Search Results

Search found 79415 results on 3177 pages for 'log file'.

Page 30/3177 | < Previous Page | 26 27 28 29 30 31 32 33 34 35 36 37  | Next Page >

  • Reliable file copy (move) process - mostly Unix/Linux

    - by mfinni
    Short story : We have a need for a rock-solid reliable file mover process. We have source directories that are often being written to that we need to move files from. The files come in pairs - a big binary, and a small XML index. We get a CTL file that defines these file bundles. There is a process that operates on the files once they are in the destination directory; that gets rid of them when it's done. Would rsync do the best job, or do we need to get more complex? Long story as follows : We have multiple sources to pull from : one set of directories are on a Windows machine (that does have Cygwin and an SSH daemon), and a whole pile of directories are on a set of SFTP servers (Most of these are also Windows.) Our destinations are a list of directories on AIX servers. We used to use a very reliable Perl script on the Windows/Cygwin machine when it was our only source. However, we're working on getting rid of that machine, and there are other sources now, the SFTP servers, that we cannot presently run our own scripts on. For security reasons, we can't run the copy jobs on our AIX servers - they have no access to the source servers. We currently have a homegrown Java program on a Linux machine that uses SFTP to pull from the various new SFTP source directories, copies to a local tmp directory, verifies that everything is present, then copies that to the AIX machines, and then deletes the files from the source. However, we're finding any number of bugs or poorly-handled error checking. None of us are Java experts, so fixing/improving this may be difficult. Concerns for us are: With a remote source (SFTP), will rsync leave alone any file still being written? Some of these files are large. From reading the docs, it seems like rysnc will be very good about not removing the source until the destination is reliably written. Does anyone have experience confirming or disproving this? Additional info We will be concerned about the ingestion process that operates on the files once they are in the destination directory. We don't want it operating on files while we are in the process of copying them; it waits until the small XML index file is present. Our current copy job are supposed to copy the XML file last. Sometimes the network has problems, sometimes the SFTP source servers crap out on us. Sometimes we typo the config files and a destination directory doesn't exist. We never want to lose a file due to this sort of error. We need good logs If you were presented with this, would you just script up some rsync? Or would you build or buy a tool, and if so, what would it be (or what technologies would it use?) I (and others on my team) are decent with Perl.

    Read the article

  • Transaction log is full and does not free up space

    - by titanium
    Hi, I have a database in SQL Server 2005 whose transaction log becomes full. It is using snapshot replication. I noticed the transaction log is not freeing up space. So I created an additional transaction log. Three days has passed and this first transaction log is still full. I performed a full database backup and transaction backup. Then I tried to shrink the transaction log but the shrink failed. Can anyone advise why shrinking transaction log is failing? ANy other recommendation on how to resolve the problem?

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • Copy mdf file and use it in run time

    - by Anibas
    After I copy mdf file (and his log file) I tries to Insert data. I receive the following message: "An attempt to attach an auto-named database for file [fileName].mdf failed. A database with the same name exists, or specified file cannot be opened, or it is located on UNC share. When I copied the file manual everything worked normally. Is it correct the order File.Copy leaves the file engaged?

    Read the article

  • Designing a database file format

    - by RoliSoft
    I would like to design my own database engine for educational purposes, for the time being. Designing a binary file format is not hard nor the question, I've done it in the past, but while designing a database file format, I have come across a very important question: How to handle the deletion of an item? So far, I've thought of the following two options: Each item will have a "deleted" bit which is set to 1 upon deletion. Pro: relatively fast. Con: potentially sensitive data will remain in the file. 0x00 out the whole item upon deletion. Pro: potentially sensitive data will be removed from the file. Con: relatively slow. Recreating the whole database. Pro: no empty blocks which makes the follow-up question void. Con: it's a really good idea to overwrite the whole 4 GB database file because a user corrected a typo. I will sell this method to Twitter ASAP! Now let's say you already have a few empty blocks in your database (deleted items). The follow-up question is how to handle the insertion of a new item? Append the item to the end of the file. Pro: fastest possible. Con: file will get huge because of all the empty blocks that remain because deleted items aren't actually deleted. Search for an empty block exactly the size of the one you're inserting. Pro: may get rid of some blocks. Con: you may end up scanning the whole file at each insert only to find out it's very unlikely to come across a perfectly fitting empty block. Find the first empty block which is equal or larger than the item you're inserting. Pro: you probably won't end up scanning the whole file, as you will find an empty block somewhere mid-way; this will keep the file size relatively low. Con: there will still be lots of leftover 0x00 bytes at the end of items which were inserted into bigger empty blocks than they are. Rigth now, I think the first deletion method and the last insertion method are probably the "best" mix, but they would still have their own small issues. Alternatively, the first insertion method and scheduled full database recreation. (Probably not a good idea when working with really large databases. Also, each small update in that method will clone the whole item to the end of the file, thus accelerating file growth at a potentially insane rate.) Unless there is a way of deleting/inserting blocks from/to the middle of the file in a file-system approved way, what's the best way to do this? More importantly, how do databases currently used in production usually handle this?

