b; no duplicates and no specific order. with(x) { // regular 'with' usage; using the global interpretation of "x" x = 5; // will replace the original definition of "x = a U b;" } with(x = a) { // this code block is executed when the "x" variable // has the "a" variable assigned. All references in // this code-block to "x" are references to "a". So saying: x = 5; // would only change the variable "a". If the variable "a" // later on changes, x still equals to 5, in this fashion: // 'x = a U b U 5;' // '[currentscope] = 5;' // thus, 'a = 5;' } with(x = b) { // same but with "b" } with(x != a) { // here the "x" variable refers to any variable // but "a"; thus saying x = 5; // is equal to the rewriting of // 'x = a U b U 5;' // 'b = 5;' (since it was the scope of this block) } with(x = (a U b)) { // guaranteed that "x" is 'a U b'; interacting with "x" // will interact with both "a" and "b". x = 5; // makes both "a" and "b" equal to 5; also the "x" variable // is updated to contain: // 'x = a U b U 5;' // '[currentscope] = 5;' // 'a U b = 5;' // and thus: 'a = 5; b = 5;'. } // etc. In the above, all code-blocks are executed, but the "scope" changes in each block how x is interpreted. In the first block, x is guaranteed to be a: thus interacting with x inside that block will interact on a. The second and the third code-block are only equal in this situation (because not a: then there only remains b). The last block guarantees that x is at least a or b. Further more; U is not the "bitwise or operator", but I've called it the "and/or"-operator. Its definition is: "U" = "and" U "or" (On my blog, http://cplang.wordpress.com/2009/12/19/binop-and-or/, there is more (mathematical) background information on this operator. It's loosely based on sets. Using different syntax, changed it in this question.) Update: more examples. print = "Hello world!" U "How are you?"; // this will print // both values, but the // order doesn't matter. // 'userkey' is a variable containing a key. with(userkey = "a") { print = userkey; // will only print "a". } with(userkey = ("shift" U "a")) { // pressed both "shift" and the "a" key. print = userkey; // will "print" shift and "a", even // if the user also pressed "ctrl": // the interpretation of "userkey" is changed, // such that it only contains the matched cases. } with((userkey = "shift") U (userkey = "a")) { // same as if-statement above this one, showing the distributivity. } x = 5 U 6 U 7; y = x + x; // will be: // y = (5 U 6 U 7) + (5 U 6 U 7) // = 10 U 11 U 12 U 13 U 14 somewantedkey = "ctrl" U "alt" U "space" with(userkey = somewantedkey) { // must match all elements of "somewantedkey" // (distributed the Boolean equals operated) // thus only executed when all the defined keys are pressed } with(somewantedkey = userkey) { // matches only one of the provided "somewantedkey" // thus when only "space" is pressed, this block is executed. } Update2: more examples and some more context. with(x = (a U b)) { // this } // can be written as with((x = a) U (x = b)) { // this: changing the variable like x = 5; // will be rewritten as: // a = 5 and b = 5 } Some background information: I'm building a language which is "time-independent", like Java is "platform-independant". Everything stated in the language is "as is", and is continuously actively executed. This means; the programmer does not know in which order (unless explicitly stated using constructions) elements are, nor when statements are executed. The language is completely separated from the "time"-concept, i.e. it's continuously executed: with(a < 5) { a++; } // this is a loop-structure; // how and when it's executed isn't known however. with(a) { // everytime the "a" variable changes, this code-block is executed. b = 4; with(b < 3) { // runs only three times. } with(b > 0) { b = b - 1; // runs four times } } Update 3: After pondering on the type of this language feature; it closely resemblances Netbeans Platform's Lookup, where each "with"-statement a synchronized agent is, working on it's specific "filter" of objects. Instead of type-based, this is variable-based (fundamentally quite the same; just a different way of identifiying objects). I greatly thank all of you for providing me with very insightful information and links/hints to great topics I can research. Thanks. I do not know if this construction already exists, so that's my question: does this language feature already exist?

    Read the article

  • Parsing csv line to Java objects

    - by Noobling
    I was wondering if someone here could help me, I can't find a solution for my problem and I have tried everything. What I am trying to do is read and parse lines in a csv file into java objects and I have succeeded in doing that but after it reads all the lines it should insert the lines into the database but it only inserts the 1st line the entire time and I don't no why. When I do a print it shows that it is reading all the lines and placing them in the objects but as soon as I do the insert it wants to insert only the 1st line. Please see my code below: public boolean lineReader(File file){ BufferedReader br = null; String line= ""; String splitBy = ","; storeList = new ArrayList<StoreFile>(); try { br = new BufferedReader(new FileReader(file)); while((line = br.readLine())!=null){ line = line.replace('|', ','); //split on pipe ( | ) String[] array = line.split(splitBy, 14); //Add values from csv to store object //Add values from csv to storeF objects StoreFile StoreF = new StoreFile(); if (array[0].equals("H") || array[0].equals("T")) { return false; } else { StoreF.setRetailID(array[1].replaceAll("/", "")); StoreF.setChain(array[2].replaceAll("/","")); StoreF.setStoreID(array[3].replaceAll("/", "")); StoreF.setStoreName(array[4].replaceAll("/", "")); StoreF.setAddress1(array[5].replaceAll("/", "")); StoreF.setAddress2(array[6].replaceAll("/", "")); StoreF.setAddress3(array[7].replaceAll("/", "")); StoreF.setProvince(array[8].replaceAll("/", "")); StoreF.setAddress4(array[9].replaceAll("/", "")); StoreF.setCountry(array[10].replaceAll("/", "")); StoreF.setCurrency(array[11].replaceAll("/", "")); StoreF.setAddress5(array[12].replaceAll("/", "")); StoreF.setTelNo(array[13].replaceAll("/", "")); //Add stores to list storeList.add(StoreF); } } //print list stores in file printStoreList(storeList); executeStoredPro(storeList); } catch (Exception ex) { nmtbatchservice.NMTBatchService2.LOG.error("An exception accoured: " + ex.getMessage(), ex); //copy to error folder //email } return false; } public void printStoreList(List<StoreFile> storeListToPrint) { for(int i = 0; i <storeListToPrint.size();i++){ System.out.println( storeListToPrint.get(i).getRetailID() + storeListToPrint.get(i).getChain() + storeListToPrint.get(i).getStoreID() + storeListToPrint.get(i).getStoreName() + storeListToPrint.get(i).getAddress1() + storeListToPrint.get(i).getAddress2() + storeListToPrint.get(i).getAddress3() + storeListToPrint.get(i).getProvince() + storeListToPrint.get(i).getAddress4() + storeListToPrint.get(i).getCountry() + storeListToPrint.get(i).getCurrency() + storeListToPrint.get(i).getAddress5() + storeListToPrint.get(i).getTelNo()); } } public void unzip(String source, String destination) { try { ZipFile zipFile = new ZipFile(source); zipFile.extractAll(destination); deleteStoreFile(source); } catch (ZipException ex) { nmtbatchservice.NMTBatchService2.LOG.error("Error unzipping file : " + ex.getMessage(), ex); } } public void deleteStoreFile(String directory) { try { File file = new File(directory); file.delete(); } catch (Exception ex) { nmtbatchservice.NMTBatchService2.LOG.error("An exception accoured when trying to delete file " + directory + " : " + ex.getMessage(), ex); } } public void executeStoredPro(List<StoreFile> storeListToInsert) { Connection con = null; CallableStatement st = null; try { String connectionURL = MSSQLConnectionURL; Class.forName("com.microsoft.sqlserver.jdbc.SQLServerDriver").newInstance(); con = DriverManager.getConnection(connectionURL, MSSQLUsername, MSSQLPassword); for(int i = 0; i <storeListToInsert.size();i++){ st = con.prepareCall( "IF EXISTS (SELECT * FROM tblPay@RetailStores WHERE StoreID = " + storeListToInsert.get(i).getStoreID() + " AND RetailID = "+ storeListToInsert.get(i).getRetailID() + ")" + " UPDATE tblPay@RetailStores " + " SET RetailID = '" + storeListToInsert.get(i).getRetailID() + "'," + " StoreID = '" + storeListToInsert.get(i).getStoreID() + "'," + " StoreName = '" + storeListToInsert.get(i).getStoreName() + "'," + " TestStore = 0," + " Address1 = '" + storeListToInsert.get(i).getAddress1() + "'," + " Address2 = '" + storeListToInsert.get(i).getAddress2() + "'," + " Address3 = '" + storeListToInsert.get(i).getAddress3() + "'," + " Address4 = '" + storeListToInsert.get(i).getAddress4() + "'," + " Address5 = '" + storeListToInsert.get(i).getAddress5() + "'," + " Province = '" + storeListToInsert.get(i).getProvince() + "'," + " TelNo = '" + storeListToInsert.get(i).getTelNo() + "'," + " Enabled = 1" + " ELSE " + " INSERT INTO tblPay@RetailStores ( [RetailID], [StoreID], [StoreName], [TestStore], [Address1], [Address2], [Address3], [Address4], [Address5], [Province], [TelNo] , [Enabled] ) " + " VALUES " + "('" + storeListToInsert.get(i).getRetailID() + "'," + "'" + storeListToInsert.get(i).getStoreID() + "'," + "'" + storeListToInsert.get(i).getStoreName() + "'," + "0," + "'" + storeListToInsert.get(i).getAddress1() + "'," + "'" + storeListToInsert.get(i).getAddress2() + "'," + "'" + storeListToInsert.get(i).getAddress3() + "'," + "'" + storeListToInsert.get(i).getAddress4() + "'," + "'" + storeListToInsert.get(i).getAddress5() + "'," + "'" + storeListToInsert.get(i).getProvince() + "'," + "'" + storeListToInsert.get(i).getTelNo() + "'," + "1)"); st.executeUpdate(); } con.close(); } catch (Exception ex) { nmtbatchservice.NMTBatchService2.LOG.error("Error executing Stored proc with error : " + ex.getMessage(), ex); nmtbatchservice.NMTBatchService2.mailingQueue.addToQueue(new Mail("[email protected]", "Service Email Error", "An error occurred during Store Import failed with error : " + ex.getMessage())); } } Any advise would be appreciated. Thanks

