Search Results

Search found 3479 results on 140 pages for 'sequence diagram'.

Page 32/140 | < Previous Page | 28 29 30 31 32 33 34 35 36 37 38 39  | Next Page >

  • Technique to Solve Hard Programming logic

    - by Paresh Mayani
    I have heard about many techniques which are used by developer/software manager to solve hard programming logic or to create flow of an application and this flow will be implemented by developers to create an actual application. Some of the technique which i know, are: Flowchart Screen-Layout Data Flow Diagram E-R Diagram Algorithm of every programs I'd like to know about two facts: (1) Are there any techniques other than this ? (2) Which one is the most suitable to solve hard programming logic and process of application creation?

    Read the article

  • Windows Azure Service Bus Splitter and Aggregator

    - by Alan Smith
    This article will cover basic implementations of the Splitter and Aggregator patterns using the Windows Azure Service Bus. The content will be included in the next release of the “Windows Azure Service Bus Developer Guide”, along with some other patterns I am working on. I’ve taken the pattern descriptions from the book “Enterprise Integration Patterns” by Gregor Hohpe. I bought a copy of the book in 2004, and recently dusted it off when I started to look at implementing the patterns on the Windows Azure Service Bus. Gregor has also presented an session in 2011 “Enterprise Integration Patterns: Past, Present and Future” which is well worth a look. I’ll be covering more patterns in the coming weeks, I’m currently working on Wire-Tap and Scatter-Gather. There will no doubt be a section on implementing these patterns in my “SOA, Connectivity and Integration using the Windows Azure Service Bus” course. There are a number of scenarios where a message needs to be divided into a number of sub messages, and also where a number of sub messages need to be combined to form one message. The splitter and aggregator patterns provide a definition of how this can be achieved. This section will focus on the implementation of basic splitter and aggregator patens using the Windows Azure Service Bus direct programming model. In BizTalk Server receive pipelines are typically used to implement the splitter patterns, with sequential convoy orchestrations often used to aggregate messages. In the current release of the Service Bus, there is no functionality in the direct programming model that implements these patterns, so it is up to the developer to implement them in the applications that send and receive messages. Splitter A message splitter takes a message and spits the message into a number of sub messages. As there are different scenarios for how a message can be split into sub messages, message splitters are implemented using different algorithms. The Enterprise Integration Patterns book describes the splatter pattern as follows: How can we process a message if it contains multiple elements, each of which may have to be processed in a different way? Use a Splitter to break out the composite message into a series of individual messages, each containing data related to one item. The Enterprise Integration Patterns website provides a description of the Splitter pattern here. In some scenarios a batch message could be split into the sub messages that are contained in the batch. The splitting of a message could be based on the message type of sub-message, or the trading partner that the sub message is to be sent to. Aggregator An aggregator takes a stream or related messages and combines them together to form one message. The Enterprise Integration Patterns book describes the aggregator pattern as follows: How do we combine the results of individual, but related messages so that they can be processed as a whole? Use a stateful filter, an Aggregator, to collect and store individual messages until a complete set of related messages has been received. Then, the Aggregator publishes a single message distilled from the individual messages. The Enterprise Integration Patterns website provides a description of the Aggregator pattern here. A common example of the need for an aggregator is in scenarios where a stream of messages needs to be combined into a daily batch to be sent to a legacy line-of-business application. The BizTalk Server EDI functionality provides support for batching messages in this way using a sequential convoy orchestration. Scenario The scenario for this implementation of the splitter and aggregator patterns is the sending and receiving of large messages using a Service Bus queue. In the current release, the Windows Azure Service Bus currently supports a maximum message size of 256 KB, with a maximum header size of 64 KB. This leaves a safe maximum body size of 192 KB. The BrokeredMessage class will support messages larger than 256 KB; in fact the Size property is of type long, implying that very large messages may be supported at some point in the future. The 256 KB size restriction is set in the service bus components that are deployed in the Windows Azure data centers. One of the ways of working around this size restriction is to split large messages into a sequence of smaller sub messages in the sending application, send them via a queue, and then reassemble them in the receiving application. This scenario will be used to demonstrate the pattern implementations. Implementation The splitter and aggregator will be used to provide functionality to send and receive large messages over the Windows Azure Service Bus. In order to make the implementations generic and reusable they will be implemented as a class library. The splitter will be implemented in the LargeMessageSender