Search Results

Search found 11644 results on 466 pages for 'column defaults'.

Page 315/466 | < Previous Page | 311 312 313 314 315 316 317 318 319 320 321 322  | Next Page >

  • Is it possible to use images in an Excel IF statement?

    - by dunc
    Quite a simple one here, but I guess the answer will be a resounding no! I have a few symbols, basic clip-art, which I'd like to display depending on certain information. At the moment, I'm using this statement to display Y or N: =IF(B2>0,VLOOKUP(B2,'Student Data'!$A$2:$L$36,8),"") It's a simple lookup which checks another worksheet to see if someone has entered "Y" or "N" into the relevant column. What I'm wondering is this: would it be possible to display these clip-art images (I have them in .PNG format) instead of simple text? I.e. IF VALUE_OF_CELL=7, DISPLAY IMAGE1. Thanks in advance,

    Read the article

  • Convert text to table

    - by Quattro
    I would like convert text into a table. Here is a link to the text http://www.tcdb.org/public/tcdb Short example: >gnl|TC-DB|A0CIB0|1.A.17.3.1 Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1 MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI >gnl|TC-DB|A0CS82|9.B.82.1.5 Chromosome undetermined scaffold_26, whole genome shotgun sequence - Paramecium tetraurelia. MIIEEQIEEKMIYKAIHRVKVNYQKKIDRYILYKKSRWFFNLLLMLLYAYRIQNIGGFYI VTYIYCVYQLQLLIDYFTPLGLPPVNLEDEEEDDDQFQNDFSELPTTLSNKNELNDKEFR PLLRTTSEFKVWQKSVFSVIFAYFCTYIPIWDIPVYWPFLFCYFFVIVGMSIRKYIKHMK KYGYTILDFTKKK I wanted to have columns for example delimited with pipe | or ; |>gnl|TC-DB|A0CIB0|1.A.17.3.1| Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1| MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI I am working with Windows and I don't know how to do it I just know every row starts with > I want to substitute the first whitespace in a row with a delimiter like | or ; after the first regular expression new line in a row, I want also a delimiter everything between the regular expression first new line and > should go into a new column (it's a sequence of a protein)

    Read the article

  • Set an Excel cell's color based on multiple other cells' colors

    - by Lord Torgamus
    I have an Excel 2007 spreadsheet for a list of products and a bunch of factors to rate each one on, and I'm using Conditional Formatting to set the color of the cells in the individual attribute columns. It looks something like this: I want to fill in the rating column for each item with a color, based on the color ratings of its individual attributes. Examples of ways to determine this: the color of the category in which the item scored worst the statistical mode of the category colors the average of the category ratings, where each color is assigned a numerical value How can I implement any or all of the above rules? (I'm really just asking for a quick overview of the relevant Excel feature; I don't need step-by-step instructions for each rule.)

    Read the article

  • What else can I do to secure my Linux server?

    - by eric01
    I want to put a web application on my Linux server: I will first explain to you what the web app will do and then I will tell you what I did so far to secure my brand new Linux system. The app will be a classified ads website (like gumtree.co.uk) where users can sell their items, upload images, send to and receive emails from the admin. It will use SSL for some pages. I will need SSH. So far, what I did to secure my stock Ubuntu (latest version) is the following: NOTE: I probably did some things that will prevent the application from doing all its tasks, so please let me know of that. My machine's sole purpose will be hosting the website. (I put numbers as bullet points so you can refer to them more easily) 1) Firewall I installed Uncomplicated Firewall. Deny IN & OUT by default Rules: Allow IN & OUT: HTTP, IMAP, POP3, SMTP, SSH, UDP port 53 (DNS), UDP port 123 (SNTP), SSL, port 443 (the ones I didn't allow were FTP, NFS, Samba, VNC, CUPS) When I install MySQL & Apache, I will open up Port 3306 IN & OUT. 2) Secure the partition in /etc/fstab, I added the following line at the end: tmpfs /dev/shm tmpfs defaults,rw 0 0 Then in console: mount -o remount /dev/shm 3) Secure the kernel In the file /etc/sysctl.conf, there are a few different filters to uncomment. I didn't know which one was relevant to web app hosting. Which one should I activate? They are the following: A) Turn on Source Address Verification in all interfaces to prevent spoofing attacks B) Uncomment the next line to enable packet forwarding for IPv4 C) Uncomment the next line to enable packet forwarding for IPv6 D) Do no accept ICMP redirects (we are not a router) E) Accept ICMP redirects only for gateways listed in our default gateway list F) Do not send ICMP redirects G) Do not accept IP source route packets (we are not a router) H) Log Martian Packets 4) Configure the passwd file Replace "sh" by "false" for all accounts except user account and root. I also did it for the account called sshd. I am not sure whether it will prevent SSH connection (which I want to use) or if it's something else. 5) Configure the shadow file In the console: passwd -l to lock all accounts except user account. 6) Install rkhunter and chkrootkit 7) Install Bum Disabled those services: "High performance mail server", "unreadable (kerneloops)","unreadable (speech-dispatcher)","Restores DNS" (should this one stay on?) 8) Install Apparmor_profiles 9) Install clamav & freshclam (antivirus and update) What did I do wrong and what should I do more to secure this Linux machine? Thanks a lot in advance