    Read the article

  • Multi-threading does not work correctly using std::thread (C++ 11)

    - by user1364743
    I coded a small c++ program to try to understand how multi-threading works using std::thread. Here's the step of my program execution : Initialization of a 5x5 matrix of integers with a unique value '42' contained in the class 'Toto' (initialized in the main). I print the initialized 5x5 matrix. Declaration of std::vector of 5 threads. I attach all threads respectively with their task (threadTask method). Each thread will manipulate a std::vector<int> instance. I join all threads. I print the new state of my 5x5 matrix. Here's the output : 42 42 42 42 42 42 42 42 42 42 42 42 42 42 42 42 42 42 42 42 42 42 42 42 42 42 42 42 42 42 42 42 42 42 42 42 42 42 42 42 42 42 42 42 42 42 42 42 42 42 It should be : 42 42 42 42 42 42 42 42 42 42 42 42 42 42 42 42 42 42 42 42 42 42 42 42 42 0 0 0 0 0 1 1 1 1 1 2 2 2 2 2 3 3 3 3 3 4 4 4 4 4 Here's the code sample : #include <iostream> #include <vector> #include <thread> class Toto { public: /* ** Initialize a 5x5 matrix with the 42 value. */ void initData(void) { for (int y = 0; y < 5; y++) { std::vector<int> vec; for (int x = 0; x < 5; x++) { vec.push_back(42); } this->m_data.push_back(vec); } } /* ** Display the whole matrix. */ void printData(void) const { for (int y = 0; y < 5; y++) { for (int x = 0; x < 5; x++) { printf("%d ", this->m_data[y][x]); } printf("\n"); } printf("\n"); } /* ** Function attached to the thread (thread task). ** Replace the original '42' value by another one. */ void threadTask(std::vector<int> &list, int value) { for (int x = 0; x < 5; x++) { list[x] = value; } } /* ** Return the m_data instance propertie. */ std::vector<std::vector<int> > &getData(void) { return (this->m_data); } private: std::vector<std::vector<int> > m_data; }; int main(void) { Toto toto; toto.initData(); toto.printData(); //Display the original 5x5 matrix (first display). std::vector<std::thread> threadList(5); //Initialization of vector of 5 threads. for (int i = 0; i < 5; i++) { //Threads initializationss std::vector<int> vec = toto.getData()[i]; //Get each sub-vectors. threadList.at(i) = std::thread(&Toto::threadTask, toto, vec, i); //Each thread will be attached to a specific vector. } for (int j = 0; j < 5; j++) { threadList.at(j).join(); } toto.printData(); //Second display. getchar(); return (0); } However, in the method threadTask, if I print the variable list[x], the output is correct. I think I can't print the correct data in the main because the printData() call is in the main thread and the display in the threadTask function is correct because the method is executed in its own thread (not the main one). It's strange, it means that all threads created in a parent processes can't modified the data in this parent processes ? I think I forget something in my code. I'm really lost. Does anyone can help me, please ? Thank a lot in advance for your help.

