Search Results

Search found 94 results on 4 pages for 'datainputstream'.

Page 3/4 | < Previous Page | 1 2 3 4  | Next Page >

  • Functional programming approach for Java's input/output streams

    - by Elazar Leibovich
    I'm using Java's DataInputStream with scala to parse some simple binary file (which is very bad exprerience due to the lack of unsigned types, even in scala, but that's a different story). However I find myself forced to use mutable data structure, since Java's streams are inherently state preserving entities. What's a good design to wrap Java's streams with nice functional data structure?

    Read the article

  • Java NoSuchElementException using scanner.nextInt()

    - by othnin
    I am trying to read in a pgm file (512x512 array) and when I read in a larger file I get the error: java.util.NoSuchElementException on reading element (3,97). I have created a much smaller file to read (23x23) and it reads fine. Is there a size limit? I have checked the file and confirmed that there is an int for the value: This appears to be the line it crashes at: fileArray[row][col] = scan.nextInt(); Here is the file: import java.util.Scanner; import java.io.*; public class FileReader { public static void main(String[] args) throws IOException { String fileName = "lena.pgma"; int width, height, maxValue; FileInputStream fileInputStream = null; fileInputStream = new FileInputStream(fileName); Scanner scan = new Scanner(fileInputStream); // Discard the magic number scan.nextLine(); // Discard the comment line scan.nextLine(); // Read pic width, height and max value width = scan.nextInt(); System.out.println("Width: " + width); height = scan.nextInt(); System.out.println("Heigth: " + height); maxValue = scan.nextInt(); fileInputStream.close(); // Now parse the file as binary data FileInputStream fin = new FileInputStream(fileName); DataInputStream dis = new DataInputStream(fin); // look for 4 lines (i.e.: the header) and discard them int numnewlines = 4; while (numnewlines > 0) { char c; do { c = (char)(dis.readUnsignedByte()); } while (c != '\n'); numnewlines--; } // read the image data int[][] fileArray = new int[height][width]; for (int row = 0; row < height; row++) { for (int col = 0; col < width; col++) { fileArray[row][col] = scan.nextInt(); System.out.print("(" + row + " ," + col +"): " + fileArray[row][col]+ " "); } System.out.println(); } dis.close(); } } any advise would be appreciated.

    Read the article

  • when get pagecontent from URL the connect alway return nopermistion ?

    - by tiendv
    I have a methor to return pagecontent of link but when it run, alway return "Do not perrmisson ", plesea check it here is code to return string pagecontent public static String getPageContent(String targetURL) throws Exception { Hashtable contentHash = new Hashtable(); URL url; URLConnection conn; // The data streams used to read from and write to the URL connection. DataOutputStream out; DataInputStream in; // String returned as the result . String returnString = ""; // Create the URL object and make a connection to it. url = new URL(targetURL); conn = url.openConnection(); // check out permission of acess URL if (conn.getPermission() != null) { returnString = "Do not Permission access URL "; } else { // Set connection parameters. We need to perform input and output, // so set both as true. conn.setDoInput(true); conn.setDoOutput(true); // Disable use of caches. conn.setUseCaches(false); // Set the content type we are POSTing. We impersonate it as // encoded form data conn.setRequestProperty("Content-Type", "application/x-www-form-urlencoded"); // get the output stream . out = new DataOutputStream(conn.getOutputStream()); String content = ""; // Create a single String value pairs for all the keys // in the Hashtable passed to us. Enumeration e = contentHash.keys(); boolean first = true; while (e.hasMoreElements()) { // For each key and value pair in the hashtable Object key = e.nextElement(); Object value = contentHash.get(key); // If this is not the first key-value pair in the hashtable, // concantenate an "&" sign to the constructed String if (!first) content += "&"; // append to a single string. Encode the value portion content += (String) key + "=" + URLEncoder.encode((String) value); first = false; } // Write out the bytes of the content string to the stream. out.writeBytes(content); out.flush(); out.close(); // check if can't read from URL // Read input from the input stream. in = new DataInputStream(conn.getInputStream()); String str; while (null != ((str = in.readLine()))) { returnString += str + "\n"; } in.close(); } // return the string that was read. return returnString; }

    Read the article

  • Android , Read in binary data and write it to file

    - by Shpongle
    Hi all , Im trying to read in image file from a server , with the code below . It keeps going into the exception. I know the correct number of bytes are being sent as I print them out when received. Im sending the image file from python like so #open the image file and read it into an object imgfile = open (marked_image, 'rb') obj = imgfile.read() #get the no of bytes in the image and convert it to a string bytes = str(len(obj)) #send the number of bytes self.conn.send( bytes + '\n') if self.conn.sendall(obj) == None: imgfile.flush() imgfile.close() print 'Image Sent' else: print 'Error' Here is the android part , this is where I'm having the problem. Any suggestions on the best way to go about receiving the image and writing it to a file ? //read the number of bytes in the image String noOfBytes = in.readLine(); Toast.makeText(this, noOfBytes, 5).show(); byte bytes [] = new byte [Integer.parseInt(noOfBytes)]; //create a file to store the retrieved image File photo = new File(Environment.getExternalStorageDirectory(), "PostKey.jpg"); DataInputStream dis = new DataInputStream(link.getInputStream()); try{ os =new FileOutputStream(photo); byte buf[]=new byte[1024]; int len; while((len=dis.read(buf))>0) os.write(buf,0,len); Toast.makeText(this, "File recieved", 5).show(); os.close(); dis.close(); }catch(IOException e){ Toast.makeText(this, "An IO Error Occured", 5).show(); } EDIT: I still cant seem to get it working. I have been at it since and the result of all my efforts have either resulted in a file that is not the full size or else the app crashing. I know the file is not corrupt before sending server side. As far as I can tell its definitely sending too as the send all method in python sends all or throws an exception in the event of an error and so far it has never thrown an exception. So the client side is messed up . I have to send the file from the server so I cant use the suggestion suggested by Brian .

    Read the article

  • j2me or android file upload to jsp

    - by user313613
    hi i new to mobile development i like to upload the file from blackberry and android how to develop the mobile side to this jsp page. please do reply me thanks here i mention the jsp file from roseindia.net. <%@ page import="java.io.*" % <% //to get the content type information from JSP Request Header String contentType = request.getContentType(); //here we are checking the content type is not equal to Null and as well as the passed data from mulitpart/form-data is greater than or equal to 0 if ((contentType != null) && (contentType.indexOf("multipart/form-data") = 0)) { DataInputStream in = new DataInputStream(request. getInputStream()); //we are taking the length of Content type data int formDataLength = request.getContentLength(); byte dataBytes[] = new byte[formDataLength]; int byteRead = 0; int totalBytesRead = 0; //this loop converting the uploaded file into byte code while (totalBytesRead < formDataLength) { byteRead = in.read(dataBytes, totalBytesRead, formDataLength); totalBytesRead += byteRead; } String file = new String(dataBytes); //for saving the file name String saveFile = file.substring(file.indexOf("filename=\"") + 10); saveFile = saveFile.substring(0, saveFile.indexOf("\n")); saveFile = saveFile.substring(saveFile.lastIndexOf("\\") + 1,saveFile.indexOf("\"")); int lastIndex = contentType.lastIndexOf("="); String boundary = contentType.substring(lastIndex + 1, contentType.length()); int pos; //extracting the index of file pos = file.indexOf("filename=\""); pos = file.indexOf("\n", pos) + 1; pos = file.indexOf("\n", pos) + 1; pos = file.indexOf("\n", pos) + 1; int boundaryLocation = file.indexOf(boundary, pos) - 4; int startPos = ((file.substring(0, pos)).getBytes()).length; int endPos = ((file.substring(0, boundaryLocation)) .getBytes()).length; // creating a new file with the same name and writing the content in new file FileOutputStream fileOut = new FileOutputStream(saveFile); fileOut.write(dataBytes, startPos, (endPos - startPos)); fileOut.flush(); fileOut.close(); %><Br><table border="2"><tr><td><b>You have successfully upload the file by the name of: <% out.println(saveFile); % <% } %

    Read the article

  • Can I set a timeout for a InputStream's read() function?

    - by Zombies
    I have a DataInputStream that I obtained from a Socket. Is there any way I can set a timeout for dis.read(...)? Currently I spawn a new thread to do the read. While the parent thread does a thread.join(timeout) to wait before interrupting it. I am aware of nio, but I don't think I want to refactor that much at this point. Thanks.

    Read the article

  • How to Upload a file from client to server using OFBIZ?

    - by SIVAKUMAR.J
    Hi all, Im new to ofbiz.So is my question is have any mistake forgive me for my mistakes.Im new to ofbiz so i did not know some terminologies in ofbiz.Sometimes my question is not clear because of lack of knowledge in ofbiz.So try to understand my question and give me a good solution with respect to my level.Because some solutions are in very high level cannot able to understand for me.So please give the solution with good examples. My problem is i created a project inside the ofbiz/hot-deploy folder namely "productionmgntSystem".Inside the folder "ofbiz\hot-deploy\productionmgntSystem\webapp\productionmgntSystem" i created a .ftl file namely "app_details_1.ftl" .The following are the coding of this file <html> <head> <meta http-equiv="Content-Type" content="text/html; charset=ISO-8859-1"> <title>Insert title here</title> <script TYPE="TEXT/JAVASCRIPT" language=""JAVASCRIPT"> function uploadFile() { //alert("Before calling upload.jsp"); window.location='<@ofbizUrl>testing_service1</@ofbizUrl>' } </script> </head> <!-- <form action="<@ofbizUrl>testing_service1</@ofbizUrl>" enctype="multipart/form-data" name="app_details_frm"> --> <form action="<@ofbizUrl>logout1</@ofbizUrl>" enctype="multipart/form-data" name="app_details_frm"> <center style="height: 299px; "> <table border="0" style="height: 177px; width: 788px"> <tr style="height: 115px; "> <td style="width: 103px; "> <td style="width: 413px; "><h1>APPLICATION DETAILS</h1> <td style="width: 55px; "> </tr> <tr> <td style="width: 125px; ">Application name : </td> <td> <input name="app_name_txt" id="txt_1" value=" " /> </td> </tr> <tr> <td style="width: 125px; ">Excell sheet &nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;: </td> <td> <input type="file" name="filename"/> </td> </tr> <tr> <td> <!-- <input type="button" name="logout1_cmd" value="Logout" onclick="logout1()"/> --> <input type="submit" name="logout_cmd" value="logout"/> </td> <td> <!-- <input type="submit" name="upload_cmd" value="Submit" /> --> <input type="button" name="upload1_cmd" value="Upload" onclick="uploadFile()"/> </td> </tr> </table> </center> </form> </html> the following coding is present in the file "ofbiz\hot-deploy\productionmgntSystem\webapp\productionmgntSystem\WEB-INF\controller.xml" ...... ....... ........ <request-map uri="testing_service1"> <security https="true" auth="true"/> <event type="java" path="org.ofbiz.productionmgntSystem.web_app_req.WebServices1" invoke="testingService"/> <response name="ok" type="view" value="ok_view"/> <response name="exception" type="view" value="exception_view"/> </request-map> .......... ............ .......... <view-map name="ok_view" type="ftl" page="ok_view.ftl"/> <view-map name="exception_view" type="ftl" page="exception_view.ftl"/> ................ ............. ............. The following are the coding present in the file "ofbiz\hot-deploy\productionmgntSystem\src\org\ofbiz\productionmgntSystem\web_app_req\WebServices1.java" package org.ofbiz.productionmgntSystem.web_app_req; import javax.servlet.http.HttpServletRequest; import javax.servlet.http.HttpServletResponse; import java.io.DataInputStream; import java.io.FileOutputStream; import java.io.IOException; public class WebServices1 { public static String testingService(HttpServletRequest request, HttpServletResponse response) { //int i=0; String result="ok"; System.out.println("\n\n\t*************************************\n\tInside WebServices1.testingService(HttpServletRequest request, HttpServletResponse response)- Start"); String contentType=request.getContentType(); System.out.println("\n\n\t*************************************\n\tInside WebServices1.testingService(HttpServletRequest request, HttpServletResponse response)- contentType : "+contentType); String str=new String(); // response.setContentType("text/html"); //PrintWriter writer; if ((contentType != null) && (contentType.indexOf("multipart/form-data") >= 0)) { System.out.println("\n\n\t**********************************\n\tInside WebServices1.testingService(HttpServletRequest request, HttpServletResponse response) after if (contentType != null)"); try { // writer=response.getWriter(); System.out.println("\n\n\t**********************************\n\tInside WebServices1.testingService(HttpServletRequest request, HttpServletResponse response) - try Start"); DataInputStream in = new DataInputStream(request.getInputStream()); int formDataLength = request.getContentLength(); byte dataBytes[] = new byte[formDataLength]; int byteRead = 0; int totalBytesRead = 0; //this loop converting the uploaded file into byte code while (totalBytesRead < formDataLength) { byteRead = in.read(dataBytes, totalBytesRead,formDataLength); totalBytesRead += byteRead; } String file = new String(dataBytes); //for saving the file name String saveFile = file.substring(file.indexOf("filename=\"") + 10); saveFile = saveFile.substring(0, saveFile.indexOf("\n")); saveFile = saveFile.substring(saveFile.lastIndexOf("\\")+ 1,saveFile.indexOf("\"")); int lastIndex = contentType.lastIndexOf("="); String boundary = contentType.substring(lastIndex + 1,contentType.length()); int pos; //extracting the index of file pos = file.indexOf("filename=\""); pos = file.indexOf("\n", pos) + 1; pos = file.indexOf("\n", pos) + 1; pos = file.indexOf("\n", pos) + 1; int boundaryLocation = file.indexOf(boundary, pos) - 4; int startPos = ((file.substring(0, pos)).getBytes()).length; int endPos = ((file.substring(0, boundaryLocation)).getBytes()).length; //creating a new file with the same name and writing the content in new file FileOutputStream fileOut = new FileOutputStream("/"+saveFile); fileOut.write(dataBytes, startPos, (endPos - startPos)); fileOut.flush(); fileOut.close(); System.out.println("\n\n\t**********************************\n\tInside WebServices1.testingService(HttpServletRequest request, HttpServletResponse response) - try End"); } catch(IOException ioe) { System.out.println("\n\n\t*********************************\n\tInside WebServices1.testingService(HttpServletRequest request, HttpServletResponse response) - Catch IOException"); //ioe.printStackTrace(); return("exception"); } catch(Exception ex) { System.out.println("\n\n\t*********************************\n\tInside WebServices1.testingService(HttpServletRequest request, HttpServletResponse response) - Catch Exception"); return("exception"); } } else { System.out.println("\n\n\t********************************\n\tInside WebServices1.testingService(HttpServletRequest request, HttpServletResponse response) else part"); result="exception"; } System.out.println("\n\n\t*************************************\n\tInside WebServices1.testingService(HttpServletRequest request, HttpServletResponse response)- End"); return(result); } } I want to upload a file to the server.The file is get from user "<input type="file"..> tag in the "app_details_1.ftl" file & it is updated into the server by using the method "testingService(HttpServletRequest request, HttpServletResponse response)" in the class "WebServices1".But the file is not uploaded. Give me a good solution for uploading a file to the server. Thanks & Regards, Sivakumar.J

    Read the article

  • How do I use Java to sort surnames in alphabetical order from file to file?