class and the aggregator in the LargeMessageReceiver class. A class diagram showing the two classes is shown below. Implementing the Splitter The splitter will take a large brokered message, and split the messages into a sequence of smaller sub-messages that can be transmitted over the service bus messaging entities. The LargeMessageSender class provides a Send method that takes a large brokered message as a parameter. The implementation of the class is shown below; console output has been added to provide details of the splitting operation. public class LargeMessageSender {     private static int SubMessageBodySize = 192 * 1024;     private QueueClient m_QueueClient;       public LargeMessageSender(QueueClient queueClient)     {         m_QueueClient = queueClient;     }       public void Send(BrokeredMessage message)     {         // Calculate the number of sub messages required.         long messageBodySize = message.Size;         int nrSubMessages = (int)(messageBodySize / SubMessageBodySize);         if (messageBodySize % SubMessageBodySize != 0)         {             nrSubMessages++;         }           // Create a unique session Id.         string sessionId = Guid.NewGuid().ToString();         Console.WriteLine("Message session Id: " + sessionId);         Console.Write("Sending {0} sub-messages", nrSubMessages);           Stream bodyStream = message.GetBody<Stream>();         for (int streamOffest = 0; streamOffest < messageBodySize;             streamOffest += SubMessageBodySize)         {                                     // Get the stream chunk from the large message             long arraySize = (messageBodySize - streamOffest) > SubMessageBodySize                 ? SubMessageBodySize : messageBodySize - streamOffest;             byte[] subMessageBytes = new byte[arraySize];             int result = bodyStream.Read(subMessageBytes, 0, (int)arraySize);             MemoryStream subMessageStream = new MemoryStream(subMessageBytes);               // Create a new message             BrokeredMessage subMessage = new BrokeredMessage(subMessageStream, true);             subMessage.SessionId = sessionId;               // Send the message             m_QueueClient.Send(subMessage);             Console.Write(".");         }         Console.WriteLine("Done!");     }} The LargeMessageSender class is initialized with a QueueClient that is created by the sending application. When the large message is sent, the number of sub messages is calculated based on the size of the body of the large message. A unique session Id is created to allow the sub messages to be sent as a message session, this session Id will be used for correlation in the aggregator. A for loop in then used to create the sequence of sub messages by creating chunks of data from the stream of the large message. The sub messages are then sent to the queue using the QueueClient. As sessions are used to correlate the messages, the queue used for message exchange must be created with the RequiresSession property set to true. Implementing the Aggregator The aggregator will receive the sub messages in the message session that was created by the splitter, and combine them to form a single, large message. The aggregator is implemented in the LargeMessageReceiver class, with a Receive method that returns a BrokeredMessage. The implementation of the class is shown below; console output has been added to provide details of the splitting operation.   public class LargeMessageReceiver {     private QueueClient m_QueueClient;       public LargeMessageReceiver(QueueClient queueClient)     {         m_QueueClient = queueClient;     }       public BrokeredMessage Receive()     {         // Create a memory stream to store the large message body.         MemoryStream largeMessageStream = new MemoryStream();           // Accept a message session from the queue.         MessageSession session = m_QueueClient.AcceptMessageSession();         Console.WriteLine("Message session Id: " + session.SessionId);         Console.Write("Receiving sub messages");           while (true)         {             // Receive a sub message             BrokeredMessage subMessage = session.Receive(TimeSpan.FromSeconds(5));               if (subMessage != null)             {                 // Copy the sub message body to the large message stream.                 Stream subMessageStream = subMessage.GetBody<Stream>();                 subMessageStream.CopyTo(largeMessageStream);                   // Mark the message as complete.                 subMessage.Complete();                 Console.Write(".");             }             else             {                 // The last message in the sequence is our completeness criteria.                 Console.WriteLine("Done!");                 break;             }         }                     // Create an aggregated message from the large message stream.         BrokeredMessage largeMessage = new BrokeredMessage(largeMessageStream, true);         return largeMessage;     } }   The LargeMessageReceiver initialized using a QueueClient that is created by the receiving application. The receive method creates a memory stream that will be used to aggregate the large message body. The AcceptMessageSession method on the QueueClient is then called, which will wait for the first message in a message session to become available on the queue. As the AcceptMessageSession can throw a timeout exception if no message is available on the queue after 60 seconds, a real-world implementation should handle this accordingly. Once the message session as accepted, the sub messages in the session are received, and their message body streams copied to the memory stream. Once all the messages have been received, the memory stream is used to create a large message, that is then returned to the receiving application. Testing the Implementation The splitter and aggregator are tested by creating a message sender and message receiver application. The payload for the large message will be one of the webcast video files from http://www.cloudcasts.net/, the file size is 9,697 KB, well over the 256 KB threshold imposed by the Service Bus. As the splitter and aggregator are implemented in a separate class library, the code used in the sender and receiver console is fairly basic. The implementation of the main method of the sending application is shown below.   