Search Results

Search found 3646 results on 146 pages for 'escape sequence'.

Page 32/146 | < Previous Page | 28 29 30 31 32 33 34 35 36 37 38 39  | Next Page >

  • How do I edit keyboard preferences from the command line?

    - by jumpnett
    I want to swap the Caps Lock and Escape key as specified in this answer: Use the keyboard preferences to swap Caps Lock and Escape - seriously, how often do you use Caps Lock? Using vim you will be using Escape all the time, and having it available on the home row makes a huge difference. With the standard Ubuntu desktop, go through the menus: System - Preferences - Keyboard - Layouts tab. Then hit the "Layout Options" button, click on the triangle next to "Caps Lock key behaviour" and select "Swap ESC and CapsLock". but, I'm using Ubuntu Server with no gui, so how would I do this from the command line?

    Read the article

  • LINQ - is SkipWhile broken?

    - by Judah Himango
    I'm a bit surprised to find the results of the following code, where I simply want to remove all 3s from a sequence of ints: var sequence = new [] { 1, 1, 2, 3 }; var result = sequence.SkipWhile(i => i == 3); // Oh noes! Returns { 1, 1, 2, 3 } Why isn't 3 skipped? My next thought was, OK, the Except operator will do the trick: var sequence = new [] { 1, 1, 2, 3 }; var result = sequence.Except(i => i == 3); // Oh noes! Returns { 1, 2 } In summary, Except removes the 3, but also removes non-distinct elements. Grr. SkipWhile doesn't skip the last element, even if it matches the condition. Grr. Can someone explain why SkipWhile doesn't skip the last element? And can anyone suggest what LINQ operator I can use to remove the '3' from the sequence above?

    Read the article

  • Traceability with XSD

    - by blastthisinferno
    I am trying to let my XML schema handle a little traceability functionality as I'm gathering requirements while I read through some functional specifications. (Not ideal for requirement management, but at least its a start.) What I'm doing is creating a <functionalSpec tag for each functional specification I am currently reading through. I create a <requirement tag for each requirement I find. Since I want to be able to trace where the requirement came from, I create a <trace element with the id of the <functionalSpec element. Instead of allowing myself to enter any plain-old-text in the <functionalSpecId tag, I want the XSD to validate and make sure that I only enter in an id that exists for an existing functional spec. My problem is coming in where it seems the XML Schema W3C Recommendations documentation says that what I want to do is not possible. (about 1/2 way down) {selector} specifies a restricted XPath ([XPath]) expression relative to instances of the element being declared. This must identify a node set of subordinate elements (i.e. contained within the declared element) to which the constraint applies. I'm using Oxygen to create this since I'm fairly new to XSD files, and it gives me the following error: E [Xerces] Identity Constraint error: identity constraint "KeyRef@1045a2" has a keyref which refers to a key or unique that is out of scope. So my question is does anyone know of a way that will allow me to use the same XML structure that I have below through using XSD? Below is the XML file. <?xml version="1.0" encoding="UTF-8" ?> <srs xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xsi:schemaLocation="srs req2.xsd" xmlns="srs"> <requirements> <requirement DateCreated="2010-06-11" id="1"> <Text>The system shall...</Text> <trace> <functionalSpecId>B010134</functionalSpecId> </trace> <revisions> <revision date="2010-06-11" num="0"> <description>Initial creation.</description> </revision> </revisions> </requirement> </requirements> <functionalSpecs> <functionalSpec id="B010134" model="Model-T"> <trace> <meeting></meeting> </trace> <revisions> <revision date="2009-07-08" num="0"> <description>Initial creation.</description> </revision> <detailer>Me</detailer> <engineer>Me</engineer> </revisions> </functionalSpec> </functionalSpecs> </srs> Below is the XSD file. <?xml version="1.0" encoding="UTF-8" ?> <xs:schema xmlns:xs="http://www.w3.org/2001/XMLSchema" targetNamespace="srs" xmlns="srs" xmlns:srs="srs" elementFormDefault="qualified"> <!-- SRS --> <xs:element name="srs" type="SRSType"> </xs:element> <xs:complexType name="SRSType"> <xs:sequence> <xs:element ref="requirements" /> <xs:element ref="functionalSpecs" /> </xs:sequence> </xs:complexType> <!-- Requirements --> <xs:element name="requirements" type="RequirementsType"> <xs:unique name="requirementId"> <xs:selector xpath="srs/requirements/requirement" /> <xs:field xpath="@id" /> </xs:unique> </xs:element> <xs:complexType name="RequirementsType"> <xs:choice maxOccurs="unbounded"> <xs:element name="requirement" type="RequirementType" /> </xs:choice> </xs:complexType> <xs:complexType name="RequirementType"> <xs:complexContent> <xs:extension base="RequirementInfo"> <xs:sequence> <xs:element name="trace" type="TraceType" maxOccurs="unbounded" minOccurs="1" /> <xs:element name="revisions" type="RequirementRevisions" /> </xs:sequence> </xs:extension> </xs:complexContent> </xs:complexType> <xs:complexType name="RequirementRevisions"> <xs:sequence> <xs:element name="revision" type="RevisionInfo" minOccurs="1" maxOccurs="unbounded" /> </xs:sequence> </xs:complexType> <xs:complexType name="RequirementInfo"> <xs:sequence> <xs:element name="Text" type="Description" /> </xs:sequence> <xs:attribute name="DateCreated" type="xs:date" use="required" /> <xs:attribute name="id" type="xs:integer" use="required" /> </xs:complexType> <!-- Functional Specs --> <xs:element name="functionalSpecs" type="FunctionalSpecsType"> <xs:unique name="functionalSpecId"> <xs:selector xpath="srs/functionalSpecs/functionalSpec" /> <xs:field xpath="@id" /> </xs:unique> </xs:element> <xs:complexType name="FunctionalSpecsType"> <xs:choice maxOccurs="unbounded"> <xs:element name="functionalSpec" type="FunctionalSpecType" /> </xs:choice> </xs:complexType> <xs:complexType name="FunctionalSpecType"> <xs:complexContent> <xs:extension base="FunctionalSpecInfo"> <xs:sequence> <xs:element name="trace" type="TraceType" maxOccurs="unbounded" minOccurs="1" /> <xs:element name="revisions" type="FunctionalSpecRevisions" /> </xs:sequence> </xs:extension> </xs:complexContent> </xs:complexType> <xs:complexType name="FunctionalSpecRevisions"> <xs:sequence> <xs:element name="revision" type="RevisionInfo" minOccurs="1" maxOccurs="unbounded" /> <xs:element name="detailer" type="xs:string" /> <xs:element name="engineer" type="xs:string" /> </xs:sequence> </xs:complexType> <xs:complexType name="FunctionalSpecInfo"> <xs:attribute name="id" type="xs:string" use="required" /> <xs:attribute name="model" type="xs:string" use="required" /> </xs:complexType> <!-- Requirements, Functional Specs --> <xs:complexType name="TraceType"> <xs:choice> <xs:element name="requirementId"> <xs:keyref refer="requirementId" name="requirementIdRef"> <xs:selector xpath="srs/requirements/requirement" /> <xs:field xpath="@id" /> </xs:keyref> </xs:element> <xs:element name="functionalSpecId"> <xs:keyref refer="functionalSpecId" name="functionalSpecIdRef"> <xs:selector xpath="srs/functionalSpecs/functionalSpec" /> <xs:field xpath="@id" /> </xs:keyref> </xs:element> <xs:element name="meeting" /> </xs:choice> </xs:complexType> <!-- Common --> <xs:complexType name="RevisionInfo"> <xs:choice> <xs:element name="description" type="Description" /> </xs:choice> <xs:attribute name="date" type="xs:date" use="required" /> <xs:attribute name="num" type="xs:integer" use="required" /> </xs:complexType> <xs:complexType name="Description" mixed="true"> <xs:simpleContent> <xs:extension base="xs:string"> <xs:attribute name="Date" type="xs:date" /> </xs:extension> </xs:simpleContent> </xs:complexType> </xs:schema>