    Read the article

  • Microsoft and jQuery

    - by Rick Strahl
    The jQuery JavaScript library has been steadily getting more popular and with recent developments from Microsoft, jQuery is also getting ever more exposure on the ASP.NET platform including now directly from Microsoft. jQuery is a light weight, open source DOM manipulation library for JavaScript that has changed how many developers think about JavaScript. You can download it and find more information on jQuery on www.jquery.com. For me jQuery has had a huge impact on how I develop Web applications and was probably the main reason I went from dreading to do JavaScript development to actually looking forward to implementing client side JavaScript functionality. It has also had a profound impact on my JavaScript skill level for me by seeing how the library accomplishes things (and often reviewing the terse but excellent source code). jQuery made an uncomfortable development platform (JavaScript + DOM) a joy to work on. Although jQuery is by no means the only JavaScript library out there, its ease of use, small size, huge community of plug-ins and pure usefulness has made it easily the most popular JavaScript library available today. As a long time jQuery user, I’ve been excited to see the developments from Microsoft that are bringing jQuery to more ASP.NET developers and providing more integration with jQuery for ASP.NET’s core features rather than relying on the ASP.NET AJAX library. Microsoft and jQuery – making Friends jQuery is an open source project but in the last couple of years Microsoft has really thrown its weight behind supporting this open source library as a supported component on the Microsoft platform. When I say supported I literally mean supported: Microsoft now offers actual tech support for jQuery as part of their Product Support Services (PSS) as jQuery integration has become part of several of the ASP.NET toolkits and ships in several of the default Web project templates in Visual Studio 2010. The ASP.NET MVC 3 framework (still in Beta) also uses jQuery for a variety of client side support features including client side validation and we can look forward toward more integration of client side functionality via jQuery in both MVC and WebForms in the future. In other words jQuery is becoming an optional but included component of the ASP.NET platform. PSS support means that support staff will answer jQuery related support questions as part of any support incidents related to ASP.NET which provides some piece of mind to some corporate development shops that require end to end support from Microsoft. In addition to including jQuery and supporting it, Microsoft has also been getting involved in providing development resources for extending jQuery’s functionality via plug-ins. Microsoft’s last version of the Microsoft Ajax Library – which is the successor to the native ASP.NET AJAX Library – included some really cool functionality for client templates, databinding and localization. As it turns out Microsoft has rebuilt most of that functionality using jQuery as the base API and provided jQuery plug-ins of these components. Very recently these three plug-ins were submitted and have been approved for inclusion in the official jQuery plug-in repository and been taken over by the jQuery team for further improvements and maintenance. Even more surprising: The jQuery-templates component has actually been approved for inclusion in the next major update of the jQuery core in jQuery V1.5, which means it will become a native feature that doesn’t require additional script files to be loaded. Imagine this – an open source contribution from Microsoft that has been accepted into a major open source project for a core feature improvement. Microsoft has come a long way indeed! What the Microsoft Involvement with jQuery means to you For Microsoft jQuery support is a strategic decision that affects their direction in client side development, but nothing stopped you from using jQuery in your applications prior to Microsoft’s official backing and in fact a large chunk of developers did so readily prior to Microsoft’s announcement. Official support from Microsoft brings a few benefits to developers however. jQuery support in Visual Studio 2010 means built-in support for jQuery IntelliSense, automatically added jQuery scripts in many projects types and a common base for client side functionality that actually uses what most developers are already using. If you have already been using jQuery and were worried about straying from the Microsoft line and their internal Microsoft Ajax Library – worry no more. With official support and the change in direction towards jQuery Microsoft is now following along what most in the ASP.NET community had already been doing by using jQuery, which is likely the reason for Microsoft’s shift in direction in the first place. ASP.NET AJAX and the Microsoft AJAX Library weren’t bad technology – there was tons of useful functionality buried in these libraries. However, these libraries never got off the ground, mainly because early incarnations were squarely aimed at control/component developers rather than application developers. For all the functionality that these controls provided for control developers they lacked in useful and easily usable application developer functionality that was easily accessible in day to day client side development. The result was that even though Microsoft shipped support for these tools in the box (in .NET 3.5 and 4.0), other than for the internal support in ASP.NET for things like the UpdatePanel and the ASP.NET AJAX Control Toolkit as well as some third party vendors, the Microsoft client libraries were largely ignored by the developer community opening the door for other client side solutions. Microsoft seems to be acknowledging developer choice in this case: Many more developers were going down the jQuery path rather than using the Microsoft built libraries and there seems to be little sense in continuing development of a technology that largely goes unused by the majority of developers. Kudos for Microsoft for recognizing this and gracefully changing directions. Note that even though there will be no further development in the Microsoft client libraries they will continue to be supported so if you’re using them in your applications there’s no reason to start running for the exit in a panic and start re-writing everything with jQuery. Although that might be a reasonable choice in some cases, jQuery and the Microsoft libraries work well side by side so that you can leave existing solutions untouched even as you enhance them with jQuery. The Microsoft jQuery Plug-ins – Solid Core Features One of the most interesting developments in Microsoft’s embracing of jQuery is that Microsoft has started contributing to jQuery via standard mechanism set for jQuery developers: By submitting plug-ins. Microsoft took some of the nicest new features of the unpublished Microsoft Ajax Client Library and re-wrote these components for jQuery and then submitted them as plug-ins to the jQuery plug-in repository. Accepted plug-ins get taken over by the jQuery team and that’s exactly what happened with the three plug-ins submitted by Microsoft with the templating plug-in even getting slated to be published as part of the jQuery core in the next major release (1.5). The following plug-ins are provided by Microsoft: jQuery Templates – a client side template rendering engine jQuery Data Link – a client side databinder that can synchronize changes without code jQuery Globalization – provides formatting and conversion features for dates and numbers The first two are ports of functionality that was slated for the Microsoft Ajax Library while functionality for the globalization library provides functionality that was already found in the original ASP.NET AJAX library. To me all three plug-ins address a pressing need in client side applications and provide functionality I’ve previously used in other incarnations, but with more complete implementations. Let’s take a close look at these plug-ins. jQuery Templates http://api.jquery.com/category/plugins/templates/ Client side templating is a key component for building rich JavaScript applications in the browser. Templating on the client lets you avoid from manually creating markup by creating DOM nodes and injecting them individually into the document via code. Rather you can create markup templates – similar to the way you create classic ASP server markup – and merge data into these templates to render HTML which you can then inject into the document or replace existing content with. Output from templates are rendered as a jQuery matched set and can then be easily inserted into the document as needed. Templating is key to minimize client side code and reduce repeated code for rendering logic. Instead a single template can be used in many places for updating and adding content to existing pages. Further if you build pure AJAX interfaces that rely entirely on client rendering of the initial page content, templates allow you to a use a single markup template to handle all rendering of each specific HTML section/element. I’ve used a number of different client rendering template engines with jQuery in the past including jTemplates (a PHP style templating engine) and a modified version of John Resig’s MicroTemplating engine which I built into my own set of libraries because it’s such a commonly used feature in my client side applications. jQuery templates adds a much richer templating model that allows for sub-templates and access to the data items. Like John Resig’s original Micro Template engine, the core basics of the templating engine create JavaScript code which means that templates can include JavaScript code. To give you a basic idea of how templates work imagine I have an application that downloads a set of stock quotes based on a symbol list then displays them in the document. To do this you can create an ‘item’ template that describes how each of the quotes is renderd as a template inside of the document: <script id="stockTemplate" type="text/x-jquery-tmpl"> <div id="divStockQuote" class="errordisplay" style="width: 500px;"> <div class="label">Company:</div><div><b>${Company}(${Symbol})</b></div> <div class="label">Last Price:</div><div>${LastPrice}</div> <div class="label">Net Change:</div><div> {{if NetChange > 0}} <b style="color:green" >${NetChange}</b> {{else}} <b style="color:red" >${NetChange}</b> {{/if}} </div> <div class="label">Last Update:</div><div>${LastQuoteTimeString}</div> </div> </script> The ‘template’ is little more than HTML with some markup expressions inside of it that define the template language. Notice the embedded ${} expressions which reference data from the quote objects returned from an AJAX call on the server. You can embed any JavaScript or value expression in these template expressions. There are also a number of structural commands like {{if}} and {{each}} that provide for rudimentary logic inside of your templates as well as commands ({{tmpl}} and {{wrap}}) for nesting templates. You can find more about the full set of markup expressions available in the documentation. To load up this data you can use code like the following: <script type="text/javascript"> //var Proxy = new ServiceProxy("../PageMethods/PageMethodsService.asmx/"); $(document).ready(function () { $("#btnGetQuotes").click(GetQuotes); }); function GetQuotes() { var symbols = $("#txtSymbols").val().split(","); $.ajax({ url: "../PageMethods/PageMethodsService.asmx/GetStockQuotes", data: JSON.stringify({ symbols: symbols }), // parameter map type: "POST", // data has to be POSTed contentType: "application/json", timeout: 10000, dataType: "json", success: function (result) { var quotes = result.d; var jEl = $("#stockTemplate").tmpl(quotes); $("#quoteDisplay").empty().append(jEl); }, error: function (xhr, status) { alert(status + "\r\n" + xhr.responseText); } }); }; </script> In this case an ASMX AJAX service is called to retrieve the stock quotes. The service returns an array of quote objects. The result is returned as an object with the .d property (in Microsoft service style) that returns the actual array of quotes. The template is applied with: var jEl = $("#stockTemplate").tmpl(quotes); which selects the template script tag and uses the .tmpl() function to apply the data to it. The result is a jQuery matched set of elements that can then be appended to the quote display element in the page. The template is merged