    - by user577939
    I have written this code and don't know how to sort surnames in alphabetical order from my file to another file. import java.io.*; import java.util.*; class Asmuo { String pavarde; String vardas; long buvLaikas; int atv1; int atv2; int atv3; } class Irasas { Asmuo duom; Irasas kitas; } class Sarasas { private Irasas p; Sarasas() { p = null; } Irasas itrauktiElementa(String pv, String v, long laikas, int d0, int d1, int d2) { String pvrd, vrd; int data0; int data1; int data2; long lks; lks = laikas; pvrd = pv; vrd = v; data0 = d0; data1 = d1; data2 = d2; Irasas r = new Irasas(); r.duom = new Asmuo(); uzpildymasDuomenimis(r, pvrd, vrd, lks, d0, d1, d2); r.kitas = p; p = r; return r; } void uzpildymasDuomenimis(Irasas r, String pv, String v, long laik, int d0, int d1, int d2) { r.duom.pavarde = pv; r.duom.vardas = v; r.duom.atv1 = d0; r.duom.buvLaikas = laik; r.duom.atv2 = d1; r.duom.atv3 = d2; } void spausdinti() { Irasas d = p; int i = 0; try { FileWriter fstream = new FileWriter("rez.txt"); BufferedWriter rez = new BufferedWriter(fstream); while (d != null) { System.out.println(d.duom.pavarde + " " + d.duom.vardas + " " + d.duom.buvLaikas + " " + d.duom.atv1 + " " + d.duom.atv2 + " " + d.duom.atv3); rez.write(d.duom.pavarde + " " + d.duom.vardas + " " + d.duom.buvLaikas + " " + d.duom.atv1 + " " + d.duom.atv2 + " " + d.duom.atv3 + "\n"); d = d.kitas; i++; } rez.close(); } catch (Exception e) { System.err.println("Error: " + e.getMessage()); } } } public class Gyventojai { public static void main(String args[]) { Sarasas sar = new Sarasas(); Calendar atv = Calendar.getInstance(); Calendar isv = Calendar.getInstance(); try { FileInputStream fstream = new FileInputStream("duom.txt"); DataInputStream in = new DataInputStream(fstream); BufferedReader br = new BufferedReader(new InputStreamReader(in)); String eil; while ((eil = br.readLine()) != null) { String[] cells = eil.split(" "); String pvrd = cells[0]; String vrd = cells[1]; atv.set(Integer.parseInt(cells[2]), Integer.parseInt(cells[3]), Integer.parseInt(cells[4])); isv.set(Integer.parseInt(cells[5]), Integer.parseInt(cells[6]), Integer.parseInt(cells[7])); long laik = (isv.getTimeInMillis() - atv.getTimeInMillis()) / (24 * 60 * 60 * 1000); int d0 = Integer.parseInt(cells[2]); int d1 = Integer.parseInt(cells[3]); int d2 = Integer.parseInt(cells[4]); sar.itrauktiElementa(pvrd, vrd, laik, d0, d1, d2); } in.close(); } catch (Exception e) { System.err.println("Error: " + e.getMessage()); } sar.spausdinti(); } }

    Read the article

  • JAVA: POST data via HTTPS does not seem to get sent?

    - by ostollmann
    Hi guys (and girls), I have a problem POSTing data via HTTPS in Java. The server response is the same whether or not I send 'query'. Maybe someone can point out what the problem is... Thanks! Main class: package bind; public class Main { public static final String urlString = "https://www.sms.ethz.ch/cgi-bin/sms/send.pl"; public static void main(String[] args) { Message msg = new Message("Alles klar?"); URL url = new URL(urlString); String[][] values = new String[3][2]; values[0][0] = "action"; values[0][1] = "listoriginators"; values[1][0] = "username"; values[1][1] = "xxxxxx"; values[2][0] = "password"; values[2][1] = "xxxxxx"; Query query = new Query(values); System.out.println("Query: " + query.getQuery()); Request request = new Request(url.getURL(), query.getQuery()); } } Request class: package bind; public class Request { static private int ic = 0; private URL url; protected Request(java.net.URL URL, String query){ ic++; if(CONSTANTS.SHOW_LOGS) { System.out.println("log: new instance of 'Message'"); } // connect try { System.setProperty("java.protocol.handler.pkgs", "com.sun.net.ssl.internal.www.protocol"); java.security.Security.addProvider(new com.sun.net.ssl.internal.ssl.Provider()); javax.net.ssl.HttpsURLConnection connection = (javax.net.ssl.HttpsURLConnection) URL.openConnection(); connection.setDoInput(true); connection.setDoOutput(true); connection.setRequestMethod("POST"); connection.setFollowRedirects(true); connection.setRequestProperty("Content-Length", String.valueOf(query.length())); connection.setRequestProperty("Content-Type", "application/x-www- form-urlencoded"); connection.setRequestProperty("User-Agent", "Mozilla/4.0 (compatible; MSIE 6.0; Windows NT 5.1; SV1)"); java.io.DataOutputStream output = new java.io.DataOutputStream(connection.getOutputStream()); output.writeBytes(query); // <<-- NOTHING CHANGES IF I COMMENT THIS OUT OR NOT !!??!?! System.out.println("log: response code: " + connection.getResponseCode()); System.out.println("log: response message: " + connection.getResponseMessage()); java.io.DataInputStream input = new java.io.DataInputStream(connection.getInputStream()); for(int i = input.read(); i != -1; i = input.read()) { System.out.print((char)i); } System.out.print("\n"); input.close(); } catch(java.io.IOException e) { if(CONSTANTS.SHOW_LOGS) { System.out.println("error: unable to connect"); System.out.println(e); e.printStackTrace(); } } } } URL Class: public class URL { static private int ic = 0; private String URLString; private java.net.URL url; protected URL(String a_url){ ic++; if(CONSTANTS.SHOW_LOGS) { System.out.println("log: new instance of 'URL'"); } setURLString(a_url); createURL(); } private void setURLString(String a_url) { URLString = a_url; } private void createURL() { try { url = new java.net.URL(URLString); } catch(java.net.MalformedURLException e) { System.out.println("error: invalid URL"); System.out.println(e); e.printStackTrace(); } } private void showURL() { System.out.println("URL: " + url.getHost() + url.getPath()); } public java.net.URL getURL() { return url; } } PS: mostly from here: http://www.java-samples.com/java/POST-toHTTPS-url-free-java-sample-program.htm

    Read the article

  • multipart file-upload post request from java

    - by Martin
    I'm trying to make a program that uploads a image to a webserver that accepts multipart file-uploads. More specificly i want to make a http POST request to http://iqs.me that sends a file in the variable "pic". I've made a lot of tries but i don't know if i've even been close. The hardest part seems to be to get a HttpURLConnection to make a request of the type POST. The response i get looks like it makes a GET. (And i want to do this without any third party libs) UPDATE: non-working code goes here (no errors but doesn't seem to do a POST): HttpURLConnection conn = null; BufferedReader br = null; DataOutputStream dos = null; DataInputStream inStream = null; InputStream is = null; OutputStream os = null; boolean ret = false; String StrMessage = ""; String exsistingFileName = "myScreenShot.png"; String lineEnd = "\r\n"; String twoHyphens = "--"; String boundary = "*****"; int bytesRead, bytesAvailable, bufferSize; byte[] buffer; int maxBufferSize = 1*1024*1024; String responseFromServer = ""; String urlString = "http://iqs.local.com/index.php"; try{ FileInputStream fileInputStream = new FileInputStream( new File(exsistingFileName) ); URL url = new URL(urlString); conn = (HttpURLConnection) url.openConnection(); conn.setDoInput(true); conn.setDoOutput(true); conn.setRequestMethod("POST"); conn.setUseCaches(false); conn.setRequestProperty("Connection", "Keep-Alive"); conn.setRequestProperty("Content-Type", "multipart/form-data;boundary="+boundary); dos = new DataOutputStream( conn.getOutputStream() ); dos.writeBytes(twoHyphens + boundary + lineEnd); dos.writeBytes("Content-Disposition: form-data; name=\"pic\";" + " filename=\"" + exsistingFileName +"\"" + lineEnd); dos.writeBytes(lineEnd); bytesAvailable = fileInputStream.available(); bufferSize = Math.min(bytesAvailable, maxBufferSize); buffer = new byte[bufferSize]; bytesRead = fileInputStream.read(buffer, 0, bufferSize); while (bytesRead > 0){ dos.write(buffer, 0, bufferSize); bytesAvailable = fileInputStream.available(); bufferSize = Math.min(bytesAvailable, maxBufferSize); bytesRead = fileInputStream.read(buffer, 0, bufferSize); } dos.writeBytes(lineEnd); dos.writeBytes(twoHyphens + boundary + twoHyphens + lineEnd); fileInputStream.close(); dos.flush(); dos.close(); }catch (MalformedURLException ex){ System.out.println("Error:"+ex); }catch (IOException ioe){ System.out.println("Error:"+ioe); } try{ inStream = new DataInputStream ( conn.getInputStream() ); String str; while (( str = inStream.readLine()) != null){ System.out.println(str); } inStream.close(); }catch (IOException ioex){ System.out.println("Error: "+ioex); }

    Read the article

  • multipart file-upload post request from java

    - by Martin
    I'm trying to make a program that uploads a image to a webserver that accepts multipart file-uploads. More specificly i want to make a http POST request to http://iqs.me that sends a file in the variable "pic". I've made a lot of tries but i don't know if i've even been close. The hardest part seems to be to get a HttpURLConnection to make a request of the type POST. The response i get looks like it makes a GET. (And i want to do this without any third party libs) UPDATE: non-working code goes here (no errors but doesn't seem to do a POST): HttpURLConnection conn = null; BufferedReader br = null; DataOutputStream dos = null; DataInputStream inStream = null; InputStream is = null; OutputStream os = null; boolean ret = false; String StrMessage = ""; String exsistingFileName = "myScreenShot.png"; String lineEnd = "\r\n"; String twoHyphens = "--"; String boundary = "*****"; int bytesRead, bytesAvailable, bufferSize; byte[] buffer; int maxBufferSize = 1*1024*1024; String responseFromServer = ""; String urlString = "http://iqs.local.com/index.php"; try{ FileInputStream fileInputStream = new FileInputStream( new File(exsistingFileName) ); URL url = new URL(urlString); conn = (HttpURLConnection) url.openConnection(); conn.setDoInput(true); conn.setDoOutput(true); conn.setRequestMethod("POST"); conn.setUseCaches(false); conn.setRequestProperty("Connection", "Keep-Alive"); conn.setRequestProperty("Content-Type", "multipart/form-data;boundary="+boundary); dos = new DataOutputStream( conn.getOutputStream() ); dos.writeBytes(twoHyphens + boundary + lineEnd); dos.writeBytes("Content-Disposition: form-data; name=\"pic\";" + " filename=\"" + exsistingFileName +"\"" + lineEnd); dos.writeBytes(lineEnd); bytesAvailable = fileInputStream.available(); bufferSize = Math.min(bytesAvailable, maxBufferSize); buffer = new byte[bufferSize]; bytesRead = fileInputStream.read(buffer, 0, bufferSize); while (bytesRead > 0){ dos.write(buffer, 0, bufferSize); bytesAvailable = fileInputStream.available(); bufferSize = Math.min(bytesAvailable, maxBufferSize); bytesRead = fileInputStream.read(buffer, 0, bufferSize); } dos.writeBytes(lineEnd); dos.writeBytes(twoHyphens + boundary + twoHyphens + lineEnd); fileInputStream.close(); dos.flush(); dos.close(); }catch (MalformedURLException ex){ System.out.println("Error:"+ex); }catch (IOException ioe){ System.out.println("Error:"+ioe); } try{ inStream = new DataInputStream ( conn.getInputStream() ); String str; while (( str = inStream.readLine()) != null){ System.out.println(str); } inStream.close(); }catch (IOException ioex){ System.out.println("Error: "+ioex); }

    Read the article

  • RSA encryption/ Decryption in a client server application

    - by user308806
    Hi guys, probably missing something very straight forward on this, but please forgive me, I'm very naive! Have a client server application where the client identifies its self with an RSA encrypted username & password. Unfortunately I'm getting a "bad padding exception: data must start with zero" when i try to decrypt with the public key on the client side. I'm fairly sure the key is correct as I have tested encrypting with public key then decrypting with private key on the client side with no problems at all. Just seems when I transfer it over the connection it messses it up somehow?! Using PrintWriter & BufferedReader on the sockets if thats of importance. EncodeBASE64 & DecodeBASE64 encode byte[] to 64base and vice versa respectively. Any ideas guys?? Client side: Socket connectionToServer = new Socket("127.0.0.1", 7050); InputStream in = connectionToServer.getInputStream(); DataInputStream dis = new DataInputStream(in); int length = dis.readInt(); byte[] data = new byte[length]; // dis.readFully(data); dis.read(data); System.out.println("The received Data*****************************************"); System.out.println("The length of bits "+ length); System.out.println(data); System.out.println("***********************************************************"); Decryption d = new Decryption(); byte [] ttt = d.decrypt(data); System.out.print(data); String ss = new String(ttt); System.out.println("***********************"); System.out.println(ss); System.out.println("************************"); Server Side: in = connectionFromClient.getInputStream(); OutputStream out = connectionFromClient.getOutputStream(); DataOutputStream dataOut = new DataOutputStream(out); LicenseList licenses = new LicenseList(); String ValidIDs = licenses.getAllIDs(); System.out.println(ValidIDs); Encryption enc = new Encryption(); byte[] encrypted = enc.encrypt(ValidIDs); byte[] dd = enc.encrypt(ValidIDs); String tobesent = new String(dd); //byte[] rsult = enc.decrypt(dd); //String tt = String(rsult); System.out.println("The sent data**********************************************"); System.out.println(dd); String temp = new String(dd); System.out.println(temp); System.out.println("*************************************************************"); //BufferedWriter bf = new BufferedWriter(OutputStreamWriter(out)); //dataOut.write(ValidIDs.getBytes().length); dataOut.writeInt(ValidIDs.getBytes().length); dataOut.flush(); dataOut.write(encrypted); dataOut.flush(); System.out.println("********Testing**************"); System.out.println("Here are the ids:::"); System.out.println(licenses.getAllIDs()); System.out.println("**********************"); //bw.write("it is working well\n");