    Read the article

  • Find three numbers appeared only once

    - by shilk
    In a sequence of length n, where n=2k+3, that is there are k unique numbers appeared twice and three numbers appeared only once. The question is: how to find the three unique numbers that appeared only once? for example, in sequence 1 1 2 6 3 6 5 7 7 the three unique numbers are 2 3 5. Note: 3<=n<1e6 and the number will range from 1 to 2e9 Memory limits: 1000KB , this implies that we can't store the whole sequence. Method I have tried(Memory limit exceed): I initialize a tree, and when read in one number I try to remove it from the tree, if the remove returns false(not found), I add it to the tree. Finally, the tree has the three numbers. It works, but is Memory limit exceed. I know how to find one or two such number(s) using bit manipulation. So I wonder if we can find three using the same method(or some method similar)? Method to find one/two number(s) appeared only once: If there is one number appeared only once, we can apply XOR to the sequence to find it. If there are two, we can first apply XOR to the sequence, then separate the sequence into 2 parts by one bit of the result that is 1, and again apply XOR to the 2 parts, and we will find the answer.

    Read the article

  • conversion of DNA to Protein - c structure issue

    - by sam
    I am working on conversion of DNA sequence to Protein sequence. I had completed all program only one error I found there is of structure. dna_codon is a structure and I am iterating over it.In first iteration it shows proper values of structure but from next iteration, it dont show the proper value stored in structure. Its a small error so do not think that I havnt done anything and downvote. I am stucked here because I am new in c for structures. CODE : #include <stdio.h> #include<string.h> void main() { int i, len; char short_codons[20]; char short_slc[1000]; char sequence[1000]; struct codons { char amino_acid[20], slc[20], dna_codon[40]; }; struct codons c1 [20]= { {"Isoleucine", "I", "ATT, ATC, ATA"}, {"Leucine", "L", "CTT, CTC, CTA, CTG, TTA, TTG"}, {"Valine", "V", "GTT, GTC, GTA, GTG"}, {"Phenylalanine", "F", "TTT, TTC"}, {"Methionine", "M", "ATG"}, {"Cysteine", "C", "TGT, TGC"}, {"Alanine", "A", "GCT, GCC, GCA, GCG"}, {"Proline", "P", "CCT, CCC, CCA,CCG "}, {"Threonine", "T", "ACT, ACC, ACA, ACG"}, {"Serine", "S", "TCT, TCC, TCA, TCG, AGT, AGC"}, {"Tyrosine", "Y", "TAT, TAC"}, {"Tryptophan", "W", "TGG"}, {"Glutamine", "Q", "CAA, CAG"}, {"Aspargine","N" "AAT, AAC"}, {"Histidine", "H", "CAT, CAC"}, {"Glutamic acid", "E", "GAA, GAG"}, {"Aspartic acid", "D", "GAT, GAC"}, {"Lysine", "K", "AAA, AAG"}, {"Arginine", "R", "CGT, CGC, CGA, CGG, AGA, AGG"}, {"Stop codons", "Stop", "AA, TAG, TGA"} }; int count = 0; printf("Enter the sequence: "); gets(sequence); char *input_string = sequence; char *tmp_str = input_string; int k; char *pch; while (*input_string != '\0') { char string_3l[4] = {'\0'}; strncpy(string_3l, input_string, 3); printf("\n-----------%s & %s----------", string_3l, tmp_str ); for(k=0;k<20;k++) { //printf("@REAL - %s", c1[0].dna_codon); printf("@ %s", c1[k].dna_codon); int x; x = c1[k].dna_codon; pch = strtok(x, ","); while (pch != NULL) { printf("\n%d : %s with %s", k, string_3l, pch); count=strcmp(string_3l, pch); if(count==0) { strcat(short_slc, c1[k].slc); printf("\n==>%s", short_slc); } pch = strtok (NULL, " ,.-"); } } input_string = input_string+3; } printf("\nProtien sequence is : %s\n", short_slc); } INPUT : TAGTAG OUTPUT : If you see output of printf("\n-----------%s & %s----------", string_3l, tmp_str ); in both iterations, we found that values defined in structure are reduced. I want to know why structure reduces it or its my mistake? because I am stucked here