against an array in this example. When the result is an array the template is automatically applied to each each array item. If you pass a single data item – like say a stock quote – the template works exactly the same way but is applied only once. Templates also have access to a $data item which provides the current data item and information about the tempalte that is currently executing. This makes it possible to keep context within the context of the template itself and also to pass context from a parent template to a child template which is very powerful. Templates can be evaluated by using the template selector and calling the .tmpl() function on the jQuery matched set as shown above or you can use the static $.tmpl() function to provide a template as a string. This allows you to dynamically create templates in code or – more likely – to load templates from the server via AJAX calls. In short there are options The above shows off some of the basics, but there’s much for functionality available in the template engine. Check the documentation link for more information and links to additional examples. The plug-in download also comes with a number of examples that demonstrate functionality. jQuery templates will become a native component in jQuery Core 1.5, so it’s definitely worthwhile checking out the engine today and get familiar with this interface. As much as I’m stoked about templating becoming part of the jQuery core because it’s such an integral part of many applications, there are also a couple shortcomings in the current incarnation: Lack of Error Handling Currently if you embed an expression that is invalid it’s simply not rendered. There’s no error rendered into the template nor do the various  template functions throw errors which leaves finding of bugs as a runtime exercise. I would like some mechanism – optional if possible – to be able to get error info of what is failing in a template when it’s rendered. No String Output Templates are always rendered into a jQuery matched set and there’s no way that I can see to directly render to a string. String output can be useful for debugging as well as opening up templating for creating non-HTML string output. Limited JavaScript Access Unlike John Resig’s original MicroTemplating Engine which was entirely based on JavaScript code generation these templates are limited to a few structured commands that can ‘execute’. There’s no code execution inside of script code which means you’re limited to calling expressions available in global objects or the data item passed in. This may or may not be a big deal depending on the complexity of your template logic. Error handling has been discussed quite a bit and it’s likely there will be some solution to that particualar issue by the time jQuery templates ship. The others are relatively minor issues but something to think about anyway. jQuery Data Link http://api.jquery.com/category/plugins/data-link/ jQuery Data Link provides the ability to do two-way data binding between input controls and an underlying object’s properties. The typical scenario is linking a textbox to a property of an object and have the object updated when the text in the textbox is changed and have the textbox change when the value in the object or the entire object changes. The plug-in also supports converter functions that can be applied to provide the conversion logic from string to some other value typically necessary for mapping things like textbox string input to say a number property and potentially applying additional formatting and calculations. In theory this sounds great, however in reality this plug-in has some serious usability issues. Using the plug-in you can do things like the following to bind data: person = { firstName: "rick", lastName: "strahl"}; $(document).ready( function() { // provide for two-way linking of inputs $("form").link(person); // bind to non-input elements explicitly $("#objFirst").link(person, { firstName: { name: "objFirst", convertBack: function (value, source, target) { $(target).text(value); } } }); $("#objLast").link(person, { lastName: { name: "objLast", convertBack: function (value, source, target) { $(target).text(value); } } }); }); This code hooks up two-way linking between a couple of textboxes on the page and the person object. The first line in the .ready() handler provides mapping of object to form field with the same field names as properties on the object. Note that .link() does NOT bind items into the textboxes when you call .link() – changes are mapped only when values change and you move out of the field. Strike one. The two following commands allow manual binding of values to specific DOM elements which is effectively a one-way bind. You specify the object and a then an explicit mapping where name is an ID in the document. The converter is required to explicitly assign the value to the element. Strike two. You can also detect changes to the underlying object and cause updates to the input elements bound. Unfortunately the syntax to do this is not very natural as you have to rely on the jQuery data object. To update an object’s properties and get change notification looks like this: function updateFirstName() { $(person).data("firstName", person.firstName + " (code updated)"); } This works fine in causing any linked fields to be updated. In the bindings above both the firstName input field and objFirst DOM element gets updated. But the syntax requires you to use a jQuery .data() call for each property change to ensure that the changes are tracked properly. Really? Sure you’re binding through multiple layers of abstraction now but how is that better than just manually assigning values? The code savings (if any) are going to be minimal. As much as I would like to have a WPF/Silverlight/Observable-like binding mechanism in client script, this plug-in doesn’t help much towards that goal in its current incarnation. While you can bind values, the ‘binder’ is too limited to be really useful. If initial values can’t be assigned from the mappings you’re going to end up duplicating work loading the data using some other mechanism. There’s no easy way to re-bind data with a different object altogether since updates trigger only through the .data members. Finally, any non-input elements have to be bound via code that’s fairly verbose and frankly may be more voluminous than what you might write by hand for manual binding and unbinding. Two way binding can be very useful but it has to be easy and most importantly natural. If it’s more work to hook up a binding than writing a couple of lines to do binding/unbinding this sort of thing helps very little in most scenarios. In talking to some of the developers the feature set for Data Link is not complete and they are still soliciting input for features and functionality. If you have ideas on how you want this feature to be more useful get involved and post your recommendations. As it stands, it looks to me like this component needs a lot of love to become useful. For this component to really provide value, bindings need to be able to be refreshed easily and work at the object level, not just the property level. It seems to me we would be much better served by a model binder object that can perform these binding/unbinding tasks in bulk rather than a tool where each link has to be mapped first. I also find the choice of creating a jQuery plug-in questionable – it seems a standalone object – albeit one that relies on the jQuery library – would provide a more intuitive interface than the current forcing of options onto a plug-in style interface. Out of the three Microsoft created components this is by far the least useful and least polished implementation at this point. jQuery Globalization http://github.com/jquery/jquery-global Globalization in JavaScript applications often gets short shrift and part of the reason for this is that natively in JavaScript there’s little support for formatting and parsing of numbers and dates. There are a number of JavaScript libraries out there that provide some support for globalization, but most are limited to a particular portion of globalization. As .NET developers we’re fairly spoiled by the richness of APIs provided in the framework and when dealing with client development one really notices the lack of these features. While you may not necessarily need to localize your application the globalization plug-in also helps with some basic tasks for non-localized applications: Dealing with formatting and parsing of dates and time values. Dates in particular are problematic in JavaScript as there are no formatters whatsoever except the .toString() method which outputs a verbose and next to useless long string. With the globalization plug-in you get a good chunk of the formatting and parsing functionality that the .NET framework provides on the server. You can write code like the following for example to format numbers and dates: var date = new Date(); var output = $.format(date, "MMM. dd, yy") + "\r\n" + $.format(date, "d") + "\r\n" + // 10/25/2010 $.format(1222.32213, "N2") + "\r\n" + $.format(1222.33, "c") + "\r\n"; alert(output); This becomes even more useful if you combine it with templates which can also include any JavaScript expressions. Assuming the globalization plug-in is loaded you can create template expressions that use the $.format function. Here’s the template I used earlier for the stock quote again with a couple of formats applied: <script id="stockTemplate" type="text/x-jquery-tmpl"> <div id="divStockQuote" class="errordisplay" style="width: 500px;"> <div class="label">Company:</div><div><b>${Company}(${Symbol})</b></div> <div class="label">Last Price:</div> <div>${$.format(LastPrice,"N2")}</div> <div class="label">Net Change:</div><div> {{if NetChange > 0}} <b style="color:green" >${NetChange}</b> {{else}} <b style="color:red" >${NetChange}</b> {{/if}} </div> <div class="label">Last Update:</div> <div>${$.format(LastQuoteTime,"MMM dd, yyyy")}</div> </div> </script> There are also parsing methods that can parse dates and numbers from strings into numbers easily: alert($.parseDate("25.10.2010")); alert($.parseInt("12.222")); // de-DE uses . for thousands separators As you can see culture specific options are taken into account when parsing. The globalization plugin provides rich support for a variety of locales: Get a list of all available cultures Query cultures for culture items (like currency symbol, separators etc.) Localized string names for all calendar related items (days of week, months) Generated off of .NET’s supported locales In short you get much of the same functionality that you already might be using in .NET on the server side. The plugin includes a huge number of locales and an Globalization.all.min.js file that contains the text defaults for each of these locales as well as small locale specific script files that define each of the locale specific settings. It’s highly recommended that you NOT use the huge globalization file that includes all locales, but rather add script references to only those languages you explicitly care about. Overall this plug-in is a welcome helper. Even if you use it with a single locale (like en-US) and do no other localization, you’ll gain solid support for number and date formatting which is a vital feature of many applications. Changes for Microsoft It’s good to see Microsoft coming out of its shell and away from the ‘not-built-here’ mentality that has been so pervasive in the past. It’s especially good to see it applied to jQuery – a technology that has stood in drastic contrast to Microsoft’s own internal efforts in terms of design, usage model and… popularity. It’s great to see that Microsoft is paying attention to what customers prefer to use and supporting the customer sentiment – even if it meant drastically changing course of policy and moving into a more open and sharing environment in the process. The additional jQuery support that has been introduced in the last two years certainly has made lives easier for many developers on the ASP.NET platform. It’s also nice to see Microsoft submitting proposals through the standard jQuery process of plug-ins and getting accepted for various very useful projects. Certainly the jQuery Templates plug-in is going to be very useful to many especially since it will be baked into the jQuery core in jQuery 1.5. I hope we see more of this type of involvement from Microsoft in the future. Kudos!© Rick Strahl, West Wind Technologies, 2005-2010Posted in jQuery  ASP.NET  