    Read the article

  • Where does java.util.logging.Logger store their log

    - by Harry Pham
    This might be a stupid question but I am a bit lost with java Logger private static Logger logger = Logger.getLogger("order.web.OrderManager"); logger.info("Removed order " + id + "."); Where do I see the log? Also this quote from java.util.logging.Logger library: On each logging call the Logger initially performs a cheap check of the request level (e.g. SEVERE or FINE) against the effective log level of the logger. If the request level is lower than the log level, the logging call returns immediately. After passing this initial (cheap) test, the Logger will allocate a LogRecord to describe the logging message. It will then call a Filter (if present) to do a more detailed check on whether the record should be published. If that passes it will then publish the LogRecord to its output Handlers. Does this mean that if I have 3 request level log: logger.log(Level.FINE, "Something"); logger.log(Level.WARNING, "Something"); logger.log(Level.SEVERE, "Something"); And my log level is SEVERE, I can see all three logs, if my log level is WARNING, then I cant see SEVERE log, is that correct? And how do I set the log level?

    Read the article

  • opening and viewing a file in php

    - by Christian Burgos
    how do i open/view for editing an uploaded file in php? i have tried this but it doesn't open the file. $my_file = 'file.txt'; $handle = fopen($my_file, 'r'); $data = fread($handle,filesize($my_file)); i've also tried this but it wont work. $my_file = 'file.txt'; $handle = fopen($my_file, 'w') or die('Cannot open file: '.$my_file); $data = 'This is the data'; fwrite($handle, $data); what i have in mind is like when you want to view an uploaded resume,documents or any other ms office files like .docx,.xls,.pptx and be able to edit them, save and close the said file. edit: latest tried code... <?php // Connects to your Database include "configdb.php"; //Retrieves data from MySQL $data = mysql_query("SELECT * FROM employees") or die(mysql_error()); //Puts it into an array while($info = mysql_fetch_array( $data )) { //Outputs the image and other data //Echo "<img src=localhost/uploadfile/images".$info['photo'] ."> <br>"; Echo "<b>Name:</b> ".$info['name'] . "<br> "; Echo "<b>Email:</b> ".$info['email'] . " <br>"; Echo "<b>Phone:</b> ".$info['phone'] . " <hr>"; //$file=fopen("uploadfile/images/".$info['photo'],"r+"); $file=fopen("Applications/XAMPP/xamppfiles/htdocs/uploadfile/images/file.odt","r") or exit("unable to open file");; } ?> i am getting the error: Warning: fopen(Applications/XAMPP/xamppfiles/htdocs/uploadfile/images/file.odt): failed to open stream: No such file or directory in /Applications/XAMPP/xamppfiles/htdocs/uploadfile/view.php on line 17 unable to open file the file is in that folder, i don't know it wont find it.

    Read the article

  • Reading data from text file in C

    - by themake
    I have a text file which contains words separated by space. I want to take each word from the file and store it. So i have opened the file but am unsure how to assign the word to a char. FILE *fp; fp = fopen("file.txt", "r"); //then i want char one = the first word in the file char two = the second word in the file