    Read the article

  • MySQL server has gone away

    - by user491992
    Hello Friends, I executed this query on my MySql Server and it is giving me "MySQL server has gone away" Error.In following query my both table have more then 1000000 rows. SELECT a_tab_11_10.url as url,a_tab_11_10.c5 as 't1',a_tab_12_10.c3 as 't2' FROM a_tab_11_10 join a_tab_12_10 on (a_tab_11_10.url)=(a_tab_12_10.url) order by (a_tab_11_10.c5-a_tab_12_10.c3) desc limit 10 here is my log file but i am not getting it. Thank you @Faisal for answer and i check my log file but i am not getting it.. 110111 10:19:50 [Note] Plugin 'FEDERATED' is disabled. 110111 10:19:51 InnoDB: Started; log sequence number 0 945537221 110111 10:19:51 [Note] Event Scheduler: Loaded 0 events 110111 10:19:51 [Note] wampmysqld: ready for connections. Version: '5.1.36-community-log' socket: '' port: 3306 MySQL Community Server (GPL) 110111 12:35:42 [Note] wampmysqld: Normal shutdown 110111 12:35:43 [Note] Event Scheduler: Purging the queue. 0 events 110111 12:35:43 InnoDB: Starting shutdown... 110111 12:35:45 InnoDB: Shutdown completed; log sequence number 0 945538624 110111 12:35:45 [Warning] Forcing shutdown of 1 plugins 110111 12:35:45 [Note] wampmysqld: Shutdown complete 110111 12:36:39 [Note] Plugin 'FEDERATED' is disabled. 110111 12:36:40 InnoDB: Started; log sequence number 0 945538624 110111 12:36:40 [Note] Event Scheduler: Loaded 0 events 110111 12:36:40 [Note] wampmysqld: ready for connections. Version: '5.1.36-community-log' socket: '' port: 3306 MySQL Community Server (GPL) 110111 12:36:40 [Note] wampmysqld: Normal shutdown 110111 12:36:40 [Note] Event Scheduler: Purging the queue. 0 events 110111 12:36:40 InnoDB: Starting shutdown... 110111 12:36:42 InnoDB: Shutdown completed; log sequence number 0 945538634 110111 12:36:42 [Warning] Forcing shutdown of 1 plugins 110111 12:36:42 [Note] wampmysqld: Shutdown complete 110111 12:36:52 [Note] Plugin 'FEDERATED' is disabled. 110111 12:36:52 InnoDB: Started; log sequence number 0 945538634 110111 12:36:52 [Note] Event Scheduler: Loaded 0 events 110111 12:36:52 [Note] wampmysqld: ready for connections. Version: '5.1.36-community-log' socket: '' port: 3306 MySQL Community Server (GPL) 110111 12:37:42 [Note] wampmysqld: Normal shutdown 110111 12:37:42 [Note] Event Scheduler: Purging the queue. 0 events 110111 12:37:42 InnoDB: Starting shutdown... 110111 12:37:43 InnoDB: Shutdown completed; log sequence number 0 945538634 110111 12:37:43 [Warning] Forcing shutdown of 1 plugins 110111 12:37:43 [Note] wampmysqld: Shutdown complete 110111 12:37:46 [Note] Plugin 'FEDERATED' is disabled. 110111 12:37:46 InnoDB: Started; log sequence number 0 945538634 110111 12:37:46 [Note] Event Scheduler: Loaded 0 events 110111 12:37:46 [Note] wampmysqld: ready for connections. Version: '5.1.36-community-log' socket: '' port: 3306 MySQL Community Server (GPL)

    Read the article

  • Oracle physical standby database received redo has not been applied

    - by Arthur Aoife
    Hi, I followed the steps in oracle documentation on creation of a physical standby database. The link to the configuration steps, http://download.oracle.com/docs/cd/B28359_01/server.111/b28294/create_ps.htm#i63561 When I perform "Step 4 Verfiy that received redo has been applied." my query result is not as expected, following is the result, SQL SELECT SEQUENCE#,APPLIED FROM V$ARCHIVED_LOG ORDER BY SEQUENCE#; SEQUENCE# APP 5 NO 6 NO 7 NO 8 NO 4 rows selected. Appreciate any advice on how to proceed, thanks.