static void Main(string[] args) {     // Create a token provider with the relevant credentials.     TokenProvider credentials =         TokenProvider.CreateSharedSecretTokenProvider         (AccountDetails.Name, AccountDetails.Key);       // Create a URI for the serivce bus.     Uri serviceBusUri = ServiceBusEnvironment.CreateServiceUri         ("sb", AccountDetails.Namespace, string.Empty);       // Create the MessagingFactory     MessagingFactory factory = MessagingFactory.Create(serviceBusUri, credentials);       // Use the MessagingFactory to create a queue client     QueueClient queueClient = factory.CreateQueueClient(AccountDetails.QueueName);       // Open the input file.     FileStream fileStream = new FileStream(AccountDetails.TestFile, FileMode.Open);       // Create a BrokeredMessage for the file.     BrokeredMessage largeMessage = new BrokeredMessage(fileStream, true);       Console.WriteLine("Sending: " + AccountDetails.TestFile);     Console.WriteLine("Message body size: " + largeMessage.Size);     Console.WriteLine();         // Send the message with a LargeMessageSender     LargeMessageSender sender = new LargeMessageSender(queueClient);     sender.Send(largeMessage);       // Close the messaging facory.     factory.Close();  } The implementation of the main method of the receiving application is shown below. static void Main(string[] args) {       // Create a token provider with the relevant credentials.     TokenProvider credentials =         TokenProvider.CreateSharedSecretTokenProvider         (AccountDetails.Name, AccountDetails.Key);       // Create a URI for the serivce bus.     Uri serviceBusUri = ServiceBusEnvironment.CreateServiceUri         ("sb", AccountDetails.Namespace, string.Empty);       // Create the MessagingFactory     MessagingFactory factory = MessagingFactory.Create(serviceBusUri, credentials);       // Use the MessagingFactory to create a queue client     QueueClient queueClient = factory.CreateQueueClient(AccountDetails.QueueName);       // Create a LargeMessageReceiver and receive the message.     LargeMessageReceiver receiver = new LargeMessageReceiver(queueClient);     BrokeredMessage largeMessage = receiver.Receive();       Console.WriteLine("Received message");     Console.WriteLine("Message body size: " + largeMessage.Size);       string testFile = AccountDetails.TestFile.Replace(@"\In\", @"\Out\");     Console.WriteLine("Saving file: " + testFile);       // Save the message body as a file.     Stream largeMessageStream = largeMessage.GetBody<Stream>();     largeMessageStream.Seek(0, SeekOrigin.Begin);     FileStream fileOut = new FileStream(testFile, FileMode.Create);     largeMessageStream.CopyTo(fileOut);     fileOut.Close();       Console.WriteLine("Done!"); } In order to test the application, the sending application is executed, which will use the LargeMessageSender class to split the message and place it on the queue. The output of the sender console is shown below. The console shows that the body size of the large message was 9,929,365 bytes, and the message was sent as a sequence of 51 sub messages. When the receiving application is executed the results are shown below. The console application shows that the aggregator has received the 51 messages from the message sequence that was creating in the sending application. The messages have been aggregated to form a massage with a body of 9,929,365 bytes, which is the same as the original large message. The message body is then saved as a file. Improvements to the Implementation The splitter and aggregator patterns in this implementation were created in order to show the usage of the patterns in a demo, which they do quite well. When implementing these patterns in a real-world scenario there are a number of improvements that could be made to the design. Copying Message Header Properties When sending a large message using these classes, it would be great if the message header properties in the message that was received were copied from the message that was sent. The sending application may well add information to the message context that will be required in the receiving application. When the sub messages are created in the splitter, the header properties in the first message could be set to the values in the original large message. The aggregator could then used the values from this first sub message to set the properties in the message header of the large message during the aggregation process. Using Asynchronous Methods The current implementation uses the synchronous send and receive methods of the QueueClient class. It would be much more performant to use the asynchronous methods, however doing so may well affect the sequence in which the sub messages are enqueued, which would require the implementation of a resequencer in the aggregator to restore the correct message sequence. Handling Exceptions In order to keep the code readable no exception handling was added to the implementations. In a real-world scenario exceptions should be handled accordingly.