    Read the article

  • Using FiddlerCore to capture HTTP Requests with .NET

    - by Rick Strahl
    Over the last few weeks I’ve been working on my Web load testing utility West Wind WebSurge. One of the key components of a load testing tool is the ability to capture URLs effectively so that you can play them back later under load. One of the options in WebSurge for capturing URLs is to use its built-in capture tool which acts as an HTTP proxy to capture any HTTP and HTTPS traffic from most Windows HTTP clients, including Web Browsers as well as standalone Windows applications and services. To make this happen, I used Eric Lawrence’s awesome FiddlerCore library, which provides most of the functionality of his desktop Fiddler application, all rolled into an easy to use library that you can plug into your own applications. FiddlerCore makes it almost too easy to capture HTTP content! For WebSurge I needed to capture all HTTP traffic in order to capture the full HTTP request – URL, headers and any content posted by the client. The result of what I ended up creating is this semi-generic capture form: In this post I’m going to demonstrate how easy it is to use FiddlerCore to build this HTTP Capture Form.  If you want to jump right in here are the links to get Telerik’s Fiddler Core and the code for the demo provided here. FiddlerCore Download FiddlerCore on NuGet Show me the Code (WebSurge Integration code from GitHub) Download the WinForms Sample Form West Wind Web Surge (example implementation in live app) Note that FiddlerCore is bound by a license for commercial usage – see license.txt in the FiddlerCore distribution for details. Integrating FiddlerCore FiddlerCore is a library that simply plugs into your application. You can download it from the Telerik site and manually add the assemblies to your project, or you can simply install the NuGet package via:       PM> Install-Package FiddlerCore The library consists of the FiddlerCore.dll as well as a couple of support libraries (CertMaker.dll and BCMakeCert.dll) that are used for installing SSL certificates. I’ll have more on SSL captures and certificate installation later in this post. But first let’s see how easy it is to use FiddlerCore to capture HTTP content by looking at how to build the above capture form. Capturing HTTP Content Once the library is installed it’s super easy to hook up Fiddler functionality. Fiddler includes a number of static class methods on the FiddlerApplication object that can be called to hook up callback events as well as actual start monitoring HTTP URLs. In the following code directly lifted from WebSurge, I configure a few filter options on Form level object, from the user inputs shown on the form by assigning it to a capture options object. In the live application these settings are persisted configuration values, but in the demo they are one time values initialized and set on the form. Once these options are set, I hook up the AfterSessionComplete event to capture every URL that passes through the proxy after the request is completed and start up the Proxy service:void Start() { if (tbIgnoreResources.Checked) CaptureConfiguration.IgnoreResources = true; else CaptureConfiguration.IgnoreResources = false; string strProcId = txtProcessId.Text; if (strProcId.Contains('-')) strProcId = strProcId.Substring(strProcId.IndexOf('-') + 1).Trim(); strProcId = strProcId.Trim(); int procId = 0; if (!string.IsNullOrEmpty(strProcId)) { if (!int.TryParse(strProcId, out procId)) procId = 0; } CaptureConfiguration.ProcessId = procId; CaptureConfiguration.CaptureDomain = txtCaptureDomain.Text; FiddlerApplication.AfterSessionComplete += FiddlerApplication_AfterSessionComplete; FiddlerApplication.Startup(8888, true, true, true); } The key lines for FiddlerCore are just the last two lines of code that include the event hookup code as well as the Startup() method call. Here I only hook up to the AfterSessionComplete event but there are a number of other events that hook various stages of the HTTP request cycle you can also hook into. Other events include BeforeRequest, BeforeResponse, RequestHeadersAvailable, ResponseHeadersAvailable and so on. In my case I want to capture the request data and I actually have several options to capture this data. AfterSessionComplete is the last event that fires in the request sequence and it’s the most common choice to capture all request and response data. I could have used several other events, but AfterSessionComplete is one place where you can look both at the request and response data, so this will be the most common place to hook into if you’re capturing content. The implementation of AfterSessionComplete is responsible for capturing all HTTP request headers and it looks something like this:private void FiddlerApplication_AfterSessionComplete(Session sess) { // Ignore HTTPS connect requests if (sess.RequestMethod == "CONNECT") return; if (CaptureConfiguration.ProcessId > 0) { if (sess.LocalProcessID != 0 && sess.LocalProcessID != CaptureConfiguration.ProcessId) return; } if (!string.IsNullOrEmpty(CaptureConfiguration.CaptureDomain)) { if (sess.hostname.ToLower() != CaptureConfiguration.CaptureDomain.Trim().ToLower()) return; } if (CaptureConfiguration.IgnoreResources) { string url = sess.fullUrl.ToLower(); var extensions = CaptureConfiguration.ExtensionFilterExclusions; foreach (var ext in extensions) { if (url.Contains(ext)) return; } var filters = CaptureConfiguration.UrlFilterExclusions; foreach (var urlFilter in filters) { if (url.Contains(urlFilter)) return; } } if (sess == null || sess.oRequest == null || sess.oRequest.headers == null) return; string headers = sess.oRequest.headers.ToString(); var reqBody = sess.GetRequestBodyAsString(); // if you wanted to capture the response //string respHeaders = session.oResponse.headers.ToString(); //var respBody = session.GetResponseBodyAsString(); // replace the HTTP line to inject full URL string firstLine = sess.RequestMethod + " " + sess.fullUrl + " " + sess.oRequest.headers.HTTPVersion; int at = headers.IndexOf("\r\n"); if (at < 0) return; headers = firstLine + "\r\n" + headers.Substring(at + 1); string output = headers + "\r\n" + (!string.IsNullOrEmpty(reqBody) ? reqBody + "\r\n" : string.Empty) + Separator + "\r\n\r\n"; BeginInvoke(new Action<string>((text) => { txtCapture.AppendText(text); UpdateButtonStatus(); }), output); } The code starts by filtering out some requests based on the CaptureOptions I set before the capture is started. These options/filters are applied when requests actually come in. This is very useful to help narrow down the requests that are captured for playback based on options the user picked. I find it useful to limit requests to a certain domain for captures, as well as filtering out some request types like static resources – images, css, scripts etc. This is of course optional, but I think it’s a common scenario and WebSurge makes good use of this feature. AfterSessionComplete like other FiddlerCore events, provides a Session object parameter which contains all the request and response details. There are oRequest and oResponse objects to hold their respective data. In my case I’m interested in the raw request headers and body only, as you can see in the commented code you can also retrieve the response headers and body. Here the code captures the request headers and body and simply appends the output to the textbox on the screen. Note that the Fiddler events are asynchronous, so in order to display the content in the UI they have to be marshaled back the UI thread with BeginInvoke, which here simply takes the generated headers and appends it to the existing textbox test on the form. As each request is processed, the headers are captured and appended to the bottom of the textbox resulting in a Session HTTP capture in the format that Web Surge internally supports, which is basically raw request headers with a customized 1st HTTP Header line that includes the full URL rather than a server relative URL. When the capture is done the user can either copy the raw HTTP session to the clipboard, or directly save it to file. This raw capture format is the same format WebSurge and also Fiddler use to import/export request data. While this code is application specific, it demonstrates the kind of logic that you can easily apply to the request capture process, which is one of the reasonsof why FiddlerCore is so powerful. You get to choose what content you want to look up as part of your own application logic and you can then decide how to capture or use that data as part of your application. The actual captured data in this case is only a string. The user can edit the data by hand or in the the case of WebSurge, save it to disk and automatically open the captured session as a new load test. Stopping the FiddlerCore Proxy Finally to stop capturing requests you simply disconnect the event handler and call the FiddlerApplication.ShutDown() method:void Stop() { FiddlerApplication.AfterSessionComplete -= FiddlerApplication_AfterSessionComplete; if (FiddlerApplication.IsStarted()) FiddlerApplication.Shutdown(); } As you can see, adding HTTP capture functionality to an application is very straight forward. FiddlerCore offers tons of features I’m not even touching on here – I suspect basic captures are the most common scenario, but a lot of different things can be done with FiddlerCore’s simple API interface. Sky’s the limit! The source code for this sample capture form (WinForms) is provided as part of this article. Adding Fiddler Certificates with FiddlerCore One of the sticking points in West Wind WebSurge has been that if you wanted to capture HTTPS/SSL traffic, you needed to have the full version of Fiddler and have HTTPS decryption enabled. Essentially you had to use Fiddler to configure HTTPS decryption and the associated installation of the Fiddler local client certificate that is used for local decryption of incoming SSL traffic. While this works just fine, requiring to have Fiddler installed and then using a separate application to configure the SSL functionality isn’t ideal. Fortunately FiddlerCore actually includes the tools to register the Fiddler Certificate directly using FiddlerCore. Why does Fiddler need a Certificate in the first Place? Fiddler and FiddlerCore are essentially HTTP proxies which means they inject themselves into the HTTP conversation by re-routing HTTP traffic to a special HTTP port (8888 by default for Fiddler) and then forward the HTTP data to the original client. Fiddler injects itself as the system proxy in using the WinInet Windows settings  which are the same settings that Internet Explorer uses and that are configured in the Windows and Internet Explorer Internet Settings dialog. Most HTTP clients running on Windows pick up and apply these system level Proxy settings before establishing new HTTP connections and that’s why most clients automatically work once Fiddler – or FiddlerCore/WebSurge are running. For plain HTTP requests this just works – Fiddler intercepts the HTTP requests on the proxy port and then forwards them to the original port (80 for HTTP and 443 for SSL typically but it could be any port). For SSL however, this is not quite as simple – Fiddler can easily act as an HTTPS/SSL client to capture inbound requests from the server, but when it forwards the request to the client it has to also act as an SSL server and provide a certificate that the client trusts. This won’t be the original certificate from the remote site, but rather a custom local certificate that effectively simulates an SSL connection between the proxy and the client. If there is no custom certificate configured for Fiddler the SSL request fails with a certificate validation error. The key for this to work is that a custom certificate has to be installed that the HTTPS client trusts on the local machine. For a much more detailed description of the process you can check out Eric Lawrence’s blog post on Certificates. If you’re