    Read the article

  • Copied a file with winscp; only winscp can see it

    - by nilbus
    I recently copied a 25.5GB file from another machine using WinSCP. I copied it to C:\beth.tar.gz, and WinSCP can still see the file. However no other app (including Explorer) can see the file. What might cause this, and how can I fix it? The details that might or might not matter WinSCP shows the size of the file (C:\beth.tar.gz) correctly as 27,460,124,080 bytes, which matches the filesize on the remote host Neither explorer, cmd (command line prompt w/ dir C:\), the 7Zip archive program, nor any other File Open dialog can see the beth.tar.gz file under C:\ I have configured Explorer to show hidden files I can move the file to other directories using WinSCP If I try to move the file to Users/, UAC prompts me for administrative rights, which I grant, and I get this error: Could not find this item The item is no longer located in C:\ When I try to transfer the file back to the remote host in a new directory, the transfer starts successfully and transfers data The transfer had about 30 minutes remaining when I left it for the night The morning after the file transfer, I was greeted with a message saying that the connection to the server had been lost. I don't think this is relevant, since I did not tell it to disconnect after the file was done transferring, and it likely disconnected after the file transfer finished. I'm using an old version of WinSCP - v4.1.8 from 2008 I can view the file properties in WinSCP: Type of file: 7zip (.gz) Location: C:\ Attributes: none (Ready-only, Hidden, Archive, or Ready for indexing) Security: SYSTEM, my user, and Administrators group have full permissions - everything other than "special permissions" is checked under Allow for all 3 users/groups (my user, Administrators, SYSTEM) What's going on?!

    Read the article

  • How do I open a file in such a way that if the file doesn't exist it will be created and opened automatically?

    - by snakile
    Here's how I open a file for writing+ : if( fopen_s( &f, fileName, "w+" ) !=0 ) { printf("Open file failed\n"); return; } fprintf_s(f, "content"); If the file doesn't exist the open operation fails. What's the right way to fopen if I want to create the file automatically if the file doesn't already exist? EDIT: If the file does exist, I would like fprintf to overwrite the file, not to append to it.

    Read the article

  • C++, Ifstream opens local file but not file on HTTP Server

    - by fammi
    Hi, I am using ifstream to open a file and then read from it. My program works fine when i give location of the local file on my system. for eg /root/Desktop/abc.xxx works fine But once the location is on the http server the file fails to open. for eg http://192.168.0.10/abc.xxx fails to open. Is there any alternate for ifstream when using a URL address? thanks. part of the code where having problem: bool readTillEof = (endIndex == -1) ? true : false; // Open the file in binary mode and seek to the end to determine file size ifstream file ( fileName.c_str ( ), ios::in|ios::ate|ios::binary ); if ( file.is_open ( ) ) { long size = (long) file.tellg ( ); long numBytesRead; if ( readTillEof ) { numBytesRead = size - startIndex; } else { numBytesRead = endIndex - startIndex + 1; } // Allocate a new buffer ptr to read in the file data BufferSptr buf (new Buffer ( numBytesRead ) ); mpStreamingClientEngine->SetResponseBuffer ( nextRequest, buf ); // Seek to the start index of the byte range // and read the data file.seekg ( startIndex, ios::beg ); file.read ( (char *)buf->GetData(), numBytesRead ); // Pass on the data to the SCE // and signal completion of request mpStreamingClientEngine->HandleDataReceived( nextRequest, numBytesRead); mpStreamingClientEngine->MarkRequestCompleted( nextRequest ); // Close the file file.close ( ); } else { // Report error to the Streaming Client Engine // as unable to open file AHS_ERROR ( ConnectionManager, " Error while opening file \"%s\"\n", fileName.c_str ( ) ); mpStreamingClientEngine->HandleRequestFailed( nextRequest, CONNECTION_FAILED ); } }

    Read the article

  • Problem with File uplolad in javascript.

    - by Nikhil
    I have used javascript to upload more than one file. when user clicks on 'add more' javascript appends new object to older div using innerHTML. Now the problem is if I select a file and then click on "add more" then new file button exist but older selected file removes and two blank file buttons display. I want this old file must be selected when user add new file button. If anybody can, Help Plz!!! tnX.

    Read the article

  • Log in manager doesn't appear after editing /etc/X11/default-display-manager

    - by hamed
    I have ubuntu 11.10 , and I installed kde and I choosed kdm mistakly, as mentioned here I did this procedure Pretty simple. Open the file /etc/X11/default-display-manager with your editor of choice. Make sure you invoke that editor as root, otherwise it won't work. In that file there's a single line: /usr/bin/kdm Change that to /usr/bin/gdm and save the file. Reboot and you're in Gnome. now ,after booting, the log in manager gdm or kdm didn't appear . how can I fix this?

    Read the article

  • File upload permission problem IIS 7

    - by krish
    I am unable to upload files to website hosted under IIS7. I have already given write permissions to "IUSR_websitename" and set the property in web.config also. I am able to upload files with out log in to application at the time of user registration. But once log in to application, if I upload files, it is giving "Access denied" error. Please help me.