    Read the article

  • Vim Misbehaving

    - by zchtodd
    I'm not sure what changed, but lately Vim has been driving me nuts. Whenever I try to do a column mode insert, vim takes my current character and adds to the last character I inserted. For example, the first time I do a block comment by inserting # on multiple lines, it works fine. The next time, however, I end up with ## inserted on every line, and the problem just compounds from there. To do this, I'm hitting Ctrl-V, down or up arrow, Shift-I, #, and then Esc. This worked for months, but now it seems to be pasting extra stuff in. I've tried disabling all .vimrc files, but the behavior remains the same. Any ideas?

    Read the article

  • How do I combine data from multiple rows in excel to one cell?

    - by Steve
    I have a list of product skus in one column in excel. I have thousands of these skus that need to be combined in one cell separated by commas with no spaces. There are too many rows of data to use the concatenate function. Not sure how to get this done. Here's an example of what I'm working with but with 6,000+ more rows. I'm using Excel 2003. A 140-12 1074-156 903-78 876-65 349-09 986-43 237-12 342-11 450-187 677-133

    Read the article

  • Emacs org-mode: how to avoid duplicate lines in agenda, when items is scheduled AND has deadline

    - by Martin
    Many of my TODO items in Emacs org-mode have a DEADLINE defined in the future (e. g. Friday) and are at the same time SCHEDULED today so that I already know I have to start working on this task. Then, this task will appear twice in my agenda. That's not nice but not necessarily a problem yet, but if then the task has assigned a time estimate for its duration and I go to column view with C-C C-X C-C to see how much time my tasks today will need, the time estimate for this task is counted twice, so e. g. if the time effort estimate is 2 hours, I'll have 4 hours in my daily agenda, as the item appears as well as scheduled today (or in the past) as also with its deadline in 3 days. How can I avoid counting an item twice?

    Read the article

  • Backup all plesk MySQL Databases to individual files

    - by Michael
    Hy, Because I'm new to shell scripting I need a hand. I currently backup all mydatabases to a single file, thing that makes the restore preaty hard. The second problem that my MySQL password dosen't work because of a Plesk bug and i get the password from "/etc/psa/.psa.shadow". Here is the code that I use to backup all my databases to a single file. mysqldump -uadmin -p`cat /etc/psa/.psa.shadow` --all-databases | bzip2 -c > /root/21.10.2013.sql.bz2 I found some scripts on the web that backup each database to individual files but I don't know how to make them work for my situation. Here is a example script: for db in $(mysql -e 'show databases' -s --skip-column-names); do mysqldump $db | gzip > "/backups/mysqldump-$(hostname)-$db-$(date +%Y-%m-%d-%H.%M.%S).gz"; done Can someone help me make the script above work for my situation? Requirements: Backup each database to individual file using plesk password location.

    Read the article

  • How can i lock images to a cell in excel 2010

    - by Jamie
    Ok, so i am using microsoft excel 2010 and have a set up currently where i have 2 views expanded and deflated using the Group or +/- function. My problem is that ui have images on the workbook too. The images are over the cells which are to be "hidden" when the - button is pressed and i would like the images to disappear with them. This is not curently happening instead they are moving to the next visible cell. I have included an example below incase i wasn't clear. I wish to hide Columns M:AU and the images are in various cells suchas N5 and O5. When i colapse (hide) the column range all of the images move to "AV5" the next row along that isn't hidden. This means the workbooks is looking messy when colapsed which is the oposite of what i was trying to do. Can anyone advise on a way around this?