using the desktop version of Fiddler you can install a local certificate into the Windows certificate store. Fiddler proper does this from the Options menu: This operation does several things: It installs the Fiddler Root Certificate It sets trust to this Root Certificate A new client certificate is generated for each HTTPS site monitored Certificate Installation with FiddlerCore You can also provide this same functionality using FiddlerCore which includes a CertMaker class. Using CertMaker is straight forward to use and it provides an easy way to create some simple helpers that can install and uninstall a Fiddler Root certificate:public static bool InstallCertificate() { if (!CertMaker.rootCertExists()) { if (!CertMaker.createRootCert()) return false; if (!CertMaker.trustRootCert()) return false; } return true; } public static bool UninstallCertificate() { if (CertMaker.rootCertExists()) { if (!CertMaker.removeFiddlerGeneratedCerts(true)) return false; } return true; } InstallCertificate() works by first checking whether the root certificate is already installed and if it isn’t goes ahead and creates a new one. The process of creating the certificate is a two step process – first the actual certificate is created and then it’s moved into the certificate store to become trusted. I’m not sure why you’d ever split these operations up since a cert created without trust isn’t going to be of much value, but there are two distinct steps. When you trigger the trustRootCert() method, a message box will pop up on the desktop that lets you know that you’re about to trust a local private certificate. This is a security feature to ensure that you really want to trust the Fiddler root since you are essentially installing a man in the middle certificate. It’s quite safe to use this generated root certificate, because it’s been specifically generated for your machine and thus is not usable from external sources, the only way to use this certificate in a trusted way is from the local machine. IOW, unless somebody has physical access to your machine, there’s no useful way to hijack this certificate and use it for nefarious purposes (see Eric’s post for more details). Once the Root certificate has been installed, FiddlerCore/Fiddler create new certificates for each site that is connected to with HTTPS. You can end up with quite a few temporary certificates in your certificate store. To uninstall you can either use Fiddler and simply uncheck the Decrypt HTTPS traffic option followed by the remove Fiddler certificates button, or you can use FiddlerCore’s CertMaker.removeFiddlerGeneratedCerts() which removes the root cert and any of the intermediary certificates Fiddler created. Keep in mind that when you uninstall you uninstall the certificate for both FiddlerCore and Fiddler, so use UninstallCertificate() with care and realize that you might affect the Fiddler application’s operation by doing so as well. When to check for an installed Certificate Note that the check to see if the root certificate exists is pretty fast, while the actual process of installing the certificate is a relatively slow operation that even on a fast machine takes a few seconds. Further the trust operation pops up a message box so you probably don’t want to install the certificate repeatedly. Since the check for the root certificate is fast, you can easily put a call to InstallCertificate() in any capture startup code – in which case the certificate installation only triggers when a certificate is in fact not installed. Personally I like to make certificate installation explicit – just like Fiddler does, so in WebSurge I use a small drop down option on the menu to install or uninstall the SSL certificate:   This code calls the InstallCertificate and UnInstallCertificate functions respectively – the experience with this is similar to what you get in Fiddler with the extra dialog box popping up to prompt confirmation for installation of the root certificate. Once the cert is installed you can then capture SSL requests. There’s a gotcha however… Gotcha: FiddlerCore Certificates don’t stick by Default When I originally tried to use the Fiddler certificate installation I ran into an odd problem. I was able to install the certificate and immediately after installation was able to capture HTTPS requests. Then I would exit the application and come back in and try the same HTTPS capture again and it would fail due to a missing certificate. CertMaker.rootCertExists() would return false after every restart and if re-installed the certificate a new certificate would get added to the certificate store resulting in a bunch of duplicated root certificates with different keys. What the heck? CertMaker and BcMakeCert create non-sticky CertificatesI turns out that FiddlerCore by default uses different components from what the full version of Fiddler uses. Fiddler uses a Windows utility called MakeCert.exe to create the Fiddler Root certificate. FiddlerCore however installs the CertMaker.dll and BCMakeCert.dll assemblies, which use a different crypto library (Bouncy Castle) for certificate creation than MakeCert.exe which uses the Windows Crypto API. The assemblies provide support for non-windows operation for Fiddler under Mono, as well as support for some non-Windows certificate platforms like iOS and Android for decryption. The bottom line is that the FiddlerCore provided bouncy castle assemblies are not sticky by default as the certificates created with them are not cached as they are in Fiddler proper. To get certificates to ‘stick’ you have to explicitly cache the certificates in Fiddler’s internal preferences. A cache aware version of InstallCertificate looks something like this:public static bool InstallCertificate() { if (!CertMaker.rootCertExists()) { if (!CertMaker.createRootCert()) return false; if (!CertMaker.trustRootCert()) return false; App.Configuration.UrlCapture.Cert = FiddlerApplication.Prefs.GetStringPref("fiddler.certmaker.bc.cert", null); App.Configuration.UrlCapture.Key = FiddlerApplication.Prefs.GetStringPref("fiddler.certmaker.bc.key", null); } return true; } public static bool UninstallCertificate() { if (CertMaker.rootCertExists()) { if (!CertMaker.removeFiddlerGeneratedCerts(true)) return false; } App.Configuration.UrlCapture.Cert = null; App.Configuration.UrlCapture.Key = null; return true; } In this code I store the Fiddler cert and private key in an application configuration settings that’s stored with the application settings (App.Configuration.UrlCapture object). These settings automatically persist when WebSurge is shut down. The values are read out of Fiddler’s internal preferences store which is set after a new certificate has been created. Likewise I clear out the configuration settings when the certificate is uninstalled. In order for these setting to be used you have to also load the configuration settings into the Fiddler preferences *before* a call to rootCertExists() is made. I do this in the capture form’s constructor:public FiddlerCapture(StressTestForm form) { InitializeComponent(); CaptureConfiguration = App.Configuration.UrlCapture; MainForm = form; if (!string.IsNullOrEmpty(App.Configuration.UrlCapture.Cert)) { FiddlerApplication.Prefs.SetStringPref("fiddler.certmaker.bc.key", App.Configuration.UrlCapture.Key); FiddlerApplication.Prefs.SetStringPref("fiddler.certmaker.bc.cert", App.Configuration.UrlCapture.Cert); }} This is kind of a drag to do and not documented anywhere that I could find, so hopefully this will save you some grief if you want to work with the stock certificate logic that installs with FiddlerCore. MakeCert provides sticky Certificates and the same functionality as Fiddler But there’s actually an easier way. If you want to skip the above Fiddler preference configuration code in your application you can choose to distribute MakeCert.exe instead of certmaker.dll and bcmakecert.dll. When you use MakeCert.exe, the certificates settings are stored in Windows so they are available without any custom configuration inside of your application. It’s easier to integrate and as long as you run on Windows and you don’t need to support iOS or Android devices is simply easier to deal with. To integrate into your project, you can remove the reference to CertMaker.dll (and the BcMakeCert.dll assembly) from your project. Instead copy MakeCert.exe into your output folder. To make sure MakeCert.exe gets pushed out, include MakeCert.exe in your project and set the Build Action to None, and Copy to Output Directory to Copy if newer. Note that the CertMaker.dll reference in the project has been removed and on disk the files for Certmaker.dll, as well as the BCMakeCert.dll files on disk. Keep in mind that these DLLs are resources of the FiddlerCore NuGet package, so updating the package may end up pushing those files back into your project. Once MakeCert.exe is distributed FiddlerCore checks for it first before using the assemblies so as long as MakeCert.exe exists it’ll be used for certificate creation (at least on Windows). Summary FiddlerCore is a pretty sweet tool, and it’s absolutely awesome that we get to plug in most of the functionality of Fiddler right into our own applications. A few years back I tried to build this sort of functionality myself for an app and ended up giving up because it’s a big job to get HTTP right – especially if you need to support SSL. FiddlerCore now provides that functionality as a turnkey solution that can be plugged into your own apps easily. The only downside is FiddlerCore’s documentation for more advanced features like certificate installation which is pretty sketchy. While for the most part FiddlerCore’s feature set is easy to work with without any documentation, advanced features are often not intuitive to gleam by just using Intellisense or the FiddlerCore help file reference (which is not terribly useful). While Eric Lawrence is very responsive on his forum and on Twitter, there simply isn’t much useful documentation on Fiddler/FiddlerCore available online. If you run into trouble the forum is probably the first place to look and then ask a question if you can’t find the answer. The best documentation you can find is Eric’s Fiddler Book which covers a ton of functionality of Fiddler and FiddlerCore. The book is a great reference to Fiddler’s feature set as well as providing great insights into the HTTP protocol. The second half of the book that gets into the innards of HTTP is an excellent read for anybody who wants to know more about some of the more arcane aspects and special behaviors of HTTP – it’s well worth the read. While the book has tons of information in a very readable format, it’s unfortunately not a great reference as it’s hard to find things in the book and because it’s not available online you can’t electronically search for the great content in it. But it’s hard to complain about any of this given the obvious effort and love that’s gone into this awesome product for all of these years. A mighty big thanks to Eric Lawrence  for having created this useful tool that so many of us use all the time, and also to Telerik for picking up Fiddler/FiddlerCore and providing Eric the resources to support and improve this wonderful tool full time and keeping it free for all. Kudos! Resources FiddlerCore Download FiddlerCore NuGet Fiddler Capture Sample Form Fiddler Capture Form in West Wind WebSurge (GitHub) Eric Lawrence’s Fiddler Book© Rick Strahl, West Wind Technologies, 2005-2014Posted in .NET  HTTP   Tweet !function(d,s,id){var js,fjs=d.getElementsByTagName(s)[0];if(!d.getElementById(id)){js=d.createElement(s);js.id=id;js.src="//platform.twitter.com/widgets.js";fjs.parentNode.insertBefore(js,fjs);}}(document,"script","twitter-wjs"); (function() { var po = document.createElement('script'); po.type = 'text/javascript'; po.async = true; po.src = 'https://apis.google.com/js/plusone.js'; var s = document.getElementsByTagName('script')[0]; s.parentNode.insertBefore(po, s); })();