    Read the article

  • What is the method to reset the Planar 1910m monitor?

    - by Richard J Foster
    My monitor (a Planar, apparently model number PL1910M) is not working. (It is flashing a green / orange sequence which I believe to be an error code. The sequence, in case it helps consists of orange and green three times quickly followed by a longer orange, then another green followed by a long period where both colors appear to be present). I vaguely recall a co-worker suffering from a similar problem, and our IT department "resetting" the monitor by holding down a certain set of keys as they apply power. Unfortunately, I do not remember what that key sequence was, our IT department is not responding, and the Planar web site is blocked by the content filtering firewall we have in place! What is the sequence to perform the reset? (For bonus geek-credit, what does the code mean... as if it indicates a blown component clearly a reset will not help me. ;-))

    Read the article

  • What steps to take when CPAN installation fails?

    - by pythonic metaphor
    I have used CPAN to install perl modules on quite a few occasions, but I've been lucky enough to just have it work. Unfortunately, I was trying to install Thread::Pool today and one of the required dependencies, Thread::Converyor::Monitored failed the test: Test Summary Report ------------------- t/Conveyor-Monitored02.t (Wstat: 65280 Tests: 89 Failed: 0) Non-zero exit status: 255 Parse errors: Tests out of sequence. Found (2) but expected (4) Tests out of sequence. Found (4) but expected (5) Tests out of sequence. Found (5) but expected (6) Tests out of sequence. Found (3) but expected (7) Tests out of sequence. Found (6) but expected (8) Displayed the first 5 of 86 TAP syntax errors. Re-run prove with the -p option to see them all. Files=3, Tests=258, 6 wallclock secs ( 0.07 usr 0.03 sys + 4.04 cusr 1.25 csys = 5.39 CPU) Result: FAIL Failed 1/3 test programs. 0/258 subtests failed. make: *** [test_dynamic] Error 255 ELIZABETH/Thread-Conveyor-Monitored-0.12.tar.gz /usr/bin/make test -- NOT OK //hint// to see the cpan-testers results for installing this module, try: reports ELIZABETH/Thread-Conveyor-Monitored-0.12.tar.gz Running make install make test had returned bad status, won't install without force Failed during this command: ELIZABETH/Thread-Conveyor-Monitored-0.12.tar.gz: make_test NO What steps do you take to start seeing why an installation failed? I'm not even sure how to begin tracking down what's wrong.

    Read the article

  • Shuffling in windows media player

    - by Crazy Buddy
    I think media player has several issues indeed. You see, I'll be hearing songs most of the time using WMP 11 (in WinXP SP3). Today - While I was wasting my time poking some sleepy questions in SE, I also noticed this... My "Now-playing" list contains some 500 mp3s (doesn't matter). I've enabled both Shuffle and Repeat. I play those songs. When I get irritated with some song (say - the 10th song), I change it. Something mysterious happened (happens even now). A sequence of atleast 3 songs (already played before the 10th song) repeat again in the same way following the selected one... Then, I skip those somehow and arrive at another boring song (say now - 20th) and now, the sequence would've increased by about 5 songs (sometimes)... Sometimes, I even notice a specific "sequence of songs" (including the skipped one) repeating again & again. I doubt most guys would've noticed. This makes me ask a question - Why? There are a lot songs in my playlist. Why the same sets of songs? Does WMP really chooses a sequence at start and follows it. Once a change is encountered, it starts the sequence again after several songs. Is it so? Feel free to shoot it down. I don't know whether it's acceptable here. Just curious about it... Note: This is only observed when both shuffle and repeat are enabled. To confirm, I tried it in two other PCs of mine (thereby dumped 2 hours). BTW, I also didn't observe this magic in VLC, Winamp, K-Lite and not even my Nokia cellphone. I think I'm not a good Googler and so, I can't find any such issues :-)

    Read the article

  • What is the method to reset the Planar 1910m monitor?

    - by Richard J Foster
    My monitor (a Planar, apparently model number PL1910M) is not working. (It is flashing a green / orange sequence which I believe to be an error code. The sequence, in case it helps consists of orange and green three times quickly followed by a longer orange, then another green followed by a long period where both colors appear to be present). I vaguely recall a co-worker suffering from a similar problem, and our IT department "resetting" the monitor by holding down a certain set of keys as they apply power. Unfortunately, I do not remember what that key sequence was, our IT department is not responding, and the Planar web site is blocked by the content filtering firewall we have in place! What is the sequence to perform the reset? (For bonus geek-credit, what does the code mean... as if it indicates a blown component clearly a reset will not help me. ;-))