    Read the article

  • Sharepoint managed Properties

    - by paulie
    Originally posted on StackOverflow, and edited for clarity I have a custom Content Type inside a list that has over 30 items (Which were uploaded via DockIt), and I have added several "managed properties" to the "crawled properties", in the SSP. All of them work except 1. The column "Synopsis" is a multiline field with no limit on it's length. It appears as a crawled property "Synopsis", and is mapped to a managed property 'asynop'. On the 'Advanced Search Page', it is added as a property and searchable, however it only returns a some matching records (if any). I manually created an entry, ran the crawl and was able to search for it. I edited an existing entry, ran the crawl (full and incremental), and it still only returned the manually entered entry. If I entered the search term in the Search box directly "asynop:fatigue", then all the correct results appear. Why is this happening? And could it please stop?

    Read the article

  • Cant Add Columns to a AD Task pad except for the top level of the domain

    - by Darktux
    We are working on Active Directory taskpads application for user management in our organization and facing stange issue. When we create a taskpad, and when we are at top level of the domain, i can click view - Add/Remove Columns and add "Pre Windows Name" (and lots of other properties) to the taskpad as columns, but when i just go 1 level down , i can only see "Operating System" and "Service Pack" ; why is it happening , isnt "Domain Admins" supposed to god access to all the things in AD domain , atleast of objects they own? It is important to have "Pre Windows 2000" Name as a column begause with out that our "Shell Command" task wont show up in taskpads, since its bound to parameter "Col<9" (which is pre qindows name). Please do let me know if any additions questions to clarify my problem.

    Read the article

  • Formula in table header cells

    - by Cylindric
    I have a table in Excel 2007 that I want to summarise, in a similar fashion to a Pivot Table, but for various reasons I can't use a pivot table. I like the "Format as table" features of sort and filter buttons, automatic formatting etc, so have used that to create a simple table: A B C N +-----------+------------+------------+-------+------------+ 1 | | 01/01/2010 | 01/02/2010 | ... | 01/12/2010 | +-----------+------------+------------+-------+------------+ 2 | CategoryA | 15 | 545 | | 634 | 3 | CategoryB | 32 | 332 | | 231 | 4 | CategoryC | 5 | 234 | | 644 | | ... | | | | | 27 | CategoryZ | 2 | 123 | | 64 | +-----------+------------+------------+-------+------------+ The numbers are retrieved from a "back-end" pivot table using GETPIVOTDATA(). All that works fine. Now, the problem is that I can't seem to use formulas for my column headings in these new "smart" tables - they are converted to text or just broken. For example if in B1 I put NOW(), I don't get the date, I get 00/01/1900. Is there any way of getting a formula to work in the auto tables? Or do I have to use standard tables and manually alternate-colour my rows etc?

    Read the article

  • In Excel, how to group data by date, and then do operations on the data?

    - by Bicou
    Hi, I have Excel 2003. My data is like this: 01/10/2010 0.99 02/10/2010 1.49 02/10/2010 0.99 02/10/2010 0.99 02/10/2010 0.99 03/10/2010 1.49 03/10/2010 1.49 03/10/2010 0.99 etc. In fact it is a list of sales every day. I want to have something like this: 01/10/2010 0.99 02/10/2010 4.46 03/10/2010 3.97 I want to group by date, and sum the column B. I'd like to see the evolution of the sales over time, and display a nice graph about that. I have managed to create pivot tables that almost do the job: they list the number of 0.99 and 1.49 each day, but I can't find a way to simply sum everything and group by date. Thanks for reading.

    Read the article

  • Custom CSV (.csv) filter for OpenOffice.org or LibreOffice?

    - by anon
    Is it possible to create a some kind of 'custom CSV filter' for OpenOffice.org or LibreOffice spreadsheet program. What I need is to have the program to use predefined CSV settings for loading and saving when I open, let's say file named 'somefile.myext'. Also I would need the loaded data to be placed in a prestyled spreadsheet. In this particular case, I would need the CSV settings to have tab as a field delimiter and no text delimiter at all. Prestyled spreadsheet would contain Blue gray coloring for every odd row (achieved with conditional formatting formula), some font styling and probably some column width definitions.

    Read the article

  • Excel - Dynamic row reference based on the row I paste a formula into?