    Read the article

  • sort surname in alphabet from file to file JAVA

    - by user577939
    hello all. I need some help. I have wrote this code and dont now how to sort surnames in alphabet from my file to other file. import java.io.; import java.util.; class Asmuo { String pavarde; String vardas; long buvLaikas; int atv1; int atv2; int atv3; } class Irasas { Asmuo duom; Irasas kitas; } class Sarasas { private Irasas p; Sarasas() { p = null; } Irasas itrauktiElementa(String pv, String v, long laikas, int d0, int d1, int d2) { String pvrd, vrd; int data0; int data1; int data2; long lks; lks = laikas; pvrd = pv; vrd = v; data0 = d0; data1 = d1; data2 = d2; Irasas r = new Irasas(); r.duom = new Asmuo(); uzpildymasDuomenimis(r, pvrd, vrd, lks, d0, d1, d2); r.kitas = p; p = r; return r; } void uzpildymasDuomenimis(Irasas r, String pv, String v, long laik, int d0, int d1, int d2) { r.duom.pavarde = pv; r.duom.vardas = v; r.duom.atv1 = d0; r.duom.buvLaikas = laik; r.duom.atv2 = d1; r.duom.atv3 = d2; } void spausdinti() { Irasas d = p; int i = 0; try { FileWriter fstream = new FileWriter("rez.txt"); BufferedWriter rez = new BufferedWriter(fstream); while (d != null) { System.out.println(d.duom.pavarde + " " + d.duom.vardas + " " + d.duom.buvLaikas + " " + d.duom.atv1 + " " + d.duom.atv2 + " " + d.duom.atv3); rez.write(d.duom.pavarde + " " + d.duom.vardas + " " + d.duom.buvLaikas + " " + d.duom.atv1 + " " + d.duom.atv2 + " " + d.duom.atv3 + "\n"); d = d.kitas; i++; } rez.close(); } catch (Exception e) { System.err.println("Error: " + e.getMessage()); } } } public class Gyventojai { public static void main(String args[]) { Sarasas sar = new Sarasas(); Calendar atv = Calendar.getInstance(); Calendar isv = Calendar.getInstance(); try { FileInputStream fstream = new FileInputStream("duom.txt"); DataInputStream in = new DataInputStream(fstream); BufferedReader br = new BufferedReader(new InputStreamReader(in)); String eil; while ((eil = br.readLine()) != null) { String[] cells = eil.split(" "); String pvrd = cells[0]; String vrd = cells[1]; atv.set(Integer.parseInt(cells[2]), Integer.parseInt(cells[3]), Integer.parseInt(cells[4])); isv.set(Integer.parseInt(cells[5]), Integer.parseInt(cells[6]), Integer.parseInt(cells[7])); long laik = (isv.getTimeInMillis() - atv.getTimeInMillis()) / (24 * 60 * 60 * 1000); int d0 = Integer.parseInt(cells[2]); int d1 = Integer.parseInt(cells[3]); int d2 = Integer.parseInt(cells[4]); sar.itrauktiElementa(pvrd, vrd, laik, d0, d1, d2); } in.close(); } catch (Exception e) { System.err.println("Error: " + e.getMessage()); } sar.spausdinti(); } }

    Read the article

  • Java.lang.NullPointerException when using retreived Image (Unless method is used statically!)

    - by Emdiesse
    Hi there, This has been doing my head in all day and I have finally decided to resort to asking for help! In my MIDLet I have an instance of the java class ImageFetcher called anImg. Also within my MIDLet I have a command that simply say's fetch, a CommandListener that when detects fetch was clicked runs the function below. This function should simply run public getImage() from the anImg instance of class ImageFetcher which returns an image and then appends/sets this Image onto the form on the display. (You may recognise the getImage() function from the Nokia JavaME Wiki!!!) Instead of any image being displayed this is written to the output terminal in netbeans: Msg: Java.lang.NullPointerException HOWEVER, If I change public getImage() to public static getImage() and replace anImg.getImage() with ImageFetcher.getImage() the image is successfully displayed!!! Thank you for your replies on this issue :) I look forward to going my hair back after this ordeal! FetchImageApp.java ... ... ... private doThis(){ try { Image im; if ((im = anImg.getImage()) != null) { ImageItem ii = new ImageItem(null, im, ImageItem.LAYOUT_DEFAULT, null); // If there is already an image, set (replace) it if (form.size() != 0) { form.set(0, ii); } else // Append the image to the empty form { form.append(ii); } } else { form.append("Unsuccessful download."); } // Display the form with the image display.setCurrent(form); } catch (Exception e) { System.err.println("Msg: " + e.toString()); } } ... ... ... ImageFetcher.java ... ... ... /*-------------------------------------------------- * Open connection and download png into a byte array. *-------------------------------------------------*/ public Image getImage() throws IOException { String url = "http://kenai.com/attachments/wiki_images/chessgame/java-duke-logo.png"; ContentConnection connection = (ContentConnection) Connector.open(url); // * There is a bug in MIDP 1.0.3 in which read() sometimes returns // an invalid length. To work around this, I have changed the // stream to DataInputStream and called readFully() instead of read() // InputStream iStrm = connection.openInputStream(); DataInputStream iStrm = connection.openDataInputStream(); ByteArrayOutputStream bStrm = null; Image im = null; try { // ContentConnection includes a length method byte imageData[]; int length = (int) connection.getLength(); if (length != -1) { imageData = new byte[length]; // Read the png into an array // iStrm.read(imageData); iStrm.readFully(imageData); } else // Length not available... { bStrm = new ByteArrayOutputStream(); int ch; while ((ch = iStrm.read()) != -1) { bStrm.write(ch); } imageData = bStrm.toByteArray(); bStrm.close(); } // Create the image from the byte array im = Image.createImage(imageData, 0, imageData.length); } finally { // Clean up if (iStrm != null) { iStrm.close(); } if (connection != null) { connection.close(); } if (bStrm != null) { bStrm.close(); } } return (im == null ? null : im); } ... ... ...

    Read the article

  • A Look Inside JSR 360 - CLDC 8

    - by Roger Brinkley
    If you didn't notice during JavaOne the Java Micro Edition took a major step forward in its consolidation with Java Standard Edition when JSR 360 was proposed to the JCP community. Over the last couple of years there has been a focus to move Java ME back in line with it's big brother Java SE. We see evidence of this in JCP itself which just recently merged the ME and SE/EE Executive Committees into a single Java Executive Committee. But just before that occurred JSR 360 was proposed and approved for development on October 29. So let's take a look at what changes are now being proposed. In a way JSR 360 is returning back to the original roots of Java ME when it was first introduced. It was indeed a subset of the JDK 4 language, but as Java progressed many of the language changes were not implemented in the Java ME. Back then the tradeoff was still a functionality, footprint trade off but the major market was feature phones. Today the market has changed and CLDC, while it will still target feature phones, will have it primary emphasis on embedded devices like wireless modules, smart meters, health care monitoring and other M2M devices. The major changes will come in three areas: language feature changes, library changes, and consolidating the Generic Connection Framework.  There have been three Java SE versions that have been implemented since JavaME was first developed so the language feature changes can be divided into changes that came in JDK 5 and those in JDK 7, which mostly consist of the project Coin changes. There were no language changes in JDK 6 but the changes from JDK 5 are: Assertions - Assertions enable you to test your assumptions about your program. For example, if you write a method that calculates the speed of a particle, you might assert that the calculated speed is less than the speed of light. In the example code below if the interval isn't between 0 and and 1,00 the an error of "Invalid value?" would be thrown. private void setInterval(int interval) { assert interval > 0 && interval <= 1000 : "Invalid value?" } Generics - Generics add stability to your code by making more of your bugs detectable at compile time. Code that uses generics has many benefits over non-generic code with: Stronger type checks at compile time. Elimination of casts. Enabling programming to implement generic algorithms. Enhanced for Loop - the enhanced for loop allows you to iterate through a collection without having to create an Iterator or without having to calculate beginning and end conditions for a counter variable. The enhanced for loop is the easiest of the new features to immediately incorporate in your code. In this tip you will see how the enhanced for loop replaces more traditional ways of sequentially accessing elements in a collection. void processList(Vector<string> list) { for (String item : list) { ... Autoboxing/Unboxing - This facility eliminates the drudgery of manual conversion between primitive types, such as int and wrapper types, such as Integer.  Hashtable<Integer, string=""> data = new Hashtable<>(); void add(int id, String value) { data.put(id, value); } Enumeration - Prior to JDK 5 enumerations were not typesafe, had no namespace, were brittle because they were compile time constants, and provided no informative print values. JDK 5 added support for enumerated types as a full-fledged class (dubbed an enum type). In addition to solving all the problems mentioned above, it allows you to add arbitrary methods and fields to an enum type, to implement arbitrary interfaces, and more. Enum types provide high-quality implementations of all the Object methods. They are Comparable and Serializable, and the serial form is designed to withstand arbitrary changes in the enum type. enum Season {WINTER, SPRING, SUMMER, FALL}; } private Season season; void setSeason(Season newSeason) { season = newSeason; } Varargs - Varargs eliminates the need for manually boxing up argument lists into an array when invoking methods that accept variable-length argument lists. The three periods after the final parameter's type indicate that the final argument may be passed as an array or as a sequence of arguments. Varargs can be used only in the final argument position. void warning(String format, String... parameters) { .. for(String p : parameters) { ...process(p);... } ... } Static Imports -The static import construct allows unqualified access to static members without inheriting from the type containing the static members. Instead, the program imports the members either individually or en masse. Once the static members have been imported, they may be used without qualification. The static import declaration is analogous to the normal import declaration. Where the normal import declaration imports classes from packages, allowing them to be used without package qualification, the static import declaration imports static members from classes, allowing them to be used without class qualification. import static data.Constants.RATIO; ... double r = Math.cos(RATIO * theta); Annotations - Annotations provide data about a program that is not part of the program itself. They have no direct effect on the operation of the code they annotate. There are a number of uses for annotations including information for the compiler, compiler-time and deployment-time processing, and run-time processing. They can be applied to a program's declarations of classes, fields, methods, and other program elements. @Deprecated public void clear(); The language changes from JDK 7 are little more familiar as they are mostly the changes from Project Coin: String in switch - Hey it only took us 18 years but the String class can be used in the expression of a switch statement. Fortunately for us it won't take that long for JavaME to adopt it. switch (arg) { case "-data": ... case "-out": ... Binary integral literals and underscores in numeric literals - Largely for readability, the integral types (byte, short, int, and long) can also be expressed using the binary number system. and any number of underscore characters (_) can appear anywhere between digits in a numerical literal. byte flags = 0b01001111; long mask = 0xfff0_ff08_4fff_0fffl; Multi-catch and more precise rethrow - A single catch block can handle more than one type of exception. In addition, the compiler performs more precise analysis of rethrown exceptions than earlier releases of Java SE. This enables you to specify more specific exception types in the throws clause of a method declaration. catch (IOException | InterruptedException ex) { logger.log(ex); throw ex; } Type Inference for Generic Instance Creation - Otherwise known as the diamond operator, the type arguments required to invoke the constructor of a generic class can be replaced with an empty set of type parameters (<>) as long as the compiler can infer the type arguments from the context.  map = new Hashtable<>(); Try-with-resource statement - The try-with-resources statement is a try statement that declares one or more resources. A resource is an object that must be closed after the program is finished with it. The try-with-resources statement ensures that each resource is closed at the end of the statement.  try (DataInputStream is = new DataInputStream(...)) { return is.readDouble(); } Simplified varargs method invocation - The Java compiler generates a warning at the declaration site of a varargs method or constructor with a non-reifiable varargs formal parameter. Java SE 7 introduced a compiler option -Xlint:varargs and the annotations @SafeVarargs and @SuppressWarnings({"unchecked", "varargs"}) to supress these warnings. On the library side there are new features that will be added to satisfy the language requirements above and some to improve the currently available set of APIs.  The library changes include: Collections update - New Collection, List, Set and Map, Iterable and Iteratator as well as implementations including Hashtable and Vector. Most of the work is too support generics String - New StringBuilder and CharSequence as well as a Stirng formatter. The javac compiler  now uses the the StringBuilder instead of String Buffer. Since StringBuilder is synchronized there is a performance increase which has necessitated the wahat String constructor works. Comparable interface - The comparable interface works with Collections, making it easier to reuse. Try with resources - Closeable and AutoCloseable Annotations - While support for Annotations is provided it will only be a compile time support. SuppressWarnings, Deprecated, Override NIO - There is a subset of NIO Buffer that have been in use on the of the graphics packages and needs to be pulled in and also support for NIO File IO subset. Platform extensibility via Service Providers (ServiceLoader) - ServiceLoader interface dos late bindings of interface to existing implementations. It helpe to package an interface and behavior of the implementation at a later point in time.Provider classes must have a zero-argument constructor so that they can be instantiated during loading. They are located and instantiated on demand and are identified via a provider-configuration file in the METAINF/services resource directory. This is a mechansim from Java SE. import com.XYZ.ServiceA; ServiceLoader<ServiceA> sl1= new ServiceLoader(ServiceA.class); Resources: META-INF/services/com.XYZ.ServiceA: ServiceAProvider1 ServiceAProvider2 ServiceAProvider3 META-INF/services/ServiceB: ServiceBProvider1 ServiceBProvider2 From JSR - I would rather use this list I think The Generic Connection Framework (GCF) was previously specified in a number of different JSRs including CLDC, MIDP, CDC 1.2, and JSR 197. JSR 360 represents a rare opportunity to consolidated and reintegrate parts that were duplicated in other specifications into a single specification, upgrade the APIs as well provide new functionality. The proposal is to specify a combined GCF specification that can be used with Java ME or Java SE and be backwards compatible with previous implementations. Because of size limitations as well as the complexity of the some features like InvokeDynamic and Unicode 6 will not be included. Additionally, any language or library changes in JDK 8 will be not be included. On the upside, with all the changes being made, backwards compatibility will still be maintained. JSR 360 is a major step forward for Java ME in terms of platform modernization, language alignment, and embedded support. If you're interested in following the progress of this JSR see the JSR's java.net project for details of the email lists, discussions groups.

    Read the article

  • ActiveMQ - "Cannot send, channel has already failed" every 2 seconds?