    Read the article

  • Use external display from boot on Samsung laptop

    - by OhMrBigshot
    I have a Samsung RV511 laptop, and recently my screen broke. I connected an external screen and it works fine, but only after Windows starts. I want to be able to use the external screen right from boot, in order to set the BIOS to boot from DVD, and to then install a different OS and also format the hard drive. Right now I can only use the screen when Windows loads. What I've tried: I've tried opening up the laptop and disconnecting the display to make it only find the external and use the VGA as default -- didn't work. I've tried using the Fn+key combo in BIOS to connect external display - nothing I've been looking around for ways to change boot sequence without entering BIOS, but it doesn't look like it's possible. Possible solutions? A way to change boot sequence without entering BIOS? Someone with the same brand/similar model to help me blindly keystroke the correct arrows/F5/F6 buttons while in BIOS mode to change boot sequence? A way to force the external display to work from boot, through modifying the internal connections (I have no problem taking the laptop apart if needed, please no soldering though), through BIOS or program? Also, if I change boot sequence without accessing external screen, would the Ubuntu 12.1 installation sequence attempt to use the external screen or would I only be able to use it after Linux is installed and running? I'd really appreciate help, I can't afford to fix the screen for a few months from now, and I'd really like to make my computer come back to decent performance! Thanks in advance!

    Read the article

  • Convert text to table

    - by Quattro
    I would like convert text into a table. Here is a link to the text http://www.tcdb.org/public/tcdb Short example: >gnl|TC-DB|A0CIB0|1.A.17.3.1 Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1 MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI >gnl|TC-DB|A0CS82|9.B.82.1.5 Chromosome undetermined scaffold_26, whole genome shotgun sequence - Paramecium tetraurelia. MIIEEQIEEKMIYKAIHRVKVNYQKKIDRYILYKKSRWFFNLLLMLLYAYRIQNIGGFYI VTYIYCVYQLQLLIDYFTPLGLPPVNLEDEEEDDDQFQNDFSELPTTLSNKNELNDKEFR PLLRTTSEFKVWQKSVFSVIFAYFCTYIPIWDIPVYWPFLFCYFFVIVGMSIRKYIKHMK KYGYTILDFTKKK I wanted to have columns for example delimited with pipe | or ; |>gnl|TC-DB|A0CIB0|1.A.17.3.1| Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1| MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI I am working with Windows and I don't know how to do it I just know every row starts with > I want to substitute the first whitespace in a row with a delimiter like | or ; after the first regular expression new line in a row, I want also a delimiter everything between the regular expression first new line and > should go into a new column (it's a sequence of a protein)

    Read the article

  • Defining recursive algebraic data types in XML XSD

    - by Ben Challenor
    Imagine I have a recursive algebraic data type like this (Haskell syntax): data Expr = Zero | One | Add Expr Expr | Mul Expr Expr I'd like to represent this in XML, and I'd like an XSD schema for it. I have figured out how to achieve this syntax: <Expr> <Add> <Expr> <Zero/> </Expr> <Expr> <Mul> <Expr> <One/> </Expr> <Expr> <Add> <Expr> <One/> </Expr> <Expr> <One/> </Expr> </Add> </Expr> </Mul> </Expr> </Add> </Expr> with this schema: <xs:complexType name="Expr"> <xs:choice minOccurs="1" maxOccurs="1"> <xs:element minOccurs="1" maxOccurs="1" name="Zero" type="Zero" /> <xs:element minOccurs="1" maxOccurs="1" name="One" type="One" /> <xs:element minOccurs="1" maxOccurs="1" name="Add" type="Add" /> <xs:element minOccurs="1" maxOccurs="1" name="Mul" type="Mul" /> </xs:choice> </xs:complexType> <xs:complexType name="Zero"> <xs:sequence> </xs:sequence> </xs:complexType> <xs:complexType name="One"> <xs:sequence> </xs:sequence> </xs:complexType> <xs:complexType name="Add"> <xs:sequence> <xs:element minOccurs="2" maxOccurs="2" name="Expr" type="Expr" /> </xs:sequence> </xs:complexType> <xs:complexType name="Mul"> <xs:sequence> <xs:element minOccurs="2" maxOccurs="2" name="Expr" type="Expr" /> </xs:sequence> </xs:complexType> But what I really want is this syntax: <Add> <Zero/> <Mul> <One/> <Add> <One/> <One/> </Add> </Mul> </Add> Is this possible? Thanks!

    Read the article

  • DataTable ReadXmlSchema and ReadXml Resulting in error

    - by MasterMax1313
    I'm having some trouble with the ReadXmlSchema and ReadXml methods for a DataTable. I'm getting the error "DataTable does not support schema inference from Xml". Code Snippet: I've tried Table.ReadXmlSchema(new StringReader(File.ReadAllText(XsdFilePath))); Table.ReadXml(new StringReader(File.ReadAllText(XmlFilePath))); And Table.ReadXmlSchema(XsdFilePath); Table.ReadXml(XmlFilePath); Xml Snippet: <ScreenSets> <ScreenSet id="Credit 1"> <Screen xmlFile="sb-credit1.en.xml" tabText="Recommendation" isCached="false"> <Buttons> <Button id="btnClosePresentation"/> </Buttons> </Screen> </ScreenSet> <ScreenSet id="Credit 2"> <Screen xmlFile="sb-credit2.en.xml" tabText="Recommendation" isCached="false"> <Buttons> <Button id="btnClosePresentation"/> </Buttons> </Screen> </ScreenSet> <ScreenSet id="Credit 3"> <Screen xmlFile="sb-credit3.en.xml" tabText="Recommendation" isCached="false"> <Buttons> <Button id="btnClosePresentation"/> </Buttons> </Screen> </ScreenSet> </ScreenSets> Xsd: <?xml version="1.0" encoding="utf-8"?> <xs:schema attributeFormDefault="unqualified" elementFormDefault="qualified" xmlns:xs="http://www.w3.org/2001/XMLSchema"> <xs:element name="ScreenSets"> <xs:complexType> <xs:sequence> <xs:element maxOccurs="unbounded" name="ScreenSet"> <xs:complexType> <xs:sequence> <xs:element name="Screen"> <xs:complexType> <xs:sequence> <xs:element name="Buttons"> <xs:complexType> <xs:sequence> <xs:element maxOccurs="unbounded" name="Button"> <xs:complexType> <xs:attribute name="id" type="xs:string" use="required" /> </xs:complexType> </xs:element> </xs:sequence> </xs:complexType> </xs:element> </xs:sequence> <xs:attribute name="xmlFile" type="xs:string" use="required" /> <xs:attribute name="tabText" type="xs:string" use="required" /> <xs:attribute name="isCached" type="xs:boolean" use="required" /> </xs:complexType> </xs:element> </xs:sequence> <xs:attribute name="id" type="xs:string" use="required" /> </xs:complexType> </xs:element> </xs:sequence> </xs:complexType> </xs:element> </xs:schema>