    - by michaelmichael
    I have a simple, oft-used formula that I paste as plain text into spreadsheets I receive. It looks something like this: =IF(D8="FOO", "BAR", "BAZ") It looks in D8 for the word "FOO". If it finds it it will show "BAR". If it doesn't it will show "BAZ" It works great. The problem is I have to paste this formula as plain text into many spreadsheets. It should ALWAYS look in column D for "FOO", however I don't always want it to look in row 8. I'd like it to look at whatever row I'm pasting it into. For example, if I pasted the above formula into row 25, say, I would like it to automatically change to this: =IF(D25="FOO", "BAR", "BAZ") Is there any way to achieve this?

    Read the article

  • Windows 7 Enterprise, Service Pack 1. Software MS Office Excel 2010

    - by user327560
    In Excel I understand there is no mechanism to customise & re-label the Rows & Columns (i.e. Renaming Col. A to some text like "Item Number" and so on. My question is regarding if it's possible to start Row Numbering at zero, or to determine a pre-allocated number of rows which contain my Headers, and then the first Row with the detail is infact seen as Row 1? Reason for question is I work multiple INternational Projects and we use Excel to trsack alot of activities & issues. Oddly, many people will refer to, for example "Point 7"... Some people mean the ID 7 (which I have the first Column dedicated to ID Number), some mean Excel Row 7, which infact could be really ID 3, or 4 from Col. A.... Any easy way or workaround to just use the Excel Row Numbers but select from when Row 1 is counted?

    Read the article

  • How can I turn off calculated columns in an Excel table from a macro using VBA?

    - by user41293
    I am working on a macro that inserts formulas into a cell in an Excel table. The Excel table does the automatic filling of columns and fills all the cells in that column with the formula, but all I want is one cell to have the formula. I cannot just turn off automatic formula for tables as I need to have other people use this worksheet on their systems. Is there a way to turn off the automatic filling of formulas in a table using VBA in a macro? It just needs to be temporary: I just want to turn it off, put in my formulas, then turn it back on.

    Read the article

  • Average Difference and Direction Between Values in Excel with Blanks

    - by 114
    I have a sheet that looks something like this: Sheet 1 1 2 3 4 5 6 7 8 9 10 11 1 6 2 3 5 3 4 2 4 9 4 5 6 4 6 6 7 5 3 3 3 10 8 4 8 8 9 4 11 12 12 6 10 11 8 5 5 4 9 4 7 6 What I would like to be able to do is find the average difference and direction between values in each column. For example, the first 4 rows would look like: Average Difference # + Movements # -Movements 1 2 2 1 0 3 4 (2+5+5)/3 2 1 Blanks represent N/A values due to insufficient information, and differences are calculated successively i.e. col2-col1, col3-col2, col4-col3 If I just take the differences and make a duplicate table with the formula =C2-B2 copied across issues arise whenever there is a blank space between two values or at the beginning of the row. Is there an easy way to fix this or another way to do this that I might be missing?

    Read the article

  • function to org-sort by three (3) criteria: due date / priority / title

    - by lawlist
    Is anyone aware of an org-sort function / modification that can refile / organize a group of TODO so that it sorts them by three (3) criteria: first sort by due date, second sort by priority, and third sort by by title of the task? EDIT: If anyone can please help me to modify this so that undated TODO are sorted last, that would be greatly appreciated -- at the present time, undated TODO are not being sorted: ;; multiple sort (defun org-sort-multi (&rest sort-types) "Multiple sorts on a certain level of an outline tree, or plain list items. SORT-TYPES is a list where each entry is either a character or a cons pair (BOOL . CHAR), where BOOL is whether or not to sort case-sensitively, and CHAR is one of the characters defined in `org-sort-entries-or-items'. Entries are applied in back to front order. Example: To sort first by TODO status, then by priority, then by date, then alphabetically (case-sensitive) use the following call: (org-sort-multi '(?d ?p ?t (t . ?a)))" (interactive) (dolist (x (nreverse sort-types)) (when (char-valid-p x) (setq x (cons nil x))) (condition-case nil (org-sort-entries (car x) (cdr x)) (error nil)))) ;; sort current level (defun lawlist-sort (&rest sort-types) "Sort the current org level. SORT-TYPES is a list where each entry is either a character or a cons pair (BOOL . CHAR), where BOOL is whether or not to sort case-sensitively, and CHAR is one of the characters defined in `org-sort-entries-or-items'. Entries are applied in back to front order. Defaults to \"?o ?p\" which is sorted by TODO status, then by priority" (interactive) (when (equal mode-name "Org") (let ((sort-types (or sort-types (if (or (org-entry-get nil "TODO") (org-entry-get nil "PRIORITY")) '(?d ?t ?p) ;; date, time, priority '((nil . ?a)))))) (save-excursion (outline-up-heading 1) (let ((start (point)) end) (while (and (not (bobp)) (not (eobp)) (<= (point) start)) (condition-case nil (outline-forward-same-level 1) (error (outline-up-heading 1)))) (unless (> (point) start) (goto-char (point-max))) (setq end (point)) (goto-char start) (apply 'org-sort-multi sort-types) (goto-char end) (when (eobp) (forward-line -1)) (when (looking-at "^\\s-*$") ;; (delete-line) ) (goto-char start) ;; (dotimes (x ) (org-cycle)) )))))