    Read the article

  • Loading jQuery Consistently in a .NET Web App

    - by Rick Strahl
    One thing that frequently comes up in discussions when using jQuery is how to best load the jQuery library (as well as other commonly used and updated libraries) in a Web application. Specifically the issue is the one of versioning and making sure that you can easily update and switch versions of script files with application wide settings in one place and having your script usage reflect those settings in the entire application on all pages that use the script. Although I use jQuery as an example here, the same concepts can be applied to any script library - for example in my Web libraries I use the same approach for jQuery.ui and my own internal jQuery support library. The concepts used here can be applied both in WebForms and MVC. Loading jQuery Properly From CDN Before we look at a generic way to load jQuery via some server logic, let me first point out my preferred way to embed jQuery into the page. I use the Google CDN to load jQuery and then use a fallback URL to handle the offline or no Internet connection scenario. Why use a CDN? CDN links tend to be loaded more quickly since they are very likely to be cached in user's browsers already as jQuery CDN is used by many, many sites on the Web. Using a CDN also removes load from your Web server and puts the load bearing on the CDN provider - in this case Google - rather than on your Web site. On the downside, CDN links gives the provider (Google, Microsoft) yet another way to track users through their Web usage. Here's how I use jQuery CDN plus a fallback link on my WebLog for example: <!DOCTYPE HTML> <html> <head> <script src="//ajax.googleapis.com/ajax/libs/jquery/1.6.4/jquery.min.js"></script> <script> if (typeof (jQuery) == 'undefined') document.write(unescape("%3Cscript " + "src='/Weblog/wwSC.axd?r=Westwind.Web.Controls.Resources.jquery.js' %3E%3C/script%3E")); </script> <title>Rick Strahl's Web Log</title> ... </head>   You can see that the CDN is referenced first, followed by a small script block that checks to see whether jQuery was loaded (jQuery object exists). If it didn't load another script reference is added to the document dynamically pointing to a backup URL. In this case my backup URL points at a WebResource in my Westwind.Web  assembly, but the URL can also be local script like src="/scripts/jquery.min.js". Important: Use the proper Protocol/Scheme for  for CDN Urls [updated based on comments] If you're using a CDN to load an external script resource you should always make sure that the script is loaded with the same protocol as the parent page to avoid mixed content warnings by the browser. You don't want to load a script link to an http:// resource when you're on an https:// page. The easiest way to use this is by using a protocol relative URL: <script src="//ajax.googleapis.com/ajax/libs/jquery/1.6.4/jquery.min.js"></script> which is an easy way to load resources from other domains. This URL syntax will automatically use the parent page's protocol (or more correctly scheme). As long as the remote domains support both http:// and https:// access this should work. BTW this also works in CSS (with some limitations) and links. BTW, I didn't know about this until it was pointed out in the comments. This is a very useful feature for many things - ah the benefits of my blog to myself :-) Version Numbers When you use a CDN you notice that you have to reference a specific version of jQuery. When using local files you may not have to do this as you can rename your private copy of jQuery.js, but for CDN the references are always versioned. The version number is of course very important to ensure you getting the version you have tested with, but it's also important to the provider because it ensures that cached content is always correct. If an existing file was updated the updates might take a very long time to get past the locally cached content and won't refresh properly. The version number ensures you get the right version and not some cached content that has been changed but not updated in your cache. On the other hand version numbers also mean that once you decide to use a new version of the script you now have to change all your script references in your pages. Depending on whether you use some sort of master/layout page or not this may or may not be easy in your application. Even if you do use master/layout pages, chances are that you probably have a few of them and at the very least all of those have to be updated for the scripts. If you use individual pages for all content this issue then spreads to all of your pages. Search and Replace in Files will do the trick, but it's still something that's easy to forget and worry about. Personaly I think it makes sense to have a single place where you can specify common script libraries that you want to load and more importantly which versions thereof and where they are loaded from. Loading Scripts via Server Code Script loading has always been important to me and as long as I can remember I've always built some custom script loading routines into my Web frameworks. WebForms makes this fairly easy because it has a reasonably useful script manager (ClientScriptManager and the ScriptManager) which allow injecting script into the page easily from anywhere in the Page cycle. What's nice about these components is that they allow scripts to be injected by controls so components can wrap up complex script/resource dependencies more easily without having to require long lists of CSS/Scripts/Image includes. In MVC or pure script driven applications like Razor WebPages  the process is more raw, requiring you to embed script references in the right place. But its also more immediate - it lets you know exactly which versions of scripts to use because you have to manually embed them. In WebForms with different controls loading resources this often can get confusing because it's quite possible to load multiple versions of the same script library into a page, the results of which are less than optimal… In this post I look a simple routine that embeds jQuery into the page based on a few application wide configuration settings. It returns only a string of the script tags that can be manually embedded into a Page template. It's a small function that merely a string of the script tags shown at the begging of this post along with some options on how that string is comprised. You'll be able to specify in one place which version loads and then all places where the help function is used will automatically reflect this selection. Options allow specification of the jQuery CDN Url, the fallback Url and where jQuery should be loaded from (script folder, Resource or CDN in my case). While this is specific to jQuery you can apply this to other resources as well. For example I use a similar approach with jQuery.ui as well using practically the same semantics. Providing Resources in ControlResources In my Westwind.Web Web utility library I have a class called ControlResources which is responsible for holding resource Urls, resource IDs and string contants that reference those resource IDs. The library also provides a few helper methods for loading common scriptscripts into a Web page. There are specific versions for WebForms which use the ClientScriptManager/ScriptManager and script link methods that can be used in any .NET