    Read the article

  • Cron doesn't execute one of the scheduled jobs

    - by user288633
    I'm using a lubuntu desktop, distribution Ubuntu 13.10, i686. This is my problem: in the job list scheduled by cron a job hasn't effect, but in /var/log/syslog its execution is traced. This is the relative log line: Jun 4 09:06:01 kiosk CRON[14189]: (root) CMD (/usr/bin/xinput set-prop 12 --type=float "Coordinate Transformation Matrix" 0 -1 1 1 0 0 0 0 1 /tmp/mybackup.log) This job should rotate touchscreen mapping. I try different solutions: I substitute in crontab the with bash -c "", I set "export DISPLAY=:0.0" ("for Graphics related job in Unix Environment we need to set first the DISPLAY...") before the command,...and many other! I know there are a lots of details affect cron execution (path, environment variables, special character and other) and I have no more idea by now :( Could some gentleman suggest me an idea? where can I find the problem? Thanks in advance!

    Read the article

  • Nullmailer in /var/log/syslog

    - by Fluffy
    I'm getting a lot of messages like these: me@home:/etc/snmp$ tail /var/log/syslog Jun 12 17:52:15 home nullmailer[1238]: Starting delivery: protocol: smtp host: mail. file: 1339502401.24665 Jun 12 17:52:15 home nullmailer[7086]: smtp: Failed: Connect failed Jun 12 17:52:15 home nullmailer[1238]: Sending failed: Host not found Jun 12 17:52:15 home nullmailer[1238]: Starting delivery: protocol: smtp host: mail. file: 1339174804.27614 Jun 12 17:52:15 home nullmailer[7087]: smtp: Failed: Connect failed Jun 12 17:52:15 home nullmailer[1238]: Sending failed: Host not found Jun 12 17:52:15 home nullmailer[1238]: Starting delivery: protocol: smtp host: mail. file: 1339324201.21737 Jun 12 17:52:15 home nullmailer[7088]: smtp: Failed: Connect failed Jun 12 17:52:15 home nullmailer[1238]: Sending failed: Host not found Jun 12 17:52:15 home nullmailer[1238]: Delivery complete, 331 message(s) remain. The problem is, I don't recall sending anything. How do I find out which software is sending these messages? How do I read them?

    Read the article

  • excel cannot open the file xxx.xlsx' because the file format is not valid error

    - by Yavuz
    I have difficulty open opening word and excel files suddenly. Only particular office file give me the problem. These files were previously scanned by combo fix and I believe they were damaged. The error response that I from office is Excel cannot open the file xxx.xlsx because the file format is not valid. Verify that the file has not been corrupted and that the file extension matches the format of the file. This is for excel and a similar kind of error response comes for word. The file looks fine. I mean the size vise... Please help me with this problem. I really appreciate your help and time....

    Read the article

  • Upon clicking on a file, excel opens but not the file itself

    - by william
    Platform: Windows XP SP2, Excel 2007 Problem description: Upon clicking on a file in Windows Explorer (file is either .xls or .xlsx) Excel 2007 opens, but does not open the file itself. I need either to click on a file again in Windows Explorer or open it manually with File/Open ... from Excel. Does anyone know what could cause this rather strange behaviour ? The old versions of Excel worked "normally" ... i.e. upon clicking on a file, an Excel would open along with the file. Please, help !

    Read the article

  • Syntax for piping varnish logs to rotatelogs

    - by jetboy
    Ubuntu 12.04 Server x64, Varnish 3.0.2 I'm trying to pipe varnishncsa's logs through Apache's rotatelogs, and running from the shell, things work fine: sudo varnishncsa -a -P /var/run/varnishncsa/varnishncsa.pid |/usr/sbin/rotatelogs /var/log/varnish/varnish.log.%Y%m%d%H 3600 creates a new logfile in /var/log/varnish, with rotation every hour (3600 seconds). However, I'm struggling to get things working the same way inside /etc/init.d/varnishncsa: PATH=/sbin:/bin:/usr/sbin:/usr/bin DAEMON=/usr/bin/$NAME PIDFILE=/var/run/$NAME/$NAME.pid LOGFILE=/var/log/varnish/varnishncsa.log USER=varnishlog DAEMON_OPTS="-a -P ${PIDFILE}" DAEMON_PIPE="|/usr/sbin/rotatelogs /var/log/varnish/varnish.log.%Y%m%d%H 3600" ... start_varnishncsa() { output=$(/bin/tempfile -s.varnish) log_daemon_msg "Starting $DESC" "$NAME" create_pid_directory if start-stop-daemon --start --verbose --pidfile ${PIDFILE} \ --chuid $USER --exec ${DAEMON} -- ${DAEMON_OPTS} \ > ${output} 2>&1; then log_end_msg 0 else log_end_msg 1 cat $output exit 1 fi rm $output } Where should I put DAEMON_PIPE in the above code? I've tried at the end of: if start-stop-daemon --start --verbose --pidfile ${PIDFILE} which is where additional command line parameters usually go, but it isn't creating a logfile.