    Read the article

  • MySQL died during the night on a 12.04.1 Ubuntu

    - by Olivier
    I can't explain why, but somehow during the night, one of my MySQL running on an Ubuntu 12.04.1 box broke. The service is running but I can't login anymore (to SQL), the previous password is not working anymore. It does not looks like the server has been compromised (nothing in /var/auth.log) It looks like some automatic security upgrade (server is configured to perform those) has occured and broke something. The MySQL server has restarted a couple of times in the logs at the time errors started to happen (I get email when CRON task fail). In the logs it complains about an unset root password (I do have cron job running all day using SQL so the password was set & working for months). Anyway I can't login without password either! Do you have any idea of what could have happened? How do I get my databases back? This line looks strange : Nov 6 06:36:12 ns398758 mysqld_safe[6676]: ERROR: 1064 You have an error in your SQL syntax; check the manual that corresponds to your MySQL server version for the right syntax to use near 'ALTER TABLE user ADD column Show_view_priv enum('N','Y') CHARACTER SET utf8 NOT ' at line 1 Here is the full log below : Nov 6 06:36:06 ns398758 mysqld_safe[6586]: Nov 6 06:36:06 ns398758 mysqld_safe[6586]: PLEASE REMEMBER TO SET A PASSWORD FOR THE MySQL root USER ! Nov 6 06:36:06 ns398758 mysqld_safe[6586]: To do so, start the server, then issue the following commands: Nov 6 06:36:06 ns398758 mysqld_safe[6586]: Nov 6 06:36:06 ns398758 mysqld_safe[6586]: /usr/bin/mysqladmin -u root password 'new-password' Nov 6 06:36:06 ns398758 mysqld_safe[6586]: /usr/bin/mysqladmin -u root -h ns398758.ovh.net password 'new-password' Nov 6 06:36:06 ns398758 mysqld_safe[6586]: Nov 6 06:36:06 ns398758 mysqld_safe[6586]: Alternatively you can run: Nov 6 06:36:06 ns398758 mysqld_safe[6586]: /usr/bin/mysql_secure_installation Nov 6 06:36:06 ns398758 mysqld_safe[6586]: Nov 6 06:36:06 ns398758 mysqld_safe[6586]: which will also give you the option of removing the test Nov 6 06:36:06 ns398758 mysqld_safe[6586]: databases and anonymous user created by default. This is Nov 6 06:36:06 ns398758 mysqld_safe[6586]: strongly recommended for production servers. Nov 6 06:36:06 ns398758 mysqld_safe[6586]: Nov 6 06:36:06 ns398758 mysqld_safe[6586]: See the manual for more instructions. Nov 6 06:36:06 ns398758 mysqld_safe[6586]: Nov 6 06:36:06 ns398758 mysqld_safe[6586]: Please report any problems with the /usr/scripts/mysqlbug script! Nov 6 06:36:06 ns398758 mysqld_safe[6586]: Nov 6 06:36:06 ns398758 mysqld_safe[6632]: 121106 6:36:06 [Note] Plugin 'FEDERATED' is disabled. Nov 6 06:36:06 ns398758 mysqld_safe[6632]: 121106 6:36:06 InnoDB: The InnoDB memory heap is disabled Nov 6 06:36:06 ns398758 mysqld_safe[6632]: 121106 6:36:06 InnoDB: Mutexes and rw_locks use GCC atomic builtins Nov 6 06:36:06 ns398758 mysqld_safe[6632]: 121106 6:36:06 InnoDB: Compressed tables use zlib 1.2.3.4 Nov 6 06:36:06 ns398758 mysqld_safe[6632]: 121106 6:36:06 InnoDB: Initializing buffer pool, size = 128.0M Nov 6 06:36:06 ns398758 mysqld_safe[6632]: 121106 6:36:06 InnoDB: Completed initialization of buffer pool Nov 6 06:36:06 ns398758 mysqld_safe[6632]: 121106 6:36:06 InnoDB: highest supported file format is Barracuda. Nov 6 06:36:07 ns398758 mysqld_safe[6632]: 121106 6:36:07 InnoDB: Waiting for the background threads to start Nov 6 06:36:08 ns398758 mysqld_safe[6632]: 121106 6:36:08 InnoDB: 1.1.8 started; log sequence number 29276459701 Nov 6 06:36:08 ns398758 mysqld_safe[6632]: 121106 6:36:08 InnoDB: Starting shutdown... Nov 6 06:36:09 ns398758 mysqld_safe[6632]: 121106 6:36:09 InnoDB: Shutdown completed; log sequence number 29276459701 Nov 6 06:36:11 ns398758 mysqld_safe[6676]: 121106 6:36:11 [Note] Plugin 'FEDERATED' is disabled. Nov 6 06:36:11 ns398758 mysqld_safe[6676]: 121106 6:36:11 InnoDB: The InnoDB memory heap is disabled Nov 6 06:36:11 ns398758 mysqld_safe[6676]: 121106 6:36:11 InnoDB: Mutexes and rw_locks use GCC atomic builtins Nov 6 06:36:11 ns398758 mysqld_safe[6676]: 121106 6:36:11 InnoDB: Compressed tables use zlib 1.2.3.4 Nov 6 06:36:11 ns398758 mysqld_safe[6676]: 121106 6:36:11 InnoDB: Initializing buffer pool, size = 128.0M Nov 6 06:36:11 ns398758 mysqld_safe[6676]: 121106 6:36:11 InnoDB: Completed initialization of buffer pool Nov 6 06:36:11 ns398758 mysqld_safe[6676]: 121106 6:36:11 InnoDB: highest supported file format is Barracuda. Nov 6 06:36:11 ns398758 mysqld_safe[6676]: 121106 6:36:11 InnoDB: Waiting for the background threads to start Nov 6 06:36:12 