    Read the article

  • Resolve naming conflict in included XSDs for JAXB compilation

    - by Jason Faust
    I am currently trying to compile with JAXB (IBM build 2.1.3) a pair of schema files into the same package. Each will compile on it's own, but when trying to compile them together i get a element naming conflict due to includes. My question is; is there a way to specify with an external binding a resolution to the naming collision. Example files follow. In the example the offending element is called "Common", which is defined in both incA and incB: incA.xsd <?xml version="1.0" encoding="UTF-8"?> <schema xmlns="http://www.w3.org/2001/XMLSchema" targetNamespace="http://www.example.org/" xmlns:tns="http://www.example.org/" elementFormDefault="qualified"> <complexType name="TypeA"> <sequence> <element name="ElementA" type="string"></element> </sequence> </complexType> <!-- Conflicting element --> <element name="Common" type="tns:TypeA"></element> </schema> incB.xsd <?xml version="1.0" encoding="UTF-8"?> <schema xmlns="http://www.w3.org/2001/XMLSchema" targetNamespace="http://www.example.org/" xmlns:tns="http://www.example.org/" elementFormDefault="qualified"> <complexType name="TypeB"> <sequence> <element name="ElementB" type="int"></element> </sequence> </complexType> <!-- Conflicting element --> <element name="Common" type="tns:TypeB"></element> </schema> A.xsd <?xml version="1.0" encoding="UTF-8"?> <schema targetNamespace="http://www.example.org/" elementFormDefault="qualified" xmlns="http://www.w3.org/2001/XMLSchema" xmlns:tns="http://www.example.org/"> <include schemaLocation="incA.xsd"></include> <complexType name="A"> <sequence> <element ref="tns:Common"></element> </sequence> </complexType> </schema> B.xsd <?xml version="1.0" encoding="UTF-8"?> <schema targetNamespace="http://www.example.org/" elementFormDefault="qualified" xmlns="http://www.w3.org/2001/XMLSchema" xmlns:tns="http://www.example.org/"> <include schemaLocation="incB.xsd"></include> <complexType name="B"> <sequence> <element ref="tns:Common"></element> </sequence> </complexType> </schema> Compiler error when both are compiled from one evocation of xjb: [ERROR] 'Common' is already defined line 9 of file:/C:/temp/incB.xsd [ERROR] (related to above error) the first definition appears here line 9 of file:/C:/temp/incA.xsd (For reference, this is a generalization to resolve an issue with compiling the OAGIS8 SP3 package)

    Read the article

  • Alternate method to dependent, nested if statements to check multiple states

    - by octopusgrabbus
    Is there an easier way to process multiple true/false states than using nested if statements? I think there is, and it would be to create a sequence of states, and then use a function like when to determine if all states were true, and drop out if not. I am asking the question to make sure there is not a preferred Clojure way to do this. Here is the background of my problem: I have an application that depends on quite a few input files. The application depends on .csv data reports; column headers for each report (.csv files also), so each sequence in the sequence of sequences can be zipped together with its columns for the purposes of creating a smaller sequence; and column files for output data. I use the following functions to find out if a file is present: (defn kind [filename] (let [f (File. filename)] (cond (.isFile f) "file" (.isDirectory f) "directory" (.exists f) "other" :else "(cannot be found)" ))) (defn look-for [filename expected-type] (let [find-status (kind-stat filename expected-type)] find-status)) And here are the first few lines of a multiple if which looks ugly and is hard to maintain: (defn extract-re-values "Plain old-fashioned sub-routine to process real-estate values / 3rd Q re bills extract." [opts] (if (= (utl/look-for (:ifm1 opts) "f") 0) ; got re columns? (if (= (utl/look-for (:ifn1 opts) "f") 0) ; got re data? (if (= (utl/look-for (:ifm3 opts) "f") 0) ; got re values output columns? (if (= (utl/look-for (:ifm4 opts) "f") 0) ; got re_mixed_use_ratio columns? (let [re-in-col-nams (first (utl/fetch-csv-data (:ifm1 opts))) re-in-data (utl/fetch-csv-data (:ifn1 opts)) re-val-cols-out (first (utl/fetch-csv-data (:ifm3 opts))) mu-val-cols-out (first (utl/fetch-csv-data (:ifm4 opts))) chk-results (utl/chk-seq-len re-in-col-nams (first re-in-data) re-rec-count)] I am not looking for a discussion of the best way, but what is in Clojure that facilitates solving a problem like this.