    Read the article

  • Can't log in to GNOME after upgrade (raring -> saucy)

    - by x-yuri
    I've just upgraded my ubuntu (raring to saucy) and I now can't log in to GNOME. As opposed to virtual consoles (Ctrl-Alt-F1, for example). I set it up to log in automatically. But it asks for password now. I type in the password, press Enter, the screen blinks and here I am again at the login screen. Then I looked into /var/log/Xorg.0.log: [ 33.956] Initializing built-in extension DRI2 [ 33.956] (II) LoadModule: "glx" [ 33.956] (II) Loading /usr/lib/xorg/modules/extensions/libglx.so [ 33.956] (II) Module glx: vendor="X.Org Foundation" [ 33.956] compiled for 1.14.3, module version = 1.0.0 [ 33.956] ABI class: X.Org Server Extension, version 7.0 [ 33.956] (==) AIGLX enabled [ 33.956] Loading extension GLX [ 33.956] (==) Matched fglrx as autoconfigured driver 0 [ 33.956] (==) Matched ati as autoconfigured driver 1 [ 33.956] (==) Matched fglrx as autoconfigured driver 2 [ 33.956] (==) Matched ati as autoconfigured driver 3 [ 33.956] (==) Matched vesa as autoconfigured driver 4 [ 33.956] (==) Matched modesetting as autoconfigured driver 5 [ 33.956] (==) Matched fbdev as autoconfigured driver 6 [ 33.956] (==) Assigned the driver to the xf86ConfigLayout [ 33.956] (II) LoadModule: "fglrx" [ 33.957] (WW) Warning, couldn't open module fglrx [ 33.957] (II) UnloadModule: "fglrx" [ 33.957] (II) Unloading fglrx [ 33.957] (EE) Failed to load module "fglrx" (module does not exist, 0) [ 33.957] (II) LoadModule: "ati" [ 33.957] (WW) Warning, couldn't open module ati [ 33.957] (II) UnloadModule: "ati" [ 33.957] (II) Unloading ati [ 33.957] (EE) Failed to load module "ati" (module does not exist, 0) [ 33.957] (II) LoadModule: "vesa" [ 33.957] (II) Loading /usr/lib/xorg/modules/drivers/vesa_drv.so [ 33.957] (II) Module vesa: vendor="X.Org Foundation" [ 33.957] compiled for 1.14.1, module version = 2.3.2 [ 33.957] Module class: X.Org Video Driver [ 33.957] ABI class: X.Org Video Driver, version 14.1 [ 33.957] (II) LoadModule: "modesetting" [ 33.957] (II) Loading /usr/lib/xorg/modules/drivers/modesetting_drv.so [ 33.957] (II) Module modesetting: vendor="X.Org Foundation" [ 33.957] compiled for 1.14.1, module version = 0.8.0 [ 33.957] Module class: X.Org Video Driver [ 33.957] ABI class: X.Org Video Driver, version 14.1 [ 33.957] (II) LoadModule: "fbdev" [ 33.957] (II) Loading /usr/lib/xorg/modules/drivers/fbdev_drv.so [ 33.958] (II) Module fbdev: vendor="X.Org Foundation" [ 33.958] compiled for 1.14.1, module version = 0.4.3 [ 33.958] Module class: X.Org Video Driver [ 33.958] ABI class: X.Org Video Driver, version 14.1 [ 33.958] (==) Matched fglrx as autoconfigured driver 0 [ 33.958] (==) Matched ati as autoconfigured driver 1 [ 33.958] (==) Matched fglrx as autoconfigured driver 2 [ 33.958] (==) Matched ati as autoconfigured driver 3 [ 33.958] (==) Matched vesa as autoconfigured driver 4 [ 33.958] (==) Matched modesetting as autoconfigured driver 5 [ 33.958] (==) Matched fbdev as autoconfigured driver 6 [ 33.958] (==) Assigned the driver to the xf86ConfigLayout [ 33.958] (II) LoadModule: "fglrx" [ 33.958] (WW) Warning, couldn't open module fglrx [ 33.958] (II) UnloadModule: "fglrx" [ 33.958] (II) Unloading fglrx [ 33.958] (EE) Failed to load module "fglrx" (module does not exist, 0) [ 33.958] (II) LoadModule: "ati" [ 33.958] (WW) Warning, couldn't open module ati [ 33.958] (II) UnloadModule: "ati" [ 33.958] (II) Unloading ati [ 33.958] (EE) Failed to load module "ati" (module does not exist, 