    - by quanta
    ActiveMQ 5.7.0 In the activemq.log, I'm seeing this exception every 2 seconds: 2013-11-05 13:00:52,374 | DEBUG | Transport Connection to: tcp://127.0.0.1:37501 failed: org.apache.activemq.transport.InactivityIOException: Cannot send, channel has already failed: tcp://127.0.0.1:37501 | org.apache.activemq.broker.TransportConnection.Transport | Async Exception Handler org.apache.activemq.transport.InactivityIOException: Cannot send, channel has already failed: tcp://127.0.0.1:37501 at org.apache.activemq.transport.AbstractInactivityMonitor.doOnewaySend(AbstractInactivityMonitor.java:282) at org.apache.activemq.transport.AbstractInactivityMonitor.oneway(AbstractInactivityMonitor.java:271) at org.apache.activemq.transport.TransportFilter.oneway(TransportFilter.java:85) at org.apache.activemq.transport.WireFormatNegotiator.oneway(WireFormatNegotiator.java:104) at org.apache.activemq.transport.MutexTransport.oneway(MutexTransport.java:68) at org.apache.activemq.broker.TransportConnection.dispatch(TransportConnection.java:1312) at org.apache.activemq.broker.TransportConnection.processDispatch(TransportConnection.java:838) at org.apache.activemq.broker.TransportConnection.iterate(TransportConnection.java:873) at org.apache.activemq.thread.PooledTaskRunner.runTask(PooledTaskRunner.java:129) at org.apache.activemq.thread.PooledTaskRunner$1.run(PooledTaskRunner.java:47) at java.util.concurrent.ThreadPoolExecutor$Worker.runTask(ThreadPoolExecutor.java:886) at java.util.concurrent.ThreadPoolExecutor$Worker.run(ThreadPoolExecutor.java:908) at java.lang.Thread.run(Thread.java:662) Due to this keyword InactivityIOException, the first thing comes to my mind is InactivityMonitor, but the strange thing is MaxInactivityDuration=30000: 2013-11-05 13:11:02,672 | DEBUG | Sending: WireFormatInfo { version=9, properties={MaxFrameSize=9223372036854775807, CacheSize=1024, CacheEnabled=true, SizePrefixDisabled=false, MaxInactivityDurationInitalDelay=10000, TcpNoDelayEnabled=true, MaxInactivityDuration=30000, TightEncodingEnabled=true, StackTraceEnabled=true}, magic=[A,c,t,i,v,e,M,Q]} | org.apache.activemq.transport.WireFormatNegotiator | ActiveMQ BrokerService[localhost] Task-2 Moreover, I also didn't see something like this: No message received since last read check for ... or: Channel was inactive for too (30000) long Do a netstat, I see these connections in TIME_WAIT state: tcp 0 0 127.0.0.1:38545 127.0.0.1:61616 TIME_WAIT - tcp 0 0 127.0.0.1:38544 127.0.0.1:61616 TIME_WAIT - tcp 0 0 127.0.0.1:38522 127.0.0.1:61616 TIME_WAIT - Here're the output when running tcpdump: Internet Protocol Version 4, Src: 127.0.0.1 (127.0.0.1), Dst: 127.0.0.1 (127.0.0.1) Version: 4 Header length: 20 bytes Differentiated Services Field: 0x00 (DSCP 0x00: Default; ECN: 0x00: Not-ECT (Not ECN-Capable Transport)) 0000 00.. = Differentiated Services Codepoint: Default (0x00) .... ..00 = Explicit Congestion Notification: Not-ECT (Not ECN-Capable Transport) (0x00) Total Length: 296 Identification: 0x7b6a (31594) Flags: 0x02 (Don't Fragment) 0... .... = Reserved bit: Not set .1.. .... = Don't fragment: Set ..0. .... = More fragments: Not set Fragment offset: 0 Time to live: 64 Protocol: TCP (6) Header checksum: 0xc063 [correct] [Good: True] [Bad: False] Source: 127.0.0.1 (127.0.0.1) Destination: 127.0.0.1 (127.0.0.1) Transmission Control Protocol, Src Port: 61616 (61616), Dst Port: 54669 (54669), Seq: 1, Ack: 2, Len: 244 Source port: 61616 (61616) Destination port: 54669 (54669) [Stream index: 11] Sequence number: 1 (relative sequence number) [Next sequence number: 245 (relative sequence number)] Acknowledgement number: 2 (relative ack number) Header length: 32 bytes Flags: 0x018 (PSH, ACK) 000. .... .... = Reserved: Not set ...0 .... .... = Nonce: Not set .... 0... .... = Congestion Window Reduced (CWR): Not set .... .0.. .... = ECN-Echo: Not set .... ..0. .... = Urgent: Not set .... ...1 .... = Acknowledgement: Set .... .... 1... = Push: Set .... .... .0.. = Reset: Not set .... .... ..0. = Syn: Not set .... .... ...0 = Fin: Not set Window size value: 256 [Calculated window size: 32768] [Window size scaling factor: 128] Checksum: 0xff1c [validation disabled] [Good Checksum: False] [Bad Checksum: False] Options: (12 bytes) No-Operation (NOP) No-Operation (NOP) Timestamps: TSval 2304161892, TSecr 2304161891 Kind: Timestamp (8) Length: 10 Timestamp value: 2304161892 Timestamp echo reply: 2304161891 [SEQ/ACK analysis] [Bytes in flight: 244] Constrained Application Protocol, TID: 240, Length: 244 00.. .... = Version: 0 ..00 .... = Type: Confirmable (0) .... 0000 = Option Count: 0 Code: Unknown (0) Transaction ID: 240 Payload Content-Type: text/plain (default), Length: 240, offset: 4 Line-based text data: text/plain [truncated] \001ActiveMQ\000\000\000\t\001\000\000\000<DE>\000\000\000\t\000\fMaxFrameSize\006\177<FF><FF><FF><FF> <FF><FF><FF>\000\tCacheSize\005\000\000\004\000\000\fCacheEnabled\001\001\000\022SizePrefixDisabled\001\000\000 MaxInactivityDurationInitalDelay\006\ It is very likely a tcp port check. This is what I see when trying telnet from another host: 2013-11-05 16:12:41,071 | DEBUG | Transport Connection to: tcp://10.8.20.9:46775 failed: java.io.EOFException | org.apache.activemq.broker.TransportConnection.Transport | ActiveMQ Transport: tcp:///10.8.20.9:46775@61616 java.io.EOFException at java.io.DataInputStream.readInt(DataInputStream.java:375) at org.apache.activemq.openwire.OpenWireFormat.unmarshal(OpenWireFormat.java:275) at org.apache.activemq.transport.tcp.TcpTransport.readCommand(TcpTransport.java:229) at org.apache.activemq.transport.tcp.TcpTransport.doRun(TcpTransport.java:221) at org.apache.activemq.transport.tcp.TcpTransport.run(TcpTransport.java:204) at java.lang.Thread.run(Thread.java:662) 2013-11-05 16:12:41,071 | DEBUG | Transport Connection to: tcp://10.8.20.9:46775 failed: org.apache.activemq.transport.InactivityIOException: Cannot send, channel has already failed: tcp://10.8.20.9:46775 | org.apache.activemq.broker.TransportConnection.Transport | Async Exception Handler org.apache.activemq.transport.InactivityIOException: Cannot send, channel has already failed: tcp://10.8.20.9:46775 at org.apache.activemq.transport.AbstractInactivityMonitor.doOnewaySend(AbstractInactivityMonitor.java:282) at org.apache.activemq.transport.AbstractInactivityMonitor.oneway(AbstractInactivityMonitor.java:271) at org.apache.activemq.transport.TransportFilter.oneway(TransportFilter.java:85) at org.apache.activemq.transport.WireFormatNegotiator.oneway(WireFormatNegotiator.java:104) at org.apache.activemq.transport.MutexTransport.oneway(MutexTransport.java:68) at org.apache.activemq.broker.TransportConnection.dispatch(TransportConnection.java:1312) at org.apache.activemq.broker.TransportConnection.processDispatch(TransportConnection.java:838) at org.apache.activemq.broker.TransportConnection.iterate(TransportConnection.java:873) at org.apache.activemq.thread.PooledTaskRunner.runTask(PooledTaskRunner.java:129) at org.apache.activemq.thread.PooledTaskRunner$1.run(PooledTaskRunner.java:47) at java.util.concurrent.ThreadPoolExecutor$Worker.runTask(ThreadPoolExecutor.java:886) at java.util.concurrent.ThreadPoolExecutor$Worker.run(ThreadPoolExecutor.java:908) at java.lang.Thread.run(Thread.java:662) 2013-11-05 16:12:41,071 | DEBUG | Unregistering MBean org.apache.activemq:BrokerName=localhost,Type=Connection,ConnectorName=ope nwire,ViewType=address,Name=tcp_//10.8.20.9_46775 | org.apache.activemq.broker.jmx.ManagementContext | ActiveMQ Transport: tcp:/ //10.8.20.9:46775@61616 2013-11-05 16:12:41,073 | DEBUG | Stopping connection: tcp://10.8.20.9:46775 | org.apache.activemq.broker.TransportConnection | ActiveMQ BrokerService[localhost] Task-5 2013-11-05 16:12:41,073 | DEBUG | Stopping transport tcp:///10.8.20.9:46775@61616 | org.apache.activemq.transport.tcp.TcpTranspo rt | ActiveMQ BrokerService[localhost] Task-5 2013-11-05 16:12:41,073 | DEBUG | Initialized TaskRunnerFactory[ActiveMQ Task] using ExecutorService: java.util.concurrent.Threa dPoolExecutor@23cc2a28 | org.apache.activemq.thread.TaskRunnerFactory | ActiveMQ BrokerService[localhost] Task-5 2013-11-05 16:12:41,074 | DEBUG | Closed socket Socket[addr=/10.8.20.9,port=46775,localport=61616] | org.apache.activemq.transpo rt.tcp.TcpTransport | ActiveMQ Task-1 2013-11-05 16:12:41,074 | DEBUG | Forcing shutdown of ExecutorService: java.util.concurrent.ThreadPoolExecutor@23cc2a28 | org.apache.activemq.util.ThreadPoolUtils | ActiveMQ BrokerService[localhost] Task-5 2013-11-05 16:12:41,074 | DEBUG | Stopped transport: tcp://10.8.20.9:46775 | org.apache.activemq.broker.TransportConnection | ActiveMQ BrokerService[localhost] Task-5 2013-11-05 16:12:41,074 | DEBUG | Connection Stopped: tcp://10.8.20.9:46775 | org.apache.activemq.broker.TransportConnection | ActiveMQ BrokerService[localhost] Task-5 2013-11-05 16:12:41,902 | DEBUG | Sending: WireFormatInfo { version=9, properties={MaxFrameSize=9223372036854775807, CacheSize=1024, CacheEnabled=true, SizePrefixDisabled=false, MaxInactivityDurationInitalDelay=10000, TcpNoDelayEnabled=true, MaxInactivityDuration=30000, TightEncodingEnabled=true, StackTraceEnabled=true}, magic=[A,c,t,i,v,e,M,Q]} | org.apache.activemq.transport.WireFormatNegotiator | ActiveMQ BrokerService[localhost] Task-5 So the question is: how can I find out the process that is trying to connect to my ActiveMQ (from localhost) every 2 seconds?

    Read the article

  • java.sql.SQLException: Operation not allowed after ResultSet closed

    - by javatraniee
    Why am I getting an Resultset already closed error? public class Server implements Runnable { private static int port = 1600, maxConnections = 0; public static Connection connnew = null; public static Connection connnew1 = null; public static Statement stnew, stnew1, stnew2, stnew3, stnew4; public void getConnection() { try { Class.forName("org.gjt.mm.mysql.Driver"); connnew = DriverManager.getConnection("jdbc:mysql://localhost/db_alldata", "root", "flashkit"); connnew1 = DriverManager.getConnection("jdbc:mysql://localhost/db_main", "root", "flashkit"); stnew = connnew.createStatement(); stnew1 = connnew.createStatement(); stnew2 = connnew1.createStatement(); stnew3 = connnew1.createStatement(); stnew4 = connnew1.createStatement(); } catch (Exception e) { System.out.print("Get Connection Exception---" + new SimpleDateFormat("yyyy-MM-dd HH:mm:ss").format(new Date()) + "----- > " + e); } } public void closeConnection() { try { if (!(connnew.isClosed())) { stnew.close(); stnew1.close(); connnew.close(); } if (!(connnew1.isClosed())) { stnew2.close(); stnew3.close(); stnew4.close(); connnew1.close(); } } catch (Exception e) { System.out.print("Close Connection Closing Exception-----" + new SimpleDateFormat("yyyy-MM-dd HH:mm:ss").format(new Date()) + "------->" + e); } } Server() { try { } catch (Exception ee) { System.out.print("Server Exceptions in main connection--" + new SimpleDateFormat("yyyy-MM-dd HH:mm:ss").format(new Date()) + "------>" + ee); } } public static void main(String[] args) throws SQLException { int i = 0; Server STUD = new Server(); STUD.getConnection(); try { ServerSocket listener = new ServerSocket(port); Socket server; while ((i++ < maxConnections) || (maxConnections == 0)) { @SuppressWarnings("unused") doComms connection; server = listener.accept(); try { ResultSet checkconnection = stnew4 .executeQuery("select count(*) from t_studentdetails"); if (checkconnection.next()) { // DO NOTHING IF EXCEPTION THEN CLOSE ALL CONNECTIONS AND OPEN NEW // CONNECTIONS } } catch (Exception e) { System.out.print("Db Connection Lost Closing And Re-Opning It--------" + new SimpleDateFormat("yyyy-MM-dd HH:mm:ss").format(new Date()) + "--------" + e); STUD.closeConnection(); STUD.getConnection(); } doComms conn_c = new doComms(server, stnew, stnew1, stnew2, stnew3); Thread t = new Thread(conn_c); t.start(); } } catch (IOException ioe) { System.out.println("Main IOException on socket listen: " + ioe); } } public void run() { } } class doComms implements Runnable { private Socket server; private String input; static Connection conn = null; static Connection conn1 = null; static Statement st, st1, st2, st3; doComms(Socket server, Statement st, Statement st1, Statement st2, Statement st3) { this.server = server; doComms.st = st; doComms.st1 = st1; doComms.st2 = st2; doComms.st3 = st3; } @SuppressWarnings("deprecation") public void run() { input = ""; // char ch; try { DataInputStream in = new DataInputStream(server.getInputStream()); OutputStreamWriter outgoing = new OutputStreamWriter(server.getOutputStream()); while (!(null == (input = in.readLine()))) { savetodatabase(input, server.getPort(), outgoing); } } catch (IOException ioe) { System.out.println("RUN IOException on socket listen:-------" + new SimpleDateFormat("yyyy-MM-dd HH:mm:ss").format(new Date()) + "----- " + ioe); ioe.printStackTrace(); } } public void savetodatabase(String line, int port1, OutputStreamWriter outgoing) { try { String Rollno = "-", name = "-", div = "-", storeddate = "-", storedtime = "-", mailfrom = ""; String newline = line; String unitid = "-"; storeddate = new SimpleDateFormat("yyyy-MM-dd").format(new java.util.Date()); storedtime = new SimpleDateFormat("HH:mm:ss").format(new java.util.Date()); String sql2 = "delete from t_currentport where PortNumber='" + port1 + "''"; st2.executeUpdate(sql2); sql2 = "insert into t_currentport (unitid, portnumber,thedate,thetime) values >('" + unitid + "','" + port1 + "','" + storeddate + "','" + storedtime + "')"; st2.executeUpdate(sql2); String tablename = GetTable(); String sql = "select * from t_studentdetails where Unitid='" + unitid + "'"; ResultSet rst = st2.executeQuery(sql); if (rst.next()) { Rollno = rst.getString("Rollno"); name = rst.getString("name"); div = rst.getString("div"); } String sql1 = "insert into studentInfo StoredDate,StoredTime,Subject,UnitId,Body,Status,Rollno,div,VehId,MailDate,MailTime,MailFrom,MailTo,Header,UnProcessedStamps) values('" + storeddate + "','" + storedtime + "','" + unitid + "','" + unitid + "','" + newline + "','Pending','" + Rollno + "','" + div + "','" + name + "','" + storeddate + "','" + storedtime + "','" + mailfrom + "','" + mailfrom + "','-','-')"; st1.executeUpdate(sql1); } catch (Exception e) { System.out.print("Save to db Connection Exception--" + new SimpleDateFormat("yyyy-MM-dd HH:mm:ss").format(new Date()) + "-->" + e); } } }

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • Writing Java code in Matlab?