    Read the article

  • Must go through Windows Boot Loader to get to Grub

    - by Zach
    I just installed a fresh copy of Precise alongside Windows 7. I have to separate 750GB hard drives; /dev/sda holds the Windows partitions and /dev/sdb holds the Ubuntu partitions. Other than that, these are fresh installs of both Windows 7 and Ubuntu 12.04. Whenever I boot, Grub doesn't load, instead it goes to a black screen with a single blinking (horizontal bar) cursor in the top right corner. However, if I boot, hit escape right as the BIOS/POST screen finishes up, see the Windows Boot Loader and hit escape to make it go back to the BIOS screen. After the BIOS screen, grub shows up and everything functions normally; I can boot into Ubuntu or Win7. I don't want to have to do the Escape, Escape, Wait, Boot trick every time. I have no idea what would be wrong or what information I could give you guys to help diagnose. I have run a sudo update-grub and it found everything normally. I tried adding nomodeset flag in the /etc/default/grub line GRUB_CMDLINE_LINUX_DEFAULT which searching around made me think might work. Thoughts on what I could do to fix this? EDIT: I've tried changing the boot order so that both drives in the BIOS (both are labeled as "Internal HDD") have had a try booting first. I think the problem may be that every time I boot, the BIOS boot order is different... and I have to reset it. It seems to not be stable... but I'm not sure how to go about fixing that either. The machine has both traditional BIOS and UEFI. It came standard in "Legacy" mode; so it is currently set to boot through Legacy mode. I've reinstalled Ubuntu now, and now if I hit escape at the end of the BIOS/POST startup screen, it takes me to GRUB menu. Otherwise it automatically loads Windows. It seems like GRUB is now the acting bootloader, it just doesn't automatically start that unless I ask it to open a bootloader. In my other machines, it has always automatically started at the end of BIOS/POST. EDIT2: Using gparted, I just looked at my partitions, it would seem that my linux-swap partition is currently flagged as the boot partition for my Ubuntu install. I currently only have 2 partitions: one of "ext4" with a mount point of "/" and flag " "; and the "linux-swap" with mount point " " and flag "boot." If I change the boot flag to be on "/," it does not reliably solve the problem. After 10 boots: 2 Booted successfully to GRUB 5 Booted directly to Windows 7 3 booted to the black screen with the cursor and hung there Further research makes me think this is an issue of the BIOS not reliably booting hard drives in the same order or not finding both hard drives. If I ask it to create a "boot menu" sometimes it has 2 entries for "Internal HDD," sometimes 1. Also the list it creates changes order every time I bring it up; so it is not following a consistent boot sequence. Will report back if this is not an issue with GRUB.

    Read the article

  • Sorting Algorithm : output

    - by Aaditya
    I faced this problem on a website and I quite can't understand the output, please help me understand it :- Bogosort, is a dumb algorithm which shuffles the sequence randomly until it is sorted. But here we have tweaked it a little, so that if after the last shuffle several first elements end up in the right places we will fix them and don't shuffle those elements furthermore. We will do the same for the last elements if they are in the right places. For example, if the initial sequence is (3, 5, 1, 6, 4, 2) and after one shuffle we get (1, 2, 5, 4, 3, 6) we will keep 1, 2 and 6 and proceed with sorting (5, 4, 3) using the same algorithm. Calculate the expected amount of shuffles for the improved algorithm to sort the sequence of the first n natural numbers given that no elements are in the right places initially. Input: 2 6 10 Output: 2 1826/189 877318/35343 For each test case output the expected amount of shuffles needed for the improved algorithm to sort the sequence of first n natural numbers in the form of irreducible fractions. I just can't understand the output.

    Read the article

  • TSQL Query: Escaping Special Characters

    - by Abs
    Hello all, I am trying to escape special characters in a TSQL query. I have done this before: SELECT columns FROM table WHERE column LIKE '%\%%' ESCAPE '\' And it has worked. Now I have tried to do this now: UPDATE match SET rule_name='31' ESCAPE '\' But it has failed. I know none of the vlaues have a \ but it should still work. I am guessing its because it needs a LIKE statement but how else can I escape characters that I am adding to a database? In addition, does anyone have a link to all the special characters that should be escaped, I couldn't find any documentation on this! Thanks all for any help

    Read the article

  • how can i convert a .tpl file to a .php file? [closed]