ns398758 mysqld_safe[6676]: 121106 6:36:12 InnoDB: 1.1.8 started; log sequence number 29276459701 Nov 6 06:36:12 ns398758 mysqld_safe[6676]: ERROR: 1064 You have an error in your SQL syntax; check the manual that corresponds to your MySQL server version for the right syntax to use near 'ALTER TABLE user ADD column Show_view_priv enum('N','Y') CHARACTER SET utf8 NOT ' at line 1 Nov 6 06:36:12 ns398758 mysqld_safe[6676]: 121106 6:36:12 [ERROR] Aborting Nov 6 06:36:12 ns398758 mysqld_safe[6676]: Nov 6 06:36:12 ns398758 mysqld_safe[6676]: 121106 6:36:12 InnoDB: Starting shutdown... Nov 6 06:36:13 ns398758 mysqld_safe[6676]: 121106 6:36:13 InnoDB: Shutdown completed; log sequence number 29276459701 Nov 6 06:36:13 ns398758 mysqld_safe[6676]: 121106 6:36:13 [Note] /usr/sbin/mysqld: Shutdown complete Nov 6 06:36:13 ns398758 mysqld_safe[6676]: Nov 6 06:36:13 ns398758 mysqld_safe[6697]: 121106 6:36:13 [Note] Plugin 'FEDERATED' is disabled. Nov 6 06:36:13 ns398758 mysqld_safe[6697]: 121106 6:36:13 InnoDB: The InnoDB memory heap is disabled Nov 6 06:36:13 ns398758 mysqld_safe[6697]: 121106 6:36:13 InnoDB: Mutexes and rw_locks use GCC atomic builtins Nov 6 06:36:13 ns398758 mysqld_safe[6697]: 121106 6:36:13 InnoDB: Compressed tables use zlib 1.2.3.4 Nov 6 06:36:13 ns398758 mysqld_safe[6697]: 121106 6:36:13 InnoDB: Initializing buffer pool, size = 128.0M Nov 6 06:36:13 ns398758 mysqld_safe[6697]: 121106 6:36:13 InnoDB: Completed initialization of buffer pool Nov 6 06:36:13 ns398758 mysqld_safe[6697]: 121106 6:36:13 InnoDB: highest supported file format is Barracuda. Nov 6 06:36:13 ns398758 mysqld_safe[6697]: 121106 6:36:13 InnoDB: Waiting for the background threads to start Nov 6 06:36:14 ns398758 mysqld_safe[6697]: 121106 6:36:14 InnoDB: 1.1.8 started; log sequence number 29276459701 Nov 6 06:36:14 ns398758 mysqld_safe[6697]: 121106 6:36:14 InnoDB: Starting shutdown... Nov 6 06:36:15 ns398758 mysqld_safe[6697]: 121106 6:36:15 InnoDB: Shutdown completed; log sequence number 29276459701 Nov 6 06:36:15 ns398758 mysqld_safe[6718]: 121106 6:36:15 [Note] Plugin 'FEDERATED' is disabled. Nov 6 06:36:15 ns398758 mysqld_safe[6718]: 121106 6:36:15 InnoDB: The InnoDB memory heap is disabled Nov 6 06:36:15 ns398758 mysqld_safe[6718]: 121106 6:36:15 InnoDB: Mutexes and rw_locks use GCC atomic builtins Nov 6 06:36:15 ns398758 mysqld_safe[6718]: 121106 6:36:15 InnoDB: Compressed tables use zlib 1.2.3.4 Nov 6 06:36:15 ns398758 mysqld_safe[6718]: 121106 6:36:15 InnoDB: Initializing buffer pool, size = 128.0M Nov 6 06:36:15 ns398758 mysqld_safe[6718]: 121106 6:36:15 InnoDB: Completed initialization of buffer pool Nov 6 06:36:15 ns398758 mysqld_safe[6718]: 121106 6:36:15 InnoDB: highest supported file format is Barracuda. Nov 6 06:36:15 ns398758 mysqld_safe[6718]: 121106 6:36:15 InnoDB: Waiting for the background threads to start Nov 6 06:36:16 ns398758 mysqld_safe[6718]: 121106 6:36:16 InnoDB: 1.1.8 started; log sequence number 29276459701 Nov 6 06:36:16 ns398758 mysqld_safe[6718]: ERROR: 1050 Table 'plugin' already exists Nov 6 06:36:16 ns398758 mysqld_safe[6718]: 121106 6:36:16 [ERROR] Aborting Nov 6 06:36:16 ns398758 mysqld_safe[6718]: Nov 6 06:36:16 ns398758 mysqld_safe[6718]: 121106 6:36:16 InnoDB: Starting shutdown... Nov 6 06:36:17 ns398758 mysqld_safe[6718]: 121106 6:36:17 InnoDB: Shutdown completed; log sequence number 29276459701 Nov 6 06:36:17 ns398758 mysqld_safe[6718]: 121106 6:36:17 [Note] /usr/sbin/mysqld: Shutdown complete Nov 6 06:36:17 ns398758 mysqld_safe[6718]: Nov 6 06:36:19 ns398758 /etc/mysql/debian-start[6816]: Upgrading MySQL tables if necessary. Nov 6 06:36:20 ns398758 /etc/mysql/debian-start[6819]: /usr/bin/mysql_upgrade: the '--basedir' option is always ignored Nov 6 06:36:20 ns398758 /etc/mysql/debian-start[6819]: Looking for 'mysql' as: /usr/bin/mysql Nov 6 06:36:20 ns398758 /etc/mysql/debian-start[6819]: Looking for 'mysqlcheck' as: /usr/bin/mysqlcheck Nov 6 06:36:20 ns398758 /etc/mysql/debian-start[6819]: Running 'mysqlcheck' with connection arguments: '--port=3306' '--socket=/var/run/mysqld/mysqld.sock' '--host=localhost' '--socket=/var/run/mysqld/mysqld.sock' '--host=localhost' '--socket=/var/run/mysqld/mysqld.sock' Nov 6 06:36:20 ns398758 /etc/mysql/debian-start[6819]: Running 'mysqlcheck' with connection arguments: '--port=3306' '--socket=/var/run/mysqld/mysqld.sock' '--host=localhost' '--socket=/var/run/mysqld/mysqld.sock' '--host=localhost' '--socket=/var/run/mysqld/mysqld.sock' Nov 6 06:36:20 ns398758 /etc/mysql/debian-start[6819]: col_digitas.acos OK Nov 6 06:36:20 ns398758 /etc/mysql/debian-start[6819]: col_digitas.aros OK ...