technology that can embed an expression into the output template (or code for that matter). The ControlResources class contains mostly static content - references to resources mostly. But it also contains a few static properties that configure script loading: A Script LoadMode (CDN, Resource, or script url) A default CDN Url A fallback url They are  static properties in the ControlResources class: public class ControlResources { /// <summary> /// Determines what location jQuery is loaded from /// </summary> public static JQueryLoadModes jQueryLoadMode = JQueryLoadModes.ContentDeliveryNetwork; /// <summary> /// jQuery CDN Url on Google /// </summary> public static string jQueryCdnUrl = "//ajax.googleapis.com/ajax/libs/jquery/1.6.4/jquery.min.js"; /// <summary> /// jQuery CDN Url on Google /// </summary> public static string jQueryUiCdnUrl = "//ajax.googleapis.com/ajax/libs/jqueryui/1.8.16/jquery-ui.min.js"; /// <summary> /// jQuery UI fallback Url if CDN is unavailable or WebResource is used /// Note: The file needs to exist and hold the minimized version of jQuery ui /// </summary> public static string jQueryUiLocalFallbackUrl = "~/scripts/jquery-ui.min.js"; } These static properties are fixed values that can be changed at application startup to reflect your preferences. Since they're static they are application wide settings and respected across the entire Web application running. It's best to set these default in Application_Init or similar startup code if you need to change them for your application: protected void Application_Start(object sender, EventArgs e) { // Force jQuery to be loaded off Google Content Network ControlResources.jQueryLoadMode = JQueryLoadModes.ContentDeliveryNetwork; // Allow overriding of the Cdn url ControlResources.jQueryCdnUrl = "http://ajax.googleapis.com/ajax/libs/jquery/1.6.2/jquery.min.js"; // Route to our own internal handler App.OnApplicationStart(); } With these basic settings in place you can then embed expressions into a page easily. In WebForms use: <!DOCTYPE html> <html> <head runat="server"> <%= ControlResources.jQueryLink() %> <script src="scripts/ww.jquery.min.js"></script> </head> In Razor use: <!DOCTYPE html> <html> <head> @Html.Raw(ControlResources.jQueryLink()) <script src="scripts/ww.jquery.min.js"></script> </head> Note that in Razor you need to use @Html.Raw() to force the string NOT to escape. Razor by default escapes string results and this ensures that the HTML content is properly expanded as raw HTML text. Both the WebForms and Razor output produce: <!DOCTYPE html> <html> <head> <script src="http://ajax.googleapis.com/ajax/libs/jquery/1.6.2/jquery.min.js" type="text/javascript"></script> <script type="text/javascript"> if (typeof (jQuery) == 'undefined') document.write(unescape("%3Cscript src='/WestWindWebToolkitWeb/WebResource.axd?d=-b6oWzgbpGb8uTaHDrCMv59VSmGhilZP5_T_B8anpGx7X-PmW_1eu1KoHDvox-XHqA1EEb-Tl2YAP3bBeebGN65tv-7-yAimtG4ZnoWH633pExpJor8Qp1aKbk-KQWSoNfRC7rQJHXVP4tC0reYzVw2&t=634535391996872492' type='text/javascript'%3E%3C/script%3E"));</script> <script src="scripts/ww.jquery.min.js"></script> </head> which produces the desired effect for both CDN load and fallback URL. The implementation of jQueryLink is pretty basic of course: /// <summary> /// Inserts a script link to load jQuery into the page based on the jQueryLoadModes settings /// of this class. Default load is by CDN plus WebResource fallback /// </summary> /// <param name="url"> /// An optional explicit URL to load jQuery from. Url is resolved. /// When specified no fallback is applied /// </param> /// <returns>full script tag and fallback script for jQuery to load</returns> public static string jQueryLink(JQueryLoadModes jQueryLoadMode = JQueryLoadModes.Default, string url = null) { string jQueryUrl = string.Empty; string fallbackScript = string.Empty; if (jQueryLoadMode == JQueryLoadModes.Default) jQueryLoadMode = ControlResources.jQueryLoadMode; if (!string.IsNullOrEmpty(url)) jQueryUrl = WebUtils.ResolveUrl(url); else if (jQueryLoadMode == JQueryLoadModes.WebResource) { Page page = new Page(); jQueryUrl = page.ClientScript.GetWebResourceUrl(typeof(ControlResources), ControlResources.JQUERY_SCRIPT_RESOURCE); } else if (jQueryLoadMode == JQueryLoadModes.ContentDeliveryNetwork) { jQueryUrl = ControlResources.jQueryCdnUrl; if (!string.IsNullOrEmpty(jQueryCdnUrl)) { // check if jquery loaded - if it didn't we're not online and use WebResource fallbackScript = @"<script type=""text/javascript"">if (typeof(jQuery) == 'undefined') document.write(unescape(""%3Cscript src='{0}' type='text/javascript'%3E%3C/script%3E""));</script>"; fallbackScript = string.Format(fallbackScript, WebUtils.ResolveUrl(ControlResources.jQueryCdnFallbackUrl)); } } string output = "<script src=\"" + jQueryUrl + "\" type=\"text/javascript\"></script>"; // add in the CDN fallback script code if (!string.IsNullOrEmpty(fallbackScript)) output += "\r\n" + fallbackScript + "\r\n"; return output; } There's one dependency here on WebUtils.ResolveUrl() which resolves Urls without access to a Page/Control (another one of those features that should be in the runtime, not in the WebForms or MVC engine). You can see there's only a little bit of logic in this code that deals with potentially different load modes. I can load scripts from a Url, WebResources or - my preferred way - from CDN. Based on the static settings the scripts to embed are composed to be returned as simple string <script> tag(s). I find this extremely useful especially when I'm not connected to the internet so that I can quickly swap in a local jQuery resource instead of loading from CDN. While CDN loading with the fallback works it can be a bit slow as the CDN is probed first before the fallback kicks in. Switching quickly in one place makes this trivial. It also makes it very easy once a new version of jQuery rolls around to move up to the new version and ensure that all pages are using the new version immediately. I'm not trying to make this out as 'the' definite way to load your resources, but rather provide it here as a pointer so you can maybe apply your own logic to determine where scripts come from and how they load. You could even automate this some more by using configuration settings or reading the locations/preferences out of some sort of data/metadata store that can be dynamically updated instead via recompilation. FWIW, I use a very similar approach for loading jQuery UI and my own ww.jquery library - the same concept can be applied to any kind of script you might be loading from different locations. Hopefully some of you find this a useful addition to your toolset. Resources Google CDN for jQuery Full ControlResources Source Code ControlResource Documentation Westwind.Web NuGet This method is part of the Westwind.Web library of the West Wind Web Toolkit or you can grab the Web library from NuGet and add to your Visual Studio project. This package includes a host of Web related utilities and script support features. © Rick Strahl, West Wind Technologies, 2005-2011Posted in ASP.NET  jQuery   Tweet (function() { var po = document.createElement('script'); po.type = 'text/javascript'; po.async = true; po.src = 'https://apis.google.com/js/plusone.js'; var s = document.getElementsByTagName('script')[0]; s.parentNode.insertBefore(po, s); })();

    Read the article

< Previous Page | 294 295 296 297 298 299 300 301 302 303 304 305  | Next Page >