    - by scooziexp
    Hi, I'm trying to use the Java commands pw.println() and br.readLine() in Matlab because I have set up a socket (input_socket2) between Matlab and a command-line program I want to control using Java classes BufferedReader and PrintWriter. Before the following snippet of code, I implemented another socket that goes between 2 computers. This works great and I also know that the following snippet of code successfully opens up a communication line between Matlab and the other program. However, Matlab throws an error at pw.println('noop'). I think it has something to do with syntax, but I'm not sure how to write the command in Matlab syntax then: try input_socket2 = Socket(host2,port2); input_stream2 = input_socket2.getInputStream; d_input_stream2 = DataInputStream(input_stream2); br = BufferedReader(InputStreamReader(input_stream2)); pw = PrintWriter(input_socket2.getOutputStream,true); pw.println('noop') br.read end Any ideas?

    Read the article

  • ResultSet Already closed error

    - by javatraniee
    why am i getting an error of resultset already closed error public class Server implements Runnable { private static int port=1600, maxConnections=0; public static Connection connnew=null; public static Connection connnew1=null; public static Statement stnew,stnew1,stnew2,stnew3,stnew4; public void getConnection() { try{ Class.forName("org.gjt.mm.mysql.Driver"); connnew= DriverManager.getConnection("jdbc:mysql://localhost/db_alldata","root","flashkit"); connnew1= DriverManager.getConnection("jdbc:mysql://localhost/db_main","root","flashkit"); stnew=connnew.createStatement(); stnew1=connnew.createStatement(); stnew2=connnew1.createStatement(); stnew3=connnew1.createStatement(); stnew4=connnew1.createStatement(); }catch (Exception e) { System.out.print("Get Connection Exception---"+new SimpleDateFormat("yyyy-MM-dd HH:mm:ss").format(new Date())+"----- "+e); } } public void closeConnection() { try{ if(!(connnew.isClosed())) { stnew.close(); stnew1.close(); connnew.close(); } if(!(connnew1.isClosed())) { stnew2.close(); stnew3.close(); stnew4.close(); connnew1.close(); } }catch (Exception e) { System.out.print("Close Connection Closing Exception-----"+new SimpleDateFormat("yyyy-MM-dd HH:mm:ss").format(new Date())+"-------"+e); } } Server() { try{ }catch(Exception ee) { System.out.print("Server Exceptions in main connection--"+new SimpleDateFormat("yyyy-MM-dd HH:mm:ss").format(new Date())+"------"+ee); } } public static void main(String[] args) throws SQLException { int i=0; Server STUD= new Server(); STUD.getConnection(); try { ServerSocket listener = new ServerSocket(port); Socket server; while((i++ < maxConnections) || (maxConnections == 0)) { @SuppressWarnings("unused") doComms connection; server = listener.accept(); try{ ResultSet checkconnection=stnew4.executeQuery("select count(*) from t_studentdetails"); if(checkconnection.next()) { //DO NOTHING IF EXCEPTION THEN CLOSE ALL CONNECTIONS AND OPEN NEW CONNECTIONS } }catch (Exception e) { System.out.print("Db Connection Lost Closing And Re-Opning It--------"+new SimpleDateFormat("yyyy-MM-dd HH:mm:ss").format(new Date())+"--------"+e); STUD.closeConnection(); STUD.getConnection(); } doComms conn_c= new doComms(server,stnew,stnew1,stnew2,stnew3); Thread t = new Thread(conn_c); t.start(); } }catch (IOException ioe) { System.out.println("Main IOException on socket listen: " + ioe); } } public void run() { } } class doComms implements Runnable { private Socket server; private String input; static Connection conn=null; static Connection conn1=null; static Statement st,st1,st2,st3; doComms(Socket server, Statement st,Statement st1,Statement st2,Statement st3 ) { this.server=server; doComms.st=st; doComms.st1=st1; doComms.st2=st2; doComms.st3=st3; } @SuppressWarnings("deprecation") public void run () { input=""; //char ch; try { DataInputStream in = new DataInputStream (server.getInputStream()); OutputStreamWriter outgoing=new OutputStreamWriter(server.getOutputStream()); while(!(null==(input=in.readLine()))) { savetodatabase(input,server.getPort(),outgoing); } //server.close(); } catch (IOException ioe) { System.out.println("RUN IOException on socket listen:-------"+new SimpleDateFormat("yyyy-MM-dd HH:mm:ss").format(new Date())+"----- " + ioe); ioe.printStackTrace(); } } public void savetodatabase(String line, int port1, OutputStreamWriter outgoing) { try { String Rollno="-",name="-",div="-",storeddate="-",storedtime="-",mailfrom=""; String newline=line; String unitid="-"; storeddate=new SimpleDateFormat("yyyy-MM-dd").format(new java.util.Date()); storedtime=new SimpleDateFormat("HH:mm:ss").format(new java.util.Date()); String sql2="delete from t_currentport where PortNumber='"+port1+"''"; st2.executeUpdate(sql2); sql2="insert into t_currentport (unitid, portnumber,thedate,thetime) values ('"+unitid+"','"+port1+"','"+storeddate+"','"+storedtime+"')"; st2.executeUpdate(sql2); String tablename=GetTable(); String sql="select * from t_studentdetails where Unitid='"+unitid+"'"; ResultSet rst=st2.executeQuery(sql); if(rst.next()) { Rollno=rst.getString("Rollno"); name=rst.getString("name"); div=rst.getString("div"); } String sql1="insert into studentInfo StoredDate,StoredTime,Subject,UnitId,Body,Status,Rollno,div,VehId,MailDate,MailTime,MailFrom,MailTo,Header,UnProcessedStamps) values('"+storeddate+"','"+storedtime+"','"+unitid+"','"+unitid+"','"+newline+"','Pending','"+Rollno+"','"+div+"','"+name+"','"+storeddate+"','"+storedtime+"','"+mailfrom+"','"+mailfrom+"','-','-')"; st1.executeUpdate(sql1); }catch(Exception e) { System.out.print("Save to db Connection Exception--"+new SimpleDateFormat("yyyy-MM-dd HH:mm:ss").format(new Date())+"-->"+e); } } }

    Read the article

  • opengl problem works on droid but not droid eris and others.