    Read the article

  • InstallShield-2009: Basic MSI: How to run a custom action after user cancels uninstall (rollback)

    - by Samir
    InstallShield-2009 Premier: Basic msi project: What to do when I want a custom action to run when user clicks cancel button during uninstall? I put a custom action (a C# exe which would just show a message box) with Action Type: Type: Launch an executable Location: Stored in the Binary table Action Parameters: Source: exe path Target: a b c (doesn't matter, I don't need it) Additional Options: Return Processing: Synchronous (Check exit code) Run Only During Path Uninstall: unchecked Respond Options: In-Script Execution: Rollback Execution in System Context Executing Scheduling: disabled Insert into Sequence: Install UI-Sequence: <Absent from sequence> Install Execute Sequence: After InstallServices (what should I set here?) Install Execute Condition: (do I need to set? I left it blank) but it didn't fire the message box when I canceled the uninstall. How?

    Read the article

  • PHP SOAP error: Method element needs to belong to the namespace

    - by kdm
    I'm unable to retrieve data from an XML document, any help is greatly appreciated. I'm using PHP 5.2.10 and the WSDL url is an internal link within my company. The following code produces an error. $url = "http://dta-info/IVR/IVRINFO?WSDL"; $params = array("zANI" => "12345"); try{ $client = new SoapClient($url, array( 'trace' => 1, 'connection_timeout' => 2, 'location' => $url ) ); }catch(SoapFault $fault){ echo "faultstring: {$fault->faultstring})\n"; } try{ $result = $client->GetIVRinfo($params); }catch(SoapFault $fault){ echo "(faultcode: {$fault->faultcode}, faultstring: {$fault->faultstring} )\n"; } (faultcode: SOAP-ENV:Client, faultstring: There should be no path or parameters after a SOAP vname. ) So i tried to use a non-wsdl mode but i receive a different error no matter how i try to format the params. $url = "http://dta-info/IVR/IVRINFO"; $params = array("zANI" => "12345"); try{ $client = new SoapClient(null, array( 'trace' => 1, 'connection_timeout' => 2, 'location' => $url, 'uri' => $uri, 'style' => SOAP_DOCUMENT, 'use' => SOAP_LITERAL, 'soap_version' => SOAP_2 ) ); }catch(SoapFault $fault){ echo "faultstring: {$fault->faultstring})\n"; } try{ $result = $client->GetIVRinfo($params); }catch(SoapFault $fault){ echo "(faultcode: {$fault->faultcode}, faultstring: {$fault->faultstring} )\n"; } (faultcode: SOAP-ENV:Client, faultstring: The method element needs to belong to the namespace 'http://GETIVRINFO/IVR/IVRINFO'. ) I have tested this WSDL with a tool called SoapUI and it returns the results with no errors. So it leads me to believe I'm not formatting the vars or headers correctly with PHP. I also tried passing in a xml fragment as the param but that returns the same error. What am i doing wrong?????? $params = '<soapenv:Envelope xmlns:soapenv="http://schemas.xmlsoap.org/soap/envelope/" xmlns:ivr="http://GETIVRINFO/IVR/IVRINFO"> <soapenv:Header/> <soapenv:Body> <ivr:GetIVRinfo> <!--Optional:--> <ivr:zANI>12345</ivr:zANI> </ivr:GetIVRinfo> </soapenv:Body> </soapenv:Envelope>'; Here is the WSDL document: <?xml version="1.0"?><wsdl:definitions name="IVR" targetNamespace="http://GETIVRINFO/IVR/IVRINFO" xmlns:tns="http://GETIVRINFO/IVR/IVRINFO" xmlns:xsd="http://www.w3.org/2001/XMLSchema" xmlns:wsdl="http://schemas.xmlsoap.org/wsdl/" xmlns:soap="http://schemas.xmlsoap.org/wsdl/soap/" xmlns:sql="http://schemas.microsoft.com/SQLServer/2001/12/SOAP" xmlns:sqltypes="http://schemas.microsoft.com/SQLServer/2001/12/SOAP/types" xmlns:sqlmessage="http://schemas.microsoft.com/SQLServer/2001/12/SOAP/types/SqlMessage" xmlns:sqlresultstream="http://schemas.microsoft.com/SQLServer/2001/12/SOAP/types/SqlResultStream"> <wsdl:types><xsd:schema targetNamespace='http://schemas.microsoft.com/SQLServer/2001/12/SOAP/types' elementFormDefault='qualified' attributeFormDefault='qualified'> <xsd:import namespace='http://www.w3.org/2001/XMLSchema'/> <xsd:simpleType name='nonNegativeInteger'> <xsd:restriction base='xsd:int'> <xsd:minInclusive