0) [ 33.958] (II) LoadModule: "vesa" [ 33.958] (II) Loading /usr/lib/xorg/modules/drivers/vesa_drv.so [ 33.958] (II) Module vesa: vendor="X.Org Foundation" [ 33.958] compiled for 1.14.1, module version = 2.3.2 [ 33.958] Module class: X.Org Video Driver [ 33.958] ABI class: X.Org Video Driver, version 14.1 [ 33.958] (II) UnloadModule: "vesa" [ 33.958] (II) Unloading vesa [ 33.958] (II) Failed to load module "vesa" (already loaded, 0) [ 33.958] (II) LoadModule: "modesetting" [ 33.959] (II) Loading /usr/lib/xorg/modules/drivers/modesetting_drv.so [ 33.959] (II) Module modesetting: vendor="X.Org Foundation" [ 33.959] compiled for 1.14.1, module version = 0.8.0 [ 33.959] Module class: X.Org Video Driver [ 33.959] ABI class: X.Org Video Driver, version 14.1 [ 33.959] (II) UnloadModule: "modesetting" [ 33.959] (II) Unloading modesetting [ 33.959] (II) Failed to load module "modesetting" (already loaded, 0) [ 33.959] (II) LoadModule: "fbdev" [ 33.959] (II) Loading /usr/lib/xorg/modules/drivers/fbdev_drv.so [ 33.959] (II) Module fbdev: vendor="X.Org Foundation" [ 33.959] compiled for 1.14.1, module version = 0.4.3 [ 33.959] Module class: X.Org Video Driver [ 33.959] ABI class: X.Org Video Driver, version 14.1 [ 33.959] (II) UnloadModule: "fbdev" [ 33.959] (II) Unloading fbdev [ 33.959] (II) Failed to load module "fbdev" (already loaded, 0) [ 33.959] (II) VESA: driver for VESA chipsets: vesa [ 33.959] (II) modesetting: Driver for Modesetting Kernel Drivers: kms [ 33.959] (II) FBDEV: driver for framebuffer: fbdev [ 33.959] (++) using VT number 7 If I install fglrx, it reads: [ 37.152] Initializing built-in extension DRI2 [ 37.152] (II) LoadModule: "glx" [ 37.152] (II) Loading /usr/lib/x86_64-linux-gnu/xorg/extra-modules/modules/extensions/libglx.so [ 37.152] (II) Module glx: vendor="Advanced Micro Devices, Inc." [ 37.152] compiled for 6.9.0, module version = 1.0.0 [ 37.152] Loading extension GLX [ 37.153] (==) Matched fglrx as autoconfigured driver 0 [ 37.153] (==) Matched ati as autoconfigured driver 1 [ 37.153] (==) Matched vesa as autoconfigured driver 2 [ 37.153] (==) Matched modesetting as autoconfigured driver 3 [ 37.153] (==) Matched fbdev as autoconfigured driver 4 [ 37.153] (==) Assigned the driver to the xf86ConfigLayout [ 37.153] (II) LoadModule: "fglrx" [ 37.153] (II) Loading /usr/lib/x86_64-linux-gnu/xorg/extra-modules/modules/drivers/fglrx_drv.so [ 37.168] (II) Module fglrx: vendor="FireGL - AMD Technologies Inc." [ 37.168] compiled for 1.4.99.906, module version = 13.10.10 [ 37.168] Module class: X.Org Video Driver [ 37.168] (II) Loading sub module "fglrxdrm" [ 37.168] (II) LoadModule: "fglrxdrm" [ 37.168] (II) Loading /usr/lib/x86_64-linux-gnu/xorg/extra-modules/modules/linux/libfglrxdrm.so [ 37.169] (II) Module fglrxdrm: vendor="FireGL - AMD Technologies Inc." [ 37.169] compiled for 1.4.99.906, module version = 13.10.10 [ 37.169] (II) LoadModule: "ati" [ 37.169] (WW) Warning, couldn't open module ati [ 37.169] (II) UnloadModule: "ati" [ 37.169] (II) Unloading ati [ 37.169] (EE) Failed to load module "ati" (module does not exist, 0) [ 37.169] (II) LoadModule: "vesa" [ 37.169] (II) Loading /usr/lib/xorg/modules/drivers/vesa_drv.so [ 37.169] (II) Module vesa: vendor="X.Org Foundation" [ 37.169] compiled for 1.14.1, module version = 2.3.2 [ 37.169] Module class: X.Org Video Driver [ 37.169] ABI class: X.Org Video Driver, version 14.1 [ 37.169] (II) LoadModule: "modesetting" [ 37.170] (II) Loading /usr/lib/xorg/modules/drivers/modesetting_drv.so [ 37.170] (II) Module