    - by nathan
    This GlRenderer works fine on the moto droid, but does not work well at all on droid eris or other android phones does anyone know why? package com.ntu.way2fungames.spacehockeybase; import java.io.DataInputStream; import java.io.IOException; import java.nio.Buffer; import java.nio.FloatBuffer; import javax.microedition.khronos.egl.EGLConfig; import javax.microedition.khronos.opengles.GL10; import com.ntu.way2fungames.LoadFloatArray; import com.ntu.way2fungames.OGLTriReader; import android.content.res.AssetManager; import android.content.res.Resources; import android.opengl.GLU; import android.opengl.GLSurfaceView.Renderer; import android.os.Handler; import android.os.Message; public class GlRenderer extends Thread implements Renderer { private float drawArray[]; private float yoff; private float yoff2; private long lastRenderTime; private float[] yoffs= new float[10]; int Width; int Height; private float[] pixelVerts = new float[] { +.0f,+.0f,2, +.5f,+.5f,0, +.5f,-.5f,0, +.0f,+.0f,2, +.5f,-.5f,0, -.5f,-.5f,0, +.0f,+.0f,2, -.5f,-.5f,0, -.5f,+.5f,0, +.0f,+.0f,2, -.5f,+.5f,0, +.5f,+.5f,0, }; @Override public void run() { } private float[] arenaWalls = new float[] { 8.00f,2.00f,1f,2f,2f,1f,2.00f,8.00f,1f,8.00f,2.00f,1f,2.00f,8.00f,1f,8.00f,8.00f,1f, 2.00f,8.00f,1f,2f,2f,1f,0.00f,0.00f,0f,2.00f,8.00f,1f,0.00f,0.00f,0f,0.00f,10.00f,0f, 8.00f,8.00f,1f,2.00f,8.00f,1f,0.00f,10.00f,0f,8.00f,8.00f,1f,0.00f,10.00f,0f,10.00f,10.00f,0f, 2f,2f,1f,8.00f,2.00f,1f,10.00f,0.00f,0f,2f,2f,1f,10.00f,0.00f,0f,0.00f,0.00f,0f, 8.00f,2.00f,1f,8.00f,8.00f,1f,10.00f,10.00f,0f,8.00f,2.00f,1f,10.00f,10.00f,0f,10.00f,0.00f,0f, 10.00f,10.00f,0f,0.00f,10.00f,0f,0.00f,0.00f,0f,10.00f,10.00f,0f,0.00f,0.00f,0f,10.00f,0.00f,0f, 8.00f,6.00f,1f,8.00f,4.00f,1f,122f,4.00f,1f,8.00f,6.00f,1f,122f,4.00f,1f,122f,6.00f,1f, 8.00f,6.00f,1f,122f,6.00f,1f,120f,7.00f,0f,8.00f,6.00f,1f,120f,7.00f,0f,10.00f,7.00f,0f, 122f,4.00f,1f,8.00f,4.00f,1f,10.00f,3.00f,0f,122f,4.00f,1f,10.00f,3.00f,0f,120f,3.00f,0f, 480f,10.00f,0f,470f,10.00f,0f,470f,0.00f,0f,480f,10.00f,0f,470f,0.00f,0f,480f,0.00f,0f, 478f,2.00f,1f,478f,8.00f,1f,480f,10.00f,0f,478f,2.00f,1f,480f,10.00f,0f,480f,0.00f,0f, 472f,2f,1f,478f,2.00f,1f,480f,0.00f,0f,472f,2f,1f,480f,0.00f,0f,470f,0.00f,0f, 478f,8.00f,1f,472f,8.00f,1f,470f,10.00f,0f,478f,8.00f,1f,470f,10.00f,0f,480f,10.00f,0f, 472f,8.00f,1f,472f,2f,1f,470f,0.00f,0f,472f,8.00f,1f,470f,0.00f,0f,470f,10.00f,0f, 478f,2.00f,1f,472f,2f,1f,472f,8.00f,1f,478f,2.00f,1f,472f,8.00f,1f,478f,8.00f,1f, 478f,846f,1f,472f,846f,1f,472f,852f,1f,478f,846f,1f,472f,852f,1f,478f,852f,1f, 472f,852f,1f,472f,846f,1f,470f,844f,0f,472f,852f,1f,470f,844f,0f,470f,854f,0f, 478f,852f,1f,472f,852f,1f,470f,854f,0f,478f,852f,1f,470f,854f,0f,480f,854f,0f, 472f,846f,1f,478f,846f,1f,480f,844f,0f,472f,846f,1f,480f,844f,0f,470f,844f,0f, 478f,846f,1f,478f,852f,1f,480f,854f,0f,478f,846f,1f,480f,854f,0f,480f,844f,0f, 480f,854f,0f,470f,854f,0f,470f,844f,0f,480f,854f,0f,470f,844f,0f,480f,844f,0f, 10.00f,854f,0f,0.00f,854f,0f,0.00f,844f,0f,10.00f,854f,0f,0.00f,844f,0f,10.00f,844f,0f, 8.00f,846f,1f,8.00f,852f,1f,10.00f,854f,0f,8.00f,846f,1f,10.00f,854f,0f,10.00f,844f,0f, 2f,846f,1f,8.00f,846f,1f,10.00f,844f,0f,2f,846f,1f,10.00f,844f,0f,0.00f,844f,0f, 8.00f,852f,1f,2.00f,852f,1f,0.00f,854f,0f,8.00f,852f,1f,0.00f,854f,0f,10.00f,854f,0f, 2.00f,852f,1f,2f,846f,1f,0.00f,844f,0f,2.00f,852f,1f,0.00f,844f,0f,0.00f,854f,0f, 8.00f,846f,1f,2f,846f,1f,2.00f,852f,1f,8.00f,846f,1f,2.00f,852f,1f,8.00f,852f,1f, 6f,846f,1f,4f,846f,1f,4f,8f,1f,6f,846f,1f,4f,8f,1f,6f,8f,1f, 6f,846f,1f,6f,8f,1f,7f,10f,0f,6f,846f,1f,7f,10f,0f,7f,844f,0f, 4f,8f,1f,4f,846f,1f,3f,844f,0f,4f,8f,1f,3f,844f,0f,3f,10f,0f, 474f,8f,1f,474f,846f,1f,473f,844f,0f,474f,8f,1f,473f,844f,0f,473f,10f,0f, 476f,846f,1f,476f,8f,1f,477f,10f,0f,476f,846f,1f,477f,10f,0f,477f,844f,0f, 476f,846f,1f,474f,846f,1f,474f,8f,1f,476f,846f,1f,474f,8f,1f,476f,8f,1f, 130f,10.00f,0f,120f,10.00f,0f,120f,0.00f,0f,130f,10.00f,0f,120f,0.00f,0f,130f,0.00f,0f, 128f,2.00f,1f,128f,8.00f,1f,130f,10.00f,0f,128f,2.00f,1f,130f,10.00f,0f,130f,0.00f,0f, 122f,2f,1f,128f,2.00f,1f,130f,0.00f,0f,122f,2f,1f,130f,0.00f,0f,120f,0.00f,0f, 128f,8.00f,1f,122f,8.00f,1f,120f,10.00f,0f,128f,8.00f,1f,120f,10.00f,0f,130f,10.00f,0f, 122f,8.00f,1f,122f,2f,1f,120f,0.00f,0f,122f,8.00f,1f,120f,0.00f,0f,120f,10.00f,0f, 128f,2.00f,1f,122f,2f,1f,122f,8.00f,1f,128f,2.00f,1f,122f,8.00f,1f,128f,8.00f,1f, 352f,8.00f,1f,358f,8.00f,1f,358f,2.00f,1f,352f,8.00f,1f,358f,2.00f,1f,352f,2.00f,1f, 358f,2.00f,1f,358f,8.00f,1f,360f,10.00f,0f,358f,2.00f,1f,360f,10.00f,0f,360f,0.00f,0f, 352f,2.00f,1f,358f,2.00f,1f,360f,0.00f,0f,352f,2.00f,1f,360f,0.00f,0f,350f,0.00f,0f, 358f,8.00f,1f,352f,8.00f,1f,350f,10.00f,0f,358f,8.00f,1f,350f,10.00f,0f,360f,10.00f,0f, 352f,8.00f,1f,352f,2.00f,1f,350f,0.00f,0f,352f,8.00f,1f,350f,0.00f,0f,350f,10.00f,0f, 350f,0.00f,0f,360f,0.00f,0f,360f,10.00f,0f,350f,0.00f,0f,360f,10.00f,0f,350f,10.00f,0f, 358f,6.00f,1f,472f,6.00f,1f,470f,7.00f,0f,358f,6.00f,1f,470f,7.00f,0f,360f,7.00f,0f, 472f,4.00f,1f,358f,4.00f,1f,360f,3.00f,0f,472f,4.00f,1f,360f,3.00f,0f,470f,3.00f,0f, 472f,4.00f,1f,472f,6.00f,1f,358f,6.00f,1f,472f,4.00f,1f,358f,6.00f,1f,358f,4.00f,1f, 472f,848f,1f,472f,850f,1f,358f,850f,1f,472f,848f,1f,358f,850f,1f,358f,848f,1f, 472f,848f,1f,358f,848f,1f,360f,847f,0f,472f,848f,1f,360f,847f,0f,470f,847f,0f, 358f,850f,1f,472f,850f,1f,470f,851f,0f,358f,850f,1f,470f,851f,0f,360f,851f,0f, 350f,844f,0f,360f,844f,0f,360f,854f,0f,350f,844f,0f,360f,854f,0f,350f,854f,0f, 352f,852f,1f,352f,846f,1f,350f,844f,0f,352f,852f,1f,350f,844f,0f,350f,854f,0f, 358f,852f,1f,352f,852f,1f,350f,854f,0f,358f,852f,1f,350f,854f,0f,360f,854f,0f, 352f,846f,1f,358f,846f,1f,360f,844f,0f,352f,846f,1f,360f,844f,0f,350f,844f,0f, 358f,846f,1f,358f,852f,1f,360f,854f,0f,358f,846f,1f,360f,854f,0f,360f,844f,0f, 352f,852f,1f,358f,852f,1f,358f,846f,1f,352f,852f,1f,358f,846f,1f,352f,846f,1f, 128f,846f,1f,122f,846f,1f,122f,852f,1f,128f,846f,1f,122f,852f,1f,128f,852f,1f, 122f,852f,1f,122f,846f,1f,120f,844f,0f,122f,852f,1f,120f,844f,0f,120f,854f,0f, 128f,852f,1f,122f,852f,1f,120f,854f,0f,128f,852f,1f,120f,854f,0f,130f,854f,0f, 122f,846f,1f,128f,846f,1f,130f,844f,0f,122f,846f,1f,130f,844f,0f,120f,844f,0f, 128f,846f,1f,128f,852f,1f,130f,854f,0f,128f,846f,1f,130f,854f,0f,130f,844f,0f, 130f,854f,0f,120f,854f,0f,120f,844f,0f,130f,854f,0f,120f,844f,0f,130f,844f,0f, 122f,848f,1f,8f,848f,1f,10f,847f,0f,122f,848f,1f,10f,847f,0f,120f,847f,0f, 8f,850f,1f,122f,850f,1f,120f,851f,0f,8f,850f,1f,120f,851f,0f,10f,851f,0f, 8f,850f,1f,8f,848f,1f,122f,848f,1f,8f,850f,1f,122f,848f,1f,122f,850f,1f, 10f,847f,0f,120f,847f,0f,124.96f,829.63f,-0.50f,10f,847f,0f,124.96f,829.63f,-0.50f,19.51f,829.63f,-0.50f, 130f,844f,0f,130f,854f,0f,134.55f,836.34f,-0.50f,130f,844f,0f,134.55f,836.34f,-0.50f,134.55f,826.76f,-0.50f, 350f,844f,0f,350f,854f,0f,345.45f,836.34f,-0.50f,350f,844f,0f,345.45f,836.34f,-0.50f,345.45f,826.76f,-0.50f, 360f,847f,0f,470f,847f,0f,460.49f,829.63f,-0.50f,360f,847f,0f,460.49f,829.63f,-0.50f,355.04f,829.63f,-0.50f, 470f,7.00f,0f,360f,7.00f,0f,355.04f,24.37f,-0.50f,470f,7.00f,0f,355.04f,24.37f,-0.50f,460.49f,24.37f,-0.50f, 350f,10.00f,0f,350f,0.00f,0f,345.45f,17.66f,-0.50f,350f,10.00f,0f,345.45f,17.66f,-0.50f,345.45f,27.24f,-0.50f, 130f,10.00f,0f,130f,0.00f,0f,134.55f,17.66f,-0.50f,130f,10.00f,0f,134.55f,17.66f,-0.50f,134.55f,27.24f,-0.50f, 473f,844f,0f,473f,10f,0f,463.36f,27.24f,-0.50f,473f,844f,0f,463.36f,27.24f,-0.50f,463.36f,826.76f,-0.50f, 7f,10f,0f,7f,844f,0f,16.64f,826.76f,-0.50f,7f,10f,0f,16.64f,826.76f,-0.50f,16.64f,27.24f,-0.50f, 120f,7.00f,0f,10.00f,7.00f,0f,19.51f,24.37f,-0.50f,120f,7.00f,0f,19.51f,24.37f,-0.50f,124.96f,24.37f,-0.50f, 120f,7.00f,0f,130f,10.00f,0f,134.55f,27.24f,-0.50f,120f,7.00f,0f,134.55f,27.24f,-0.50f,124.96f,24.37f,-0.50f, 10.00f,7.00f,0f,7f,10f,0f,16.64f,27.24f,-0.50f,10.00f,7.00f,0f,16.64f,27.24f,-0.50f,19.51f,24.37f,-0.50f, 350f,10.00f,0f,360f,7.00f,0f,355.04f,24.37f,-0.50f,350f,10.00f,0f,355.04f,24.37f,-0.50f,345.45f,27.24f,-0.50f, 473f,10f,0f,470f,7.00f,0f,460.49f,24.37f,-0.50f,473f,10f,0f,460.49f,24.37f,-0.50f,463.36f,27.24f,-0.50f, 473f,844f,0f,470f,847f,0f,460.49f,829.63f,-0.50f,473f,844f,0f,460.49f,829.63f,-0.50f,463.36f,826.76f,-0.50f, 360f,847f,0f,350f,844f,0f,345.45f,826.76f,-0.50f,360f,847f,0f,345.45f,826.76f,-0.50f,355.04f,829.63f,-0.50f, 130f,844f,0f,120f,847f,0f,124.96f,829.63f,-0.50f,130f,844f,0f,124.96f,829.63f,-0.50f,134.55f,826.76f,-0.50f, 7f,844f,0f,10f,847f,0f,19.51f,829.63f,-0.50f,7f,844f,0f,19.51f,829.63f,-0.50f,16.64f,826.76f,-0.50f, 19.51f,829.63f,-0.50f,124.96f,829.63f,-0.50f,136.47f,789.37f,-2f,19.51f,829.63f,-0.50f,136.47f,789.37f,-2f,41.56f,789.37f,-2f, 134.55f,826.76f,-0.50f,134.55f,836.34f,-0.50f,145.09f,795.41f,-2f,134.55f,826.76f,-0.50f,145.09f,795.41f,-2f,145.09f,786.78f,-2f, 345.45f,826.76f,-0.50f,345.45f,836.34f,-0.50f,334.91f,795.41f,-2f,345.45f,826.76f,-0.50f,334.91f,795.41f,-2f,334.91f,786.78f,-2f, 355.04f,829.63f,-0.50f,460.49f,829.63f,-0.50f,438.44f,789.37f,-2f,355.04f,829.63f,-0.50f,438.44f,789.37f,-2f,343.53f,789.37f,-2f, 460.49f,24.37f,-0.50f,355.04f,24.37f,-0.50f,343.53f,64.63f,-2f,460.49f,24.37f,-0.50f,343.53f,64.63f,-2f,438.44f,64.63f,-2f, 345.45f,27.24f,-0.50f,345.45f,17.66f,-0.50f,334.91f,58.59f,-2f,345.45f,27.24f,-0.50f,334.91f,58.59f,-2f,334.91f,67.22f,-2f, 134.55f,27.24f,-0.50f,134.55f,17.66f,-0.50f,145.09f,58.59f,-2f,134.55f,27.24f,-0.50f,145.09f,58.59f,-2f,145.09f,67.22f,-2f, 463.36f,826.76f,-0.50f,463.36f,27.24f,-0.50f,441.03f,67.22f,-2f,463.36f,826.76f,-0.50f,441.03f,67.22f,-2f,441.03f,786.78f,-2f, 16.64f,27.24f,-0.50f,16.64f,826.76f,-0.50f,38.97f,786.78f,-2f,16.64f,27.24f,-0.50f,38.97f,786.78f,-2f,38.97f,67.22f,-2f, 124.96f,24.37f,-0.50f,19.51f,24.37f,-0.50f,41.56f,64.63f,-2f,124.96f,24.37f,-0.50f,41.56f,64.63f,-2f,136.47f,64.63f,-2f, 124.96f,24.37f,-0.50f,134.55f,27.24f,-0.50f,145.09f,67.22f,-2f,124.96f,24.37f,-0.50f,145.09f,67.22f,-2f,136.47f,64.63f,-2f, 19.51f,24.37f,-0.50f,16.64f,27.24f,-0.50f,38.97f,67.22f,-2f,19.51f,24.37f,-0.50f,38.97f,67.22f,-2f,41.56f,64.63f,-2f, 345.45f,27.24f,-0.50f,355.04f,24.37f,-0.50f,343.53f,64.63f,-2f,345.45f,27.24f,-0.50f,343.53f,64.63f,-2f,334.91f,67.22f,-2f, 463.36f,27.24f,-0.50f,460.49f,24.37f,-0.50f,438.44f,64.63f,-2f,463.36f,27.24f,-0.50f,438.44f,64.63f,-2f,441.03f,67.22f,-2f, 463.36f,826.76f,-0.50f,460.49f,829.63f,-0.50f,438.44f,789.37f,-2f,463.36f,826.76f,-0.50f,438.44f,789.37f,-2f,441.03f,786.78f,-2f, 355.04f,829.63f,-0.50f,345.45f,826.76f,-0.50f,334.91f,786.78f,-2f,355.04f,829.63f,-0.50f,334.91f,786.78f,-2f,343.53f,789.37f,-2f, 134.55f,826.76f,-0.50f,124.96f,829.63f,-0.50f,136.47f,789.37f,-2f,134.55f,826.76f,-0.50f,136.47f,789.37f,-2f,145.09f,786.78f,-2f, 16.64f,826.76f,-0.50f,19.51f,829.63f,-0.50f,41.56f,789.37f,-2f,16.64f,826.76f,-0.50f,41.56f,789.37f,-2f,38.97f,786.78f,-2f, }; private float[] backgroundData = new float[] { // # ,Scale, Speed, 300 , 1.05f, .001f, 150 , 1.07f, .002f, 075 , 1.10f, .003f, 040 , 1.12f, .006f, 20 , 1.15f, .012f, 10 , 1.25f, .025f, 05 , 1.50f, .050f, 3 , 2.00f, .100f, 2 , 3.00f, .200f, }; private float[] triangleCoords = new float[] { 0, -25, 0, -.75f, -1, 0, +.75f, -1, 0, 0, +2, 0, -.99f, -1, 0, .99f, -1, 0, }; private float[] triangleColors = new float[] { 1.0f, 1.0f, 1.0f, 0.05f, 1.0f, 1.0f, 1.0f, 0.5f, 1.0f, 1.0f, 1.0f, 0.5f, 1.0f, 1.0f, 1.0f, 1.0f, 1.0f, 1.0f, 1.0f, 0.5f, 1.0f, 1.0f, 1.0f, 0.5f, }; private float[] drawArray2; private FloatBuffer drawBuffer2; private float[] colorArray2; private static FloatBuffer colorBuffer; private static FloatBuffer triangleBuffer; private static FloatBuffer quadBuffer; private static FloatBuffer drawBuffer; private float[] backgroundVerts; private FloatBuffer backgroundVertsWrapped; private float[] backgroundColors; private Buffer backgroundColorsWraped; private FloatBuffer backgroundColorsWrapped; private FloatBuffer arenaWallsWrapped; private FloatBuffer arenaColorsWrapped; private FloatBuffer arena2VertsWrapped; private FloatBuffer arena2ColorsWrapped; private long wallHitStartTime; private int wallHitDrawTime; private FloatBuffer pixelVertsWrapped; private float[] wallHit; private FloatBuffer pixelColorsWrapped; //private float[] pitVerts; private Resources lResources; private FloatBuffer pitVertsWrapped; private FloatBuffer pitColorsWrapped; private boolean arena2; private long lastStartTime; private long startTime; private int state=1; private long introEndTime; protected long introTotalTime =8000; protected long introStartTime; private boolean initDone= false; private static int stateIntro = 0; private static int stateGame = 1; public GlRenderer(spacehockey nspacehockey) { lResources = nspacehockey.getResources(); nspacehockey.SetHandlerToGLRenderer(new Handler() { @Override public void handleMessage(Message m) { if (m.what ==0){ wallHit = m.getData().getFloatArray("wall hit"); wallHitStartTime =System.currentTimeMillis(); wallHitDrawTime = 1000; }else if (m.what ==1){ //state = stateIntro; introEndTime= System.currentTimeMillis()+introTotalTime ; introStartTime = System.currentTimeMillis(); } }}); } public void onSurfaceCreated(GL10 gl, EGLConfig config) { gl.glShadeModel(GL10.GL_SMOOTH); gl.glClearColor(.01f, .01f, .01f, .1f); gl.glClearDepthf(1.0f); gl.glEnable(GL10.GL_DEPTH_TEST); gl.glDepthFunc(GL10.GL_LEQUAL); gl.glHint(GL10.GL_PERSPECTIVE_CORRECTION_HINT, GL10.GL_NICEST); } private float SumOfStrideI(float[] data, int offset, int stride) { int sum= 0; for (int i=offset;i<data.length-1;i=i+stride){ sum = (int) (data[i]+sum); } return sum; } public void onDrawFrame(GL10 gl) { if (state== stateIntro){DrawIntro(gl);} if (state== stateGame){DrawGame(gl);} } private void DrawIntro(GL10 gl) { startTime = System.currentTimeMillis(); if (startTime< introEndTime){ float ptd = (float)(startTime- introStartTime)/(float)introTotalTime; float ptl = 1-ptd; gl.glClear(GL10.GL_COLOR_BUFFER_BIT);//dont move gl.glMatrixMode(GL10.GL_MODELVIEW); int setVertOff = 0; gl.glEnableClientState(GL10.GL_VERTEX_ARRAY); gl.glEnableClientState(GL10.GL_COLOR_ARRAY); gl.glColorPointer(4, GL10.GL_FLOAT, 0, backgroundColorsWrapped); for (int i = 0; i < backgroundData.length / 3; i = i + 1) { int setoff = i * 3; int setVertLen = (int) backgroundData[setoff]; yoffs[i] = (backgroundData[setoff + 2]*(90+(ptl*250))) + yoffs[i]; if (yoffs[i] > Height) {yoffs[i] = 0;} gl.glPushMatrix(); //gl.glTranslatef(0, -(Height/2), 0); //gl.glScalef(1f, 1f+(ptl*2), 1f); //gl.glTranslatef(0, +(Height/2), 0); gl.glTranslatef(0, yoffs[i], i+60); gl.glVertexPointer(3, GL10.GL_FLOAT, 0, backgroundVertsWrapped); gl.glDrawArrays(GL10.GL_TRIANGLES, (setVertOff * 2 * 3) - 0, (setVertLen * 2 * 3) - 1); gl.glTranslatef(0, -Height, 0); gl.glDrawArrays(GL10.GL_TRIANGLES, (setVertOff * 2 * 3) - 0, (setVertLen * 2 * 3) - 1); setVertOff = (int) (setVertOff + setVertLen); gl.glPopMatrix(); } gl.glDisableClientState(GL10.GL_VERTEX_ARRAY); gl.glDisableClientState(GL10.GL_COLOR_ARRAY); }else{state = stateGame;} } private void DrawGame(GL10 gl) { lastStartTime = startTime; startTime = System.currentTimeMillis(); long moveTime = startTime-lastStartTime; gl.glClear(GL10.GL_COLOR_BUFFER_BIT);//dont move gl.glMatrixMode(GL10.GL_MODELVIEW); int setVertOff = 0; gl.glEnableClientState(GL10.GL_VERTEX_ARRAY); gl.glEnableClientState(GL10.GL_COLOR_ARRAY); gl.glColorPointer(4, GL10.GL_FLOAT, 0, backgroundColorsWrapped); for (int i = 0; i < backgroundData.length / 3; i = i + 1) { int setoff = i * 3; int setVertLen = (int) backgroundData[setoff]; yoffs[i] = (backgroundData[setoff + 2]*moveTime) + yoffs[i]; if (yoffs[i] > Height) {yoffs[i] = 0;} gl.glPushMatrix(); gl.glTranslatef(0, yoffs[i], i+60); gl.glVertexPointer(3, GL10.GL_FLOAT, 0, backgroundVertsWrapped); gl.glDrawArrays(GL10.GL_TRIANGLES, (setVertOff * 6) - 0, (setVertLen *6) - 1); gl.glTranslatef(0, -Height, 0); gl.glDrawArrays(GL10.GL_TRIANGLES, (setVertOff * 6) - 0, (setVertLen *6) - 1); setVertOff = (int) (setVertOff + setVertLen); gl.glPopMatrix(); } //arena frame gl.glPushMatrix(); gl.glVertexPointer(3, GL10.GL_FLOAT, 0, arenaWallsWrapped); gl.glColorPointer(4, GL10.GL_FLOAT, 0, arenaColorsWrapped); gl.glColor4f(.1f, .5f, 1f, 1f); gl.glTranslatef(0, 0, 50); gl.glDrawArrays(GL10.GL_TRIANGLES, 0, (int)(arenaWalls.length / 3)); gl.glPopMatrix(); //arena2 frame if (arena2 == true){ gl.glLoadIdentity(); gl.glVertexPointer(3, GL10.GL_FLOAT, 0, pitVertsWrapped); gl.glColorPointer(4, GL10.GL_FLOAT, 0, pitColorsWrapped); gl.glTranslatef(0, -Height, 40); gl.glDrawArrays(GL10.GL_TRIANGLES, 0, (int)(pitVertsWrapped.capacity() / 3)); } if (wallHitStartTime != 0) { float timeRemaining = (wallHitStartTime + wallHitDrawTime)-System.currentTimeMillis(); if (timeRemaining>0) { gl.glPushMatrix(); float percentDone = 1-(timeRemaining/wallHitDrawTime); gl.glLoadIdentity(); gl.glVertexPointer(3, GL10.GL_FLOAT, 0, pixelVertsWrapped); gl.glColorPointer(4, GL10.GL_FLOAT, 0, pixelColorsWrapped); gl.glTranslatef(wallHit[0], wallHit[1], 0); gl.glScalef(8, Height*percentDone, 0); gl.glDrawArrays(GL10.GL_TRIANGLES, 0, 12); gl.glPopMatrix(); } else { wallHitStartTime = 0; } } gl.glDisableClientState(GL10.GL_VERTEX_ARRAY); gl.glDisableClientState(GL10.GL_COLOR_ARRAY); } public void init(GL10 gl) { if (arena2 == true) { AssetManager assetManager = lResources.getAssets(); try { // byte[] ba = {111,111}; DataInputStream Dis = new DataInputStream(assetManager .open("arena2.ogl")); pitVertsWrapped = LoadFloatArray.FromDataInputStream(Dis); pitColorsWrapped = MakeFakeLighting(pitVertsWrapped.array(), .25f, .50f, 1f, 200, .5f); } catch (IOException e) { // TODO Auto-generated catch block e.printStackTrace(); } } if ((Height != 854) || (Width != 480)) { arenaWalls = ScaleFloats(arenaWalls, Width / 480f, Height / 854f); } arenaWallsWrapped = FloatBuffer.wrap(arenaWalls); arenaColorsWrapped = MakeFakeLighting(arenaWalls, .03f, .16f, .33f, .33f, 3); pixelVertsWrapped = FloatBuffer.wrap(pixelVerts); pixelColorsWrapped = MakeFakeLighting(pixelVerts, .03f, .16f, .33f, .10f, 20); initDone=true; } public void onSurfaceChanged(GL10 gl, int nwidth, int nheight) { Width= nwidth; Height = nheight; // avoid division by zero if (Height == 0) Height = 1; // draw on the entire screen gl.glViewport(0, 0, Width, Height); // setup projection matrix gl.glMatrixMode(GL10.GL_PROJECTION); gl.glLoadIdentity(); gl.glOrthof(0, Width, Height, 0, 100, -100); // gl.glOrthof(-nwidth*2, nwidth*2, nheight*2,-nheight*2, 100, -100); // GLU.gluPerspective(gl, 180.0f, (float)nwidth / (float)nheight, // 1000.0f, -1000.0f); gl.glEnable(GL10.GL_BLEND); gl.glBlendFunc(GL10.GL_SRC_ALPHA, GL10.GL_ONE_MINUS_SRC_ALPHA); System.gc(); if (initDone == false){ SetupStars(); init(gl); } } public void SetupStars(){ backgroundVerts = new float[(int) SumOfStrideI(backgroundData,0,3)*triangleCoords.length]; backgroundColors = new float[(int) SumOfStrideI(backgroundData,0,3)*triangleColors.length]; int iii=0; int vc=0; float ascale=1; for (int i=0;i<backgroundColors.length-1;i=i+1){ if (iii==0){ascale = (float) Math.random();} if (vc==3){ backgroundColors[i]= (float) (triangleColors[iii]*(ascale)); }else if(vc==2){ backgroundColors[i]= (float) (triangleColors[iii]-(Math.random()*.2)); }else{ backgroundColors[i]= (float) (triangleColors[iii]-(Math.random()*.3)); } iii=iii+1;if (iii> triangleColors.length-1){iii=0;} vc=vc+1; if (vc>3){vc=0;} } int ii=0; int i =0; int set =0; while(ii<backgroundVerts.length-1){ float scale = (float) backgroundData[(set*3)+1]; int length= (int) backgroundData[(set*3)]; for (i=0;i<length;i=i+1){ if (set ==0){ AddVertsToArray(ScaleFloats(triangleCoords, scale,scale*.25f), backgroundVerts, (float)(Math.random()*Width),(float) (Math.random()*Height), ii); }else{ AddVertsToArray(ScaleFloats(triangleCoords, scale), backgroundVerts, (float)(Math.random()*Width),(float) (Math.random()*Height), ii);} ii=ii+triangleCoords.length; } set=set+1; } backgroundVertsWrapped = FloatBuffer.wrap(backgroundVerts); backgroundColorsWrapped = FloatBuffer.wrap(backgroundColors); } public void AddVertsToArray(float[] sva,float[]dva,float ox,float oy,int start){ //x for (int i=0;i<sva.length;i=i+3){ if((start+i)<dva.length){dva[start+i]= sva[i]+ox;} } //y for (int i=1;i<sva.length;i=i+3){ if((start+i)<dva.length){dva[start+i]= sva[i]+oy;} } //z for (int i=2;i<sva.length;i=i+3){ if((start+i)<dva.length){dva[start+i]= sva[i];} } } public FloatBuffer MakeFakeLighting(float[] sa,float r, float g,float b,float a,float multby){ float[] da = new float[((sa.length/3)*4)]; int vertex=0; for (int i=0;i<sa.length;i=i+3){ if (sa[i+2]>=1){ da[(vertex*4)+0]= r*multby*sa[i+2]; da[(vertex*4)+1]= g*multby*sa[i+2]; da[(vertex*4)+2]= b*multby*sa[i+2]; da[(vertex*4)+3]= a*multby*sa[i+2]; }else if (sa[i+2]<=-1){ float divisor = (multby*(-sa[i+2])); da[(vertex*4)+0]= r / divisor; da[(vertex*4)+1]= g / divisor; da[(vertex*4)+2]= b / divisor; da[(vertex*4)+3]= a / divisor; }else{ da[(vertex*4)+0]= r; da[(vertex*4)+1]= g; da[(vertex*4)+2]= b; da[(vertex*4)+3]= a; } vertex = vertex+1; } return FloatBuffer.wrap(da); } public float[] ScaleFloats(float[] va,float s){ float[] reta= new float[va.length]; for (int i=0;i<va.length;i=i+1){ reta[i]=va[i]*s; } return reta; } public float[] ScaleFloats(float[] va,float sx,float sy){ float[] reta= new float[va.length]; int cnt = 0; for (int i=0;i<va.length;i=i+1){ if (cnt==0){reta[i]=va[i]*sx;} else if (cnt==1){reta[i]=va[i]*sy;} else if (cnt==2){reta[i]=va[i];} cnt = cnt +1;if (cnt>2){cnt=0;} } return reta; } }