value='0'/> </xsd:restriction> </xsd:simpleType> <xsd:attribute name='IsNested' type='xsd:boolean'/> <xsd:complexType name='SqlRowSet'> <xsd:sequence> <xsd:element ref='xsd:schema'/> <xsd:any/> </xsd:sequence> <xsd:attribute ref='sqltypes:IsNested'/> </xsd:complexType> <xsd:complexType name='SqlXml' mixed='true'> <xsd:sequence> <xsd:any/> </xsd:sequence> </xsd:complexType> <xsd:simpleType name='SqlResultCode'> <xsd:restriction base='xsd:int'> <xsd:minInclusive value='0'/> </xsd:restriction> </xsd:simpleType> </xsd:schema> <xsd:schema targetNamespace='http://schemas.microsoft.com/SQLServer/2001/12/SOAP/types/SqlMessage' elementFormDefault='qualified' attributeFormDefault='qualified'> <xsd:import namespace='http://www.w3.org/2001/XMLSchema'/> <xsd:import namespace='http://schemas.microsoft.com/SQLServer/2001/12/SOAP/types'/> <xsd:complexType name='SqlMessage'> <xsd:sequence minOccurs='1' maxOccurs='1'> <xsd:element name='Class' type='sqltypes:nonNegativeInteger'/> <xsd:element name='LineNumber' type='sqltypes:nonNegativeInteger'/> <xsd:element name='Message' type='xsd:string'/> <xsd:element name='Number' type='sqltypes:nonNegativeInteger'/> <xsd:element name='Procedure' type='xsd:string'/> <xsd:element name='Server' type='xsd:string'/> <xsd:element name='Source' type='xsd:string'/> <xsd:element name='State' type='sqltypes:nonNegativeInteger'/> </xsd:sequence> <xsd:attribute ref='sqltypes:IsNested'/> </xsd:complexType> </xsd:schema> <xsd:schema targetNamespace='http://schemas.microsoft.com/SQLServer/2001/12/SOAP/types/SqlResultStream' elementFormDefault='qualified' attributeFormDefault='qualified'> <xsd:import namespace='http://www.w3.org/2001/XMLSchema'/> <xsd:import namespace='http://schemas.microsoft.com/SQLServer/2001/12/SOAP/types'/> <xsd:import namespace='http://schemas.microsoft.com/SQLServer/2001/12/SOAP/types/SqlMessage'/> <xsd:complexType name='SqlResultStream'> <xsd:choice minOccurs='1' maxOccurs='unbounded'> <xsd:element name='SqlRowSet' type='sqltypes:SqlRowSet'/> <xsd:element name='SqlXml' type='sqltypes:SqlXml'/> <xsd:element name='SqlMessage' type='sqlmessage:SqlMessage'/> <xsd:element name='SqlResultCode' type='sqltypes:SqlResultCode'/> </xsd:choice> </xsd:complexType> </xsd:schema> <xsd:schema targetNamespace="http://GETIVRINFO/IVR/IVRINFO" elementFormDefault="qualified" attributeFormDefault="qualified"> <xsd:import namespace="http://www.w3.org/2001/XMLSchema"/> <xsd:import namespace="http://schemas.microsoft.com/SQLServer/2001/12/SOAP/types"/> <xsd:import namespace="http://schemas.microsoft.com/SQLServer/2001/12/SOAP/types/SqlMessage"/> <xsd:import namespace="http://schemas.microsoft.com/SQLServer/2001/12/SOAP/types/SqlResultStream"/> <xsd:element name="GetIVRinfo"> <xsd:complexType> <xsd:sequence> <xsd:element minOccurs="0" maxOccurs="1" name="zANI" type="xsd:string" nillable="true"/> </xsd:sequence> </xsd:complexType> </xsd:element> <xsd:element name="GetIVRinfoResponse"> <xsd:complexType> <xsd:sequence> <xsd:element minOccurs="1" maxOccurs="1" name="GetIVRinfoResult" type="sqlresultstream:SqlResultStream"/> </xsd:sequence> </xsd:complexType> </xsd:element> </xsd:schema> </wsdl:types> <wsdl:message name="GetIVRinfoIn"> <wsdl:part name="parameters" element="tns:GetIVRinfo"/> </wsdl:message> <wsdl:message name="GetIVRinfoOut"> <wsdl:part name="parameters" element="tns:GetIVRinfoResponse"/> </wsdl:message> <wsdl:portType name="SXSPort"> <wsdl:operation name="GetIVRinfo"> <wsdl:input message="tns:GetIVRinfoIn"/> <wsdl:output message="tns:GetIVRinfoOut"/> </wsdl:operation> </wsdl:portType> <wsdl:binding name="SXSBinding" type="tns:SXSPort"> <soap:binding style="document" transport="http://schemas.xmlsoap.org/soap/http"/> <wsdl:operation name="GetIVRinfo"> <soap:operation soapAction="http://GETIVRINFO/IVR/IVRINFO/GetIVRinfo" style="document"/> <wsdl:input> <soap:body use="literal"/> </wsdl:input> <wsdl:output> <soap:body use="literal"/> </wsdl:output> </wsdl:operation> </wsdl:binding> <wsdl:service name="IVR"> <wsdl:port name="SXSPort" binding="tns:SXSBinding"> <soap:address location="http://GETIVRINFO/IVR/IVRINFO"/> </wsdl:port> </wsdl:service> </wsdl:definitions>