modesetting: vendor="X.Org Foundation" [ 37.170] compiled for 1.14.1, module version = 0.8.0 [ 37.170] Module class: X.Org Video Driver [ 37.170] ABI class: X.Org Video Driver, version 14.1 [ 37.170] (II) LoadModule: "fbdev" [ 37.170] (II) Loading /usr/lib/xorg/modules/drivers/fbdev_drv.so [ 37.170] (II) Module fbdev: vendor="X.Org Foundation" [ 37.170] compiled for 1.14.1, module version = 0.4.3 [ 37.170] Module class: X.Org Video Driver [ 37.170] ABI class: X.Org Video Driver, version 14.1 [ 37.170] (==) Matched fglrx as autoconfigured driver 0 [ 37.170] (==) Matched ati as autoconfigured driver 1 [ 37.170] (==) Matched vesa as autoconfigured driver 2 [ 37.170] (==) Matched modesetting as autoconfigured driver 3 [ 37.170] (==) Matched fbdev as autoconfigured driver 4 [ 37.170] (==) Assigned the driver to the xf86ConfigLayout [ 37.170] (II) LoadModule: "fglrx" [ 37.170] (II) Loading /usr/lib/x86_64-linux-gnu/xorg/extra-modules/modules/drivers/fglrx_drv.so [ 37.170] (II) Module fglrx: vendor="FireGL - AMD Technologies Inc." [ 37.170] compiled for 1.4.99.906, module version = 13.10.10 [ 37.170] Module class: X.Org Video Driver [ 37.170] (II) LoadModule: "ati" [ 37.170] (WW) Warning, couldn't open module ati [ 37.170] (II) UnloadModule: "ati" [ 37.171] (II) Unloading ati [ 37.171] (EE) Failed to load module "ati" (module does not exist, 0) [ 37.171] (II) LoadModule: "vesa" [ 37.171] (II) Loading /usr/lib/xorg/modules/drivers/vesa_drv.so [ 37.171] (II) Module vesa: vendor="X.Org Foundation" [ 37.171] compiled for 1.14.1, module version = 2.3.2 [ 37.171] Module class: X.Org Video Driver [ 37.171] ABI class: X.Org Video Driver, version 14.1 [ 37.171] (II) UnloadModule: "vesa" [ 37.171] (II) Unloading vesa [ 37.171] (II) Failed to load module "vesa" (already loaded, 0) [ 37.171] (II) LoadModule: "modesetting" [ 37.171] (II) Loading /usr/lib/xorg/modules/drivers/modesetting_drv.so [ 37.171] (II) Module modesetting: vendor="X.Org Foundation" [ 37.171] compiled for 1.14.1, module version = 0.8.0 [ 37.171] Module class: X.Org Video Driver [ 37.171] ABI class: X.Org Video Driver, version 14.1 [ 37.171] (II) UnloadModule: "modesetting" [ 37.171] (II) Unloading modesetting [ 37.171] (II) Failed to load module "modesetting" (already loaded, 0) [ 37.171] (II) LoadModule: "fbdev" [ 37.171] (II) Loading /usr/lib/xorg/modules/drivers/fbdev_drv.so [ 37.171] (II) Module fbdev: vendor="X.Org Foundation" [ 37.171] compiled for 1.14.1, module version = 0.4.3 [ 37.171] Module class: X.Org Video Driver [ 37.171] ABI class: X.Org Video Driver, version 14.1 [ 37.171] (II) UnloadModule: "fbdev" [ 37.171] (II) Unloading fbdev [ 37.171] (II) Failed to load module "fbdev" (already loaded, 0) [ 37.171] (II) AMD Proprietary Linux Driver Version Identifier:13.10.10 [ 37.171] (II) AMD Proprietary Linux Driver Release Identifier: UNSUPPORTED-13.101 [ 37.171] (II) AMD Proprietary Linux Driver Build Date: May 23 2013 15:49:35 [ 37.171] (II) VESA: driver for VESA chipsets: vesa [ 37.171] (II) modesetting: Driver for Modesetting Kernel Drivers: kms [ 37.171] (II) FBDEV: driver for framebuffer: fbdev [ 37.171] (++) using VT number 7 I did more installing/removing packages than that. There were a moment when it said: (EE) Failed to load /usr/lib64/xorg/modules/libglamoregl.so: /usr/lib64/xorg/modules/libglamoregl.so: undefined symbol: _glapi_tls_Context Also there is init: not found in ~/.xsession-errors: /usr/sbin/lightdm-session: 5: exec: init: not found Actually, I'm out of ideas. What about you? :)