    Read the article

  • Help with chat server

    - by mithun1538
    I am designing a chat server in java. The communication is Http based and not socket based. In the client side I have an applet. In the server side I have a servlet. Applet: I create a new thread to listen for incoming messages(GET method). The main thread is used to send messages(POST messages). The partial code is : public void start() { System.out.println("Creating new thread"); Thread thread = new Thread(this); thread.start(); } private String getNewMessage() { System.out.println("Inside getNewMessage"); String msg = null; try { while(msg == null) { System.out.println("Trying to listen to servlet"); URL servlet = new URL(getCodeBase(), "NewServlet?mode=msg"); URLConnection con = servlet.openConnection(); con.setUseCaches(false); DataInputStream din = new DataInputStream(new BufferedInputStream(con.getInputStream())); msg = din.readUTF(); System.out.println("message read :" + msg); } } catch (Exception e) { e.printStackTrace(); } return msg + "\n"; } public void run() { System.out.println("Inside new thread"); while(true) { System.out.println("inside first while"); String newMsg = getNewMessage(); chatOutput.append(newMsg); System.out.println("Appended!!"); } } private void jButton1ActionPerformed(java.awt.event.ActionEvent evt) { String message = chatInput.getText(); chatInput.setText(""); chatOutput.append(message + "\n"); try { System.out.println("Trying to send msg :" + message); URL url = new URL(getCodeBase(), "NewServlet"); URLConnection servletConnection = url.openConnection(); servletConnection.setDoInput(true); servletConnection.setDoOutput(true); servletConnection.setUseCaches(false); servletConnection.setRequestProperty("Content-Type", "application/octet-stream"); ObjectOutputStream out = new ObjectOutputStream(servletConnection.getOutputStream()); out.writeObject(message); out.flush(); out.close(); System.out.println("Message sent!"); } catch (Exception e) { e.printStackTrace(); } } This next code is from the servlet side. it uses the Observable interface to identify and send messages to clients. public class NewServlet extends HttpServlet { // getNextMessage() returns the next new message. // It blocks until there is one. public String getNextMessage() { // Create a message sink to wait for a new message from the // message source. System.out.println("inside getNextMessage"); return new MessageSink().getNextMessage(source);} @Override protected void doGet(HttpServletRequest request, HttpServletResponse response) throws ServletException, IOException { System.out.println("Inside Doget"); response.setContentType("text/plain"); PrintWriter out = response.getWriter(); out.println(getNextMessage()); } // broadcastMessage() informs all currently listening clients that there // is a new message. Causes all calls to getNextMessage() to unblock. public void broadcastMessage(String message) { // Send the message to all the HTTP-connected clients by giving the // message to the message source source.sendMessage(message); } @Override protected void doPost(HttpServletRequest request, HttpServletResponse response) throws ServletException, IOException { System.out.println("Inside DoPost"); try { ObjectInputStream din= new ObjectInputStream(request.getInputStream()); String message = (String)din.readObject(); System.out.println("received msg"); if (message != null) broadcastMessage(message); System.out.println("Called broadcast"); // Set the status code to indicate there will be no response response.setStatus(response.SC_NO_CONTENT); } catch (Exception e) { e.printStackTrace(); } } /** * Returns a short description of the servlet. * @return a String containing servlet description */ @Override public String getServletInfo() { return "Short description"; } MessageSource source = new MessageSource();} class MessageSource extends Observable { public void sendMessage(String message) { System.out.println("inside sendMsg"); setChanged(); notifyObservers(message); } } class MessageSink implements Observer { String message = null; // set by update() and read by getNextMessage() // Called by the message source when it gets a new message synchronized public void update(Observable o, Object arg) { // Get the new message message = (String)arg; // Wake up our waiting thread notify(); } // Gets the next message sent out from the message source synchronized public String getNextMessage(MessageSource source) { // Tell source we want to be told about new messages source.addObserver(this); System.out.println("AddedObserver"); // Wait until our update() method receives a message while (message == null) { try { wait(); } catch (Exception ignored) { } } // Tell source to stop telling us about new messages source.deleteObserver(this); // Now return the message we received // But first set the message instance variable to null // so update() and getNextMessage() can be called again. String messageCopy = message; message = null; System.out.println("Returning msg"); return messageCopy; } } As you can see I have included System.out.println("Some message"); in some places. this was just for debugging purposes. In java console, i get the following output: Creating new thread Inside new thread. inside first while. Inside getNewMessage. Trying to listen to servlet. In the servlet side, i get the following output in the tomcat logs: Inside Doget. inside getNextMessage. AddedObserver. After i type a message in the applet, and send it, I get the foll output in java console: Trying to send msg :you deR?? Message sent! But in servlet side, I dont get anything in the logs. I used the O'Reily Java Servlet Programming as reference(The observer interface comes from there). But I am not getting any chat communication between two clients. As can be understood from the logs, the POST method is not called. Any reason for this?