    Read the article

  • Create a term-document matrix from files

    - by Joe
    I have a set of files from example001.txt to example100.txt. Each file contains a list of keywords from a superset (the superset is available if we want it). So example001.txt might contain apple banana ... otherfruit I'd like to be able to process these files and produce something akin to a matrix so there is the list of examples* on the top row, the fruit down the side, and a '1' in a column if the fruit is in the file. An example might be... x example1 example2 example3 Apple 1 1 0 Babana 0 1 0 Coconut 0 1 1 Any idea how I might build some sort of command-line magic to put this together? I'm on OSX and happy with perl or python...

    Read the article

  • Wireshark Display Filter protocol==TLSV1? (and PacketLength)

    - by NealWalters
    What would the filter expression be to just select the protocols where the protocol = TLSV1? Something obvious like protocol == "TLSV1" or TCP.protocol == "TLSV1" is apparently not the right way. ip.proto == "TLSV1" says "ip.proto cannot accept strings as values" Update - additional tips: Another great but hidden search is on PacketLength: You can add packet length to your display by clicking "Edit Preferences" (menu or icon), and adding the PacketLength as a new column, but to filter on it you have to use the more cryptic: frame.len == ### where ### is your desired number. We were using this to determine how many packets had been sent and/or received, when you filter, the status-bar at the bottom of the screen shows the number of items matching the filter.

    Read the article

  • Hide/Unhide rows based on more than one cell value

    - by Mike
    Please help me I am using the following code to hide rows if cell values are 0: Private Sub Worksheet_Calculate() Dim LastRow As Long, c As Range Application.EnableEvents = False LastRow = Cells(Cells.Rows.Count, "I").End(xlUp).Row On Error Resume Next For Each c In Range("I9:I48") If c.Value = 0 Then c.EntireRow.Hidden = True ElseIf c.Value > 0 Then c.EntireRow.Hidden = False End If Next On Error GoTo 0 Application.EnableEvents = True End Sub It works perfectly, but I would like for the code to also check column K (the same range K9:K48) if both cells in a row are 0 then the row must be hidden. How can I change the code to do this?

    Read the article

  • Thunderbird 3.0 - how to prevent new message indicator from clearing?

    - by Joe Casadonte
    I just installed Thunderbird 3.0 and there are a few things driving me batty. When new email is delivered it has a faint star to the left of the subject (this is different than the new star column thing). In the old days (i.e. last week) the new message indicator wouldn't go away until I read the message or left the folder and returned. Now, as soon as I do anything with any email message, all new message indicators are cleared. How can I go back to the old behavior?

    Read the article

  • excel autocomplete combo-box with on-selection event

    - by IttayD
    I have an excel sheet for groceries. One column is the name, another is whether to buy it or not (checkbox) and another is the amount. I'd like to have a widget in the top row so that I start typing an item's name and it shows a list of matching items that I can select from, or if I continue to type and there's only one item, completes its name. When the last item is selected, other widgets show the amount, which I can edit and clicking 'check' will check the item in the list. I know this is kind of very specific, but am hoping someone can at least get me started. Thank you, Ittay

    Read the article

  • How can I create matrices of data in Excel?

    - by sandeep
    I want to create a 4*4 matrix in excel 2007 by taking three or more columns or conditions for example Column index Row index Name 1 2 x 2 3 y 3 4 z 4 1 p this is how data looks and i want it for 1*1 cell as p and 1*2 cell as x and so on. and I want out put as follows matrix 1 2 3 4 1 p x y z 2 p x y z 3 p x y z 4 p x y z and I have very huge data like this some times the matrix size goes up to 60*60 also.

    Read the article

< Previous Page | 311 312 313 314 315 316 317 318 319 320 321 322  | Next Page >