    Read the article

  • How to write files in specific order?

    - by Bernie
    Okay, here's a weird problem -- My wife just bought a 2014 Nissan Altima. So, I took her iTunes library and converted the .m4a files to .mp3, since the car audio system only supports .mp3 and .wma. So far so good. Then I copied the files to a DOS FAT-32 formatted USB thumb drive, and connected the drive to the car's USB port, only to find all of the tracks were out of sequence. All tracks begin with a two digit numeric prefix, i.e., 01, 02, 03, etc. So you would think they would be in order. So I called Nissan Connect support and the rep told me that there is a known problem with reading files in the correct order. He said the files are read in the same order they are written. So, I manually copied a few albums with the tracks in a predetermined order, and sure enough he was correct. So I copied about 6 albums for testing, then changed to the top level directory and did a "find . music.txt". Then I passed this file to rsync like this: rsync -av --files-from=music.txt . ../Marys\ Music\ Sequenced/ The files looked like they were copied in order, but when I listed the files in order of modified time, they were in the same sequence as the original files: ../Marys Music Sequenced/Air Supply/Air Supply Greatest Hits ls -1rt 01 Lost In Love.mp3 04 Every Woman In The World.mp3 03 Chances.mp3 02 All Out Of Love.mp3 06 Here I Am (Just When I Thought I Was Over You).mp3 05 The One That You Love.mp3 08 I Want To Give It All.mp3 07 Sweet Dreams.mp3 11 Young Love.mp3 So the question is, how can I copy files listed in a file named music.txt, and copy them to a destination, and ensure the modification times are in the same sequence as the files are listed?

    Read the article

  • rename files with the same name

    - by snorpey
    Hi. I use the following function to rename thumbnails. For example, if I upload a file called "image.png" to an upload folder, and this folder already has a file named "image.png" in it, the new file automatically gets renamed to "image-copy-1.png". If there also is a file called "image-copy-1.png" it gets renamed to "image-copy-2.png" and so on. The following function returns the new filename. At least that's what it is supposed to do... The renaming doesn't seeem to work correctly, though. Sometimes it produces strange results, like: 1.png 1-copy-1.png 1-copy-2.png 1-copy-2-copy-1.png 1-copy-2-copy-3.png I hope you understand my problem, despite my description being somewhat complex... Can you tell me what went wrong here? (bonus question: Is regular expressions the right tool for doing this kind of stuff?) <?php function renameDuplicates($path, $file) { $fileName = pathinfo($path . $file, PATHINFO_FILENAME); $fileExtension = "." . pathinfo($path . $file, PATHINFO_EXTENSION); if(file_exists($path . $file)) { $fileCopy = $fileName . "-copy-1"; if(file_exists($path . $fileCopy . $fileExtension)) { if ($contains = preg_match_all ("/.*?(copy)(-)(\\d+)/is", $fileCopy, $matches)) { $copyIndex = $matches[3][0]; $fileName = substr($fileCopy, 0, -(strlen("-copy-" . $copyIndex))) . "-copy-" . ($copyIndex + 1); } } else { $fileName .= "-copy-1"; } } $returnValue = $fileName . $fileExtension; return $returnValue; }?>

    Read the article

< Previous Page | 26 27 28 29 30 31 32 33 34 35 36 37  | Next Page >