    - by kim
    What do I do?? I am building a site and there is a categories.tpl that I want to go where sitemap.php is. sorry i am brand new to all this. let me try to be more clear.id show you a picture but it is marking it as spam. i have a menu at the top of my site like with any retail site. [About Cart Account and Products]. when you click products it takes to you the sitemap.php file. however i need the content from the categories.tpl to appear instead. (Categories in prestashop is another way of saying products) here is the categories.tpl code: {include file=$tpl_dir./breadcrumb.tpl} {include file=$tpl_dir./errors.tpl} {if $category-id AND $category-active} {$category-name|escape:'htmlall':'UTF-8'} {$nb_products|intval} {if $nb_products1}{l s='products'}{else}{l s='product'}{/if} {if $scenes} <!-- Scenes --> {include file=$tpl_dir./scenes.tpl scenes=$scenes} {else} <!-- Category image --> {if $category->id_image} <img src="{$link->getCatImageLink($category->link_rewrite, $category->id_image, 'category')}" alt="{$category->name|escape:'htmlall':'UTF-8'}" title="{$category->name|escape:'htmlall':'UTF-8'}" id="categoryImage" /> {/if} {/if} {if $category->description} <div class="cat_desc">{$category->description}</div> {/if} {if isset($subcategories)} <!-- Subcategories --> <div id="subcategories"> <h3>{l s='Subcategories'}</h3> <ul class="inline_list"> {foreach from=$subcategories item=subcategory} <li> <a href="{$link->getCategoryLink($subcategory.id_category, $subcategory.link_rewrite)|escape:'htmlall':'UTF-8'}" title="{$subcategory.name|escape:'htmlall':'UTF-8'}"> {if $subcategory.id_image} <img src="{$link->getCatImageLink($subcategory.link_rewrite, $subcategory.id_image, 'medium')}" alt="" /> {else} <img src="{$img_cat_dir}default-medium.jpg" alt="" /> {/if} </a> <br /> <a href="{$link->getCategoryLink($subcategory.id_category, $subcategory.link_rewrite)|escape:'htmlall':'UTF-8'}">{$subcategory.name|escape:'htmlall':'UTF-8'}</a> </li> {/foreach} </ul> <br class="clear"/> </div> {/if} {if $products} {include file=$tpl_dir./product-sort.tpl} {include file=$tpl_dir./product-list.tpl products=$products} {include file=$tpl_dir./pagination.tpl} {elseif !isset($subcategories)} <p class="warning">{l s='There is no product in this category.'}</p> {/if} {elseif $category-id} {l s='This category is currently unavailable.'} {/if} and here is the sitemap.php include(dirname(FILE).'/config/config.inc.php'); include(dirname(FILE).'/header.php'); include(dirname(FILE).'/product-sort.php'); $nbProducts = intval(Product::getNewProducts(intval($cookie-id_lang), isset($p) ? intval($p) - 1 : NULL, isset($n) ? intval($n) : NULL, true)); include(dirname(FILE).'/pagination.php'); $smarty-assign(array( 'products' = Product::getNewProducts(intval($cookie-id_lang), intval($p) - 1, intval($n), false, $orderBy, $orderWay), 'nbProducts' = intval($nbProducts))); $smarty-display(_PS_THEME_DIR_.'new-products.tpl'); include(dirname(FILE).'/footer.php'); ?

    Read the article

  • Is JSON.stringify() reliable for serializing JSON objects?

    - by Colin
    I need to send full objects from Javascript to PHP. It seemed pretty obvious to do JSON.stringify() and then json_decode() on the PHP end, but will this allow for strings with ":" and ","? Do I need to run an escape() function on big user input strings that may cause an issue? What would that escape function be? I don't think escape works for my purposes. Are there any downsides to JSON.stringify() I need to know about? Thanks

    Read the article

  • Is str.replace(..).replace(..) ad nauseam a standard idiom in Python?

    - by meeselet
    For instance, say I wanted a function to escape a string for use in HTML (as in Django's escape filter): def escape(string): """ Returns the given string with ampersands, quotes and angle brackets encoded. """ return string.replace('&', '&amp;').replace('<', '&lt;').replace('>', '&gt;').replace("'", '&#39;').replace('"', '&quot;') This works, but it gets ugly quickly and appears to have poor algorithmic performance (in this example, the string is repeatedly traversed 5 times). What would be better is something like this: def escape(string): """ Returns the given string with ampersands, quotes and angle brackets encoded. """ # Note that ampersands must be escaped first; the rest can be escaped in # any order. return replace_multi(string.replace('&', '&amp;'), {'<': '&lt;', '>': '&gt;', "'": '&#39;', '"': '&quot;'}) Does such a function exist, or is the standard Python idiom to use what I wrote before?

    Read the article

  • mysql query not running correctly from inside the application

    - by Mala
    I am completely stumped. Here is my php (CodeIgniter) code: function mod() { $uid = $this->session->userdata('uid'); $pid = $this->input->post('pid'); if ($this->_verify($uid,$pid)) { $name = $this->input->post('name'); $price = $this->input->post('price'); $curr = $this->input->post('curr'); $url = $this->input->post('url'); $query = $this->db->query("UPDATE items SET name=".$this->db->escape($name).", price=".$this->db->escape($price).", currency=".$this->db->escape($curr),", url=".$this->db->escape($url)." WHERE pid=".$this->db->escape($pid)." LIMIT 1"); } header('location: '.$this->session->userdata('current')); } The purpose of this code is to modify the properties (name, price, currency, url) of a row in the 'items' table (priary key is pid). However, for some reason, allowing this function to run once modifies the name, price, currency and url of ALL entries in the table, regardless of their pid and of the LIMIT 1 thing I tacked on the end of the query. It's as if the last line of the query is being completely ignored. As if this wasn't strance enough, I replaced "$query = $this->db->query(" with an "echo" to see the SQL query being run, and it outputs a query much like I would expect: UPDATE items SET name='newname', price='newprice', currency='newcurrency', url='newurl' WHERE pid='10' LIMIT 1 Copy-pasting this into a MySQL window acts exactly as I want: it modifies the row with the selected pid. What is going on here???

    Read the article

< Previous Page | 28 29 30 31 32 33 34 35 36 37 38 39  | Next Page >