    Read the article

  • Problem while running the j2me application

    - by Paru
    I am not able to view any content in the emulator while running the application. The Build is not failed and i am able run the application successfully. While i am closing the emulator i am getting an error. i can provide both code and log here. import javax.microedition.lcdui.; import javax.microedition.midlet.; import java.io.; import java.lang.; import javax.microedition.io.; import javax.microedition.rms.; public class Login extends MIDlet implements CommandListener { TextField ItemName=null; TextField ItemNo=null; TextField UserName=null; TextField Password=null; Form authForm,mainscreen; TextBox t = null; StringBuffer b = new StringBuffer(); private Display myDisplay = null; private Command okCommand = new Command("Login", Command.OK, 1); private Command exitCommand = new Command("Exit", Command.EXIT, 2); private Command sendCommand = new Command("Send", Command.OK, 1); private Command backCommand = new Command("Back", Command.BACK, 2); private Alert alert = null; public Login() { ItemName=new TextField("Item Name","",10,TextField.ANY); ItemNo=new TextField("Item No","",10,TextField.ANY); myDisplay = Display.getDisplay(this); UserName=new TextField("Your Name","",10,TextField.ANY); Password=new TextField("Password","",10,TextField.PASSWORD); authForm=new Form("Identification"); mainscreen=new Form("Logging IN"); mainscreen.addCommand(sendCommand); mainscreen.addCommand(backCommand); authForm.append(UserName); authForm.append(Password); authForm.addCommand(okCommand); authForm.addCommand(exitCommand); authForm.setCommandListener(this); myDisplay.setCurrent(authForm); } public void startApp() throws MIDletStateChangeException { } public void pauseApp() { } protected void destroyApp(boolean unconditional) throws MIDletStateChangeException { } public void commandAction(Command c, Displayable d) { if ((c == okCommand) && (d == authForm)) { if (UserName.getString().equals("") || Password.getString().equals("")){ alert = new Alert("Error", "You should enter Username and Password", null, AlertType.ERROR); alert.setTimeout(Alert.FOREVER); myDisplay.setCurrent(alert); } else{ //myDisplay.setCurrent(mainscreen); login(UserName.getString(),Password.getString()); } } if ((c == backCommand) && (d == mainscreen)) { myDisplay.setCurrent(authForm); } if ((c == exitCommand) && (d == authForm)) { notifyDestroyed(); } if ((c == sendCommand) && (d == mainscreen)) { if(ItemName.getString().equals("") || ItemNo.getString().equals("")){ } else{ sendItem(ItemName.getString(),ItemNo.getString()); } } } public void login(String UserName,String PassWord) { HttpConnection connection=null; DataInputStream in=null; String url="http://olario.net/submitpost/submitpost/login.php"; OutputStream out=null; try { connection=(HttpConnection)Connector.open(url); connection.setRequestMethod(HttpConnection.POST); connection.setRequestProperty("IF-Modified-Since", "2 Oct 2002 15:10:15 GMT"); connection.setRequestProperty("User-Agent","Profile/MIDP-1.0 Configuration/CLDC-1.0"); connection.setRequestProperty("Content-Language", "en-CA"); connection.setRequestProperty("Content-Length",""+ (UserName.length()+PassWord.length())); connection.setRequestProperty("username",UserName); connection.setRequestProperty("password",PassWord); out = connection.openDataOutputStream(); out.flush(); in = connection.openDataInputStream(); int ch; while((ch = in.read()) != -1) { b.append((char) ch); //System.out.println((char)ch); } //t = new TextBox("Reply",b.toString(),1024,0); //mainscreen.append(b.toString()); String auth=b.toString(); if(in!=null) in.close(); if(out!=null) out.close(); if(connection!=null) connection.close(); if(auth.equals("ok")){ mainscreen.setCommandListener(this); myDisplay.setCurrent(mainscreen); } } catch(IOException x){ } } public void sendItem(String itemname,String itemno){ HttpConnection connection=null; DataInputStream in=null; String url="http://www.olario.net/submitpost/submitpost/submitPost.php"; OutputStream out=null; try { connection=(HttpConnection)Connector.open(url); connection.setRequestMethod(HttpConnection.POST); connection.setRequestProperty("IF-Modified-Since", "2 Oct 2002 15:10:15 GMT"); connection.setRequestProperty("User-Agent","Profile/MIDP-1.0 Configuration/CLDC-1.0"); connection.setRequestProperty("Content-Language", "en-CA"); connection.setRequestProperty("Content-Length",""+ (itemname.length()+itemno.length())); connection.setRequestProperty("itemCode",itemname); connection.setRequestProperty("qty",itemno); out = connection.openDataOutputStream(); out.flush(); in = connection.openDataInputStream(); int ch; while((ch = in.read()) != -1) { b.append((char) ch); //System.out.println((char)ch); } //t = new TextBox("Reply",b.toString(),1024,0); //mainscreen.append(b.toString()); String send=b.toString(); if(in!=null) in.close(); if(out!=null) out.close(); if(connection!=null) connection.close(); if(send.equals("added")){ alert = new Alert("Error", "Send Successfully", null, AlertType.INFO); alert.setTimeout(Alert.FOREVER); myDisplay.setCurrent(alert); } } catch(IOException x){ } } } and the log is pre-init: pre-load-properties: exists.config.active: exists.netbeans.user: exists.user.properties.file: load-properties: exists.platform.active: exists.platform.configuration: exists.platform.profile: basic-init: cldc-pre-init: cldc-init: cdc-init: ricoh-pre-init: ricoh-init: semc-pre-init: semc-init: savaje-pre-init: savaje-init: sjmc-pre-init: sjmc-init: ojec-pre-init: ojec-init: cdc-hi-pre-init: cdc-hi-init: nokiaS80-pre-init: nokiaS80-init: nsicom-pre-init: nsicom-init: post-init: init: conditional-clean-init: conditional-clean: deps-jar: pre-preprocess: do-preprocess: Pre-processing 0 file(s) into /home/sreekumar/NetBeansProjects/Login/build/preprocessed directory. post-preprocess: preprocess: pre-compile: extract-libs: do-compile: post-compile: compile: pre-obfuscate: proguard-init: skip-obfuscation: proguard: post-obfuscate: obfuscate: lwuit-build: pre-preverify: do-preverify: post-preverify: preverify: pre-jar: set-password-init: set-keystore-password: set-alias-password: set-password: create-jad: add-configuration: add-profile: do-extra-libs: nokiaS80-prepare-j9: nokiaS80-prepare-manifest: nokiaS80-prepare-manifest-no-icon: nokiaS80-create-manifest: jad-jsr211-properties.check: jad-jsr211-properties: semc-build-j9: do-jar: nsicom-create-manifest: do-jar-no-manifest: update-jad: Updating application descriptor: /home/sreekumar/NetBeansProjects/Login/dist/Login.jad Generated "/home/sreekumar/NetBeansProjects/Login/dist/Login.jar" is 3501 bytes. sign-jar: ricoh-init-dalp: ricoh-add-app-icon: ricoh-build-dalp-with-icon: ricoh-build-dalp-without-icon: ricoh-build-dalp: savaje-prepare-icon: savaje-build-jnlp: post-jar: jar: pre-run: netmon.check: open-netmon: cldc-run: Copying 1 file to /home/sreekumar/NetBeansProjects/Login/dist/nbrun4244989945642509378 Copying 1 file to /home/sreekumar/NetBeansProjects/Login/dist/nbrun4244989945642509378 Jad URL for OTA execution: http://localhost:8082/servlet/org.netbeans.modules.mobility.project.jam.JAMServlet//home/sreekumar/NetBeansProjects/Login/dist//Login.jad Starting emulator in execution mode Running with storage root /home/sreekumar/j2mewtk/2.5.2/appdb/temp.DefaultColorPhone1 /home/sreekumar/NetBeansProjects/Login/nbproject/build-impl.xml:915: Execution failed with error code 143. BUILD FAILED (total time: 35 seconds)

    Read the article

  • Traditional IO vs memory-mapped

    - by Senne
    I'm trying to illustrate the difference in performance between traditional IO and memory mapped files in java to students. I found an example somewhere on internet but not everything is clear to me, I don't even think all steps are nececery. I read a lot about it here and there but I'm not convinced about a correct implementation of neither of them. The code I try to understand is: public class FileCopy{ public static void main(String args[]){ if (args.length < 1){ System.out.println(" Wrong usage!"); System.out.println(" Correct usage is : java FileCopy <large file with full path>"); System.exit(0); } String inFileName = args[0]; File inFile = new File(inFileName); if (inFile.exists() != true){ System.out.println(inFileName + " does not exist!"); System.exit(0); } try{ new FileCopy().memoryMappedCopy(inFileName, inFileName+".new" ); new FileCopy().customBufferedCopy(inFileName, inFileName+".new1"); }catch(FileNotFoundException fne){ fne.printStackTrace(); }catch(IOException ioe){ ioe.printStackTrace(); }catch (Exception e){ e.printStackTrace(); } } public void memoryMappedCopy(String fromFile, String toFile ) throws Exception{ long timeIn = new Date().getTime(); // read input file RandomAccessFile rafIn = new RandomAccessFile(fromFile, "rw"); FileChannel fcIn = rafIn.getChannel(); ByteBuffer byteBuffIn = fcIn.map(FileChannel.MapMode.READ_WRITE, 0,(int) fcIn.size()); fcIn.read(byteBuffIn); byteBuffIn.flip(); RandomAccessFile rafOut = new RandomAccessFile(toFile, "rw"); FileChannel fcOut = rafOut.getChannel(); ByteBuffer writeMap = fcOut.map(FileChannel.MapMode.READ_WRITE,0,(int) fcIn.size()); writeMap.put(byteBuffIn); long timeOut = new Date().getTime(); System.out.println("Memory mapped copy Time for a file of size :" + (int) fcIn.size() +" is "+(timeOut-timeIn)); fcOut.close(); fcIn.close(); } static final int CHUNK_SIZE = 100000; static final char[] inChars = new char[CHUNK_SIZE]; public static void customBufferedCopy(String fromFile, String toFile) throws IOException{ long timeIn = new Date().getTime(); Reader in = new FileReader(fromFile); Writer out = new FileWriter(toFile); while (true) { synchronized (inChars) { int amountRead = in.read(inChars); if (amountRead == -1) { break; } out.write(inChars, 0, amountRead); } } long timeOut = new Date().getTime(); System.out.println("Custom buffered copy Time for a file of size :" + (int) new File(fromFile).length() +" is "+(timeOut-timeIn)); in.close(); out.close(); } } When exactly is it nececary to use RandomAccessFile? Here it is used to read and write in the memoryMappedCopy, is it actually nececary just to copy a file at all? Or is it a part of memorry mapping? In customBufferedCopy, why is synchronized used here? I also found a different example that -should- test the performance between the 2: public class MappedIO { private static int numOfInts = 4000000; private static int numOfUbuffInts = 200000; private abstract static class Tester { private String name; public Tester(String name) { this.name = name; } public long runTest() { System.out.print(name + ": "); try { long startTime = System.currentTimeMillis(); test(); long endTime = System.currentTimeMillis(); return (endTime - startTime); } catch (IOException e) { throw new RuntimeException(e); } } public abstract void test() throws IOException; } private static Tester[] tests = { new Tester("Stream Write") { public void test() throws IOException { DataOutputStream dos = new DataOutputStream( new BufferedOutputStream( new FileOutputStream(new File("temp.tmp")))); for(int i = 0; i < numOfInts; i++) dos.writeInt(i); dos.close(); } }, new Tester("Mapped Write") { public void test() throws IOException { FileChannel fc = new RandomAccessFile("temp.tmp", "rw") .getChannel(); IntBuffer ib = fc.map( FileChannel.MapMode.READ_WRITE, 0, fc.size()) .asIntBuffer(); for(int i = 0; i < numOfInts; i++) ib.put(i); fc.close(); } }, new Tester("Stream Read") { public void test() throws IOException { DataInputStream dis = new DataInputStream( new BufferedInputStream( new FileInputStream("temp.tmp"))); for(int i = 0; i < numOfInts; i++) dis.readInt(); dis.close(); } }, new Tester("Mapped Read") { public void test() throws IOException { FileChannel fc = new FileInputStream( new File("temp.tmp")).getChannel(); IntBuffer ib = fc.map( FileChannel.MapMode.READ_ONLY, 0, fc.size()) .asIntBuffer(); while(ib.hasRemaining()) ib.get(); fc.close(); } }, new Tester("Stream Read/Write") { public void test() throws IOException { RandomAccessFile raf = new RandomAccessFile( new File("temp.tmp"), "rw"); raf.writeInt(1); for(int i = 0; i < numOfUbuffInts; i++) { raf.seek(raf.length() - 4); raf.writeInt(raf.readInt()); } raf.close(); } }, new Tester("Mapped Read/Write") { public void test() throws IOException { FileChannel fc = new RandomAccessFile( new File("temp.tmp"), "rw").getChannel(); IntBuffer ib = fc.map( FileChannel.MapMode.READ_WRITE, 0, fc.size()) .asIntBuffer(); ib.put(0); for(int i = 1; i < numOfUbuffInts; i++) ib.put(ib.get(i - 1)); fc.close(); } } }; public static void main(String[] args) { for(int i = 0; i < tests.length; i++) System.out.println(tests[i].runTest()); } } I more or less see whats going on, my output looks like this: Stream Write: 653 Mapped Write: 51 Stream Read: 651 Mapped Read: 40 Stream Read/Write: 14481 Mapped Read/Write: 6 What is makeing the Stream Read/Write so unbelievably long? And as a read/write test, to me it looks a bit pointless to read the same integer over and over (if I understand well what's going on in the Stream Read/Write) Wouldn't it be better to read int's from the previously written file and just read and write ints on the same place? Is there a better way to illustrate it? I've been breaking my head about a lot of these things for a while and I just can't get the whole picture..

    Read the article

  • sending sms to mobile from pc using java [closed]

    - by sjohnfernandas
    hi i need to send sms from pc to mobile phone can u people guide me to achieve? i used the following code to send sms to a mobile from pc but i did not get any output and also not getting any error so guide me and point out the mistakes what i have done. package mobilesms; import java.io.; import java.util.; import javax.comm.*; import java.io.IOException; import java.util.Properties; import java.io.InputStream; import java.io.OutputStream; import java.io.DataInputStream; import java.io.FileInputStream; import java.io.DataOutputStream; import java.io.FileOutputStream; public class ReadSimple implements Runnable, SerialPortEventListener { static CommPortIdentifier portId; static Enumeration portList; OutputStream outputstream; InputStream inputStream; SerialPort serialPort; Thread readThread; public static void main(String[] args) { portList = CommPortIdentifier.getPortIdentifiers(); while (portList.hasMoreElements()) { portId = (CommPortIdentifier) portList.nextElement(); if (portId.getPortType() == CommPortIdentifier.PORT_SERIAL) { if (portId.getName().equals("COM1")) { System.out.println("Found port:COM1 "); ReadSimple reader = new ReadSimple(); } } } } public ReadSimple() { try { serialPort = (SerialPort) portId.open("ReadSimpleApp",500); } catch (PortInUseException e) { System.out.println(e); } try { inputStream = serialPort.getInputStream(); OutputStream out=serialPort.getOutputStream(); String line=""; line="AT"+"r\n"; out.write(line.trim().getBytes()); line=""; line="AT+CMGS=7639808583"+"\r\n"; out.write(line.trim().getBytes()); System.out.print(line); line="helloworld"; //line=”ATD 996544325;”+”\r\n”; out.write(line.trim().getBytes()); } catch (IOException e) { serialPort.close(); System.out.println(e); } // catch(InterruptedException E){E.printStackTrace();} try { serialPort.addEventListener(this); } catch (TooManyListenersException e) {System.out.println(e);} serialPort.notifyondataavailable(true); try { serialPort.setSerialPortParams(9600, SerialPort.DATABITS_8, SerialPort.STOPBITS_1, SerialPort.PARITY_NONE); } catch (UnsupportedCommOperationException e) {System.out.println(e);} readThread = new Thread(this); readThread.start(); } public void run() { try { Thread.sleep(200); } catch (InterruptedException e) {System.out.println(e);} } public void serialEvent(SerialPortEvent event) { switch(event.getEventType()) { case SerialPortEvent.BI: case SerialPortEvent.OE: case SerialPortEvent.FE: case SerialPortEvent.PE: case SerialPortEvent.CD: case SerialPortEvent.CTS: case SerialPortEvent.DSR: case SerialPortEvent.RI: case SerialPortEvent.OUTPUT_BUFFER_EMPTY: break; case SerialPortEvent.DATA_AVAILABLE: byte[] readBuffer = new byte[10]; try { while (inputStream.available() 0) { int numBytes = inputStream.read(readBuffer); } System.out.println(new String(readBuffer)); } catch (IOException e) {System.out.println(e);} break; } } }

    Read the article

< Previous Page | 1 2 3 4  | Next Page >