    Read the article

  • Problem deserializing xml file

    - by Andy
    I auto generated an xsd file from the below xml and used xsd2code to get a c# class. The problem is the entire xml doesn't deserialize. Here is how I'm attempting to deserialize: static void Main(string[] args) { using (TextReader textReader = new StreamReader("config.xml")) { // string temp = textReader.ReadToEnd(); XmlSerializer deserializer = new XmlSerializer(typeof(project)); project p = (project)deserializer.Deserialize(textReader); } } here is the actual XML: <?xml version='1.0' encoding='UTF-8'?> <project> <scm class="hudson.scm.SubversionSCM"> <locations> <hudson.scm.SubversionSCM_-ModuleLocation> <remote>https://svn.xxx.com/test/Validation/CPS DRTest DLL/trunk</remote> </hudson.scm.SubversionSCM_-ModuleLocation> </locations> <useUpdate>false</useUpdate> <browser class="hudson.scm.browsers.FishEyeSVN"> <url>http://fisheye.xxxx.net/browse/Test/</url> <rootModule>Test</rootModule> </browser> <excludedCommitMessages></excludedCommitMessages> </scm> <openf>Hello there</openf> <buildWrappers/> </project> When I run the above, the locations node remains null. Here is the xsd that I'm using: <?xml version="1.0" encoding="utf-8"?> <xs:schema id="NewDataSet" xmlns="" xmlns:xs="http://www.w3.org/2001/XMLSchema" xmlns:msdata="urn:schemas-microsoft-com:xml-msdata"> <xs:element name="project"> <xs:complexType> <xs:all> <xs:element name="openf" type="xs:string" minOccurs="0" /> <xs:element name="buildWrappers" type="xs:string" minOccurs="0" /> <xs:element name="scm" minOccurs="0"> <xs:complexType> <xs:sequence> <xs:element name="useUpdate" type="xs:string" minOccurs="0" msdata:Ordinal="1" /> <xs:element name="excludedCommitMessages" type="xs:string" minOccurs="0" msdata:Ordinal="2" /> <xs:element name="locations" minOccurs="0"> <xs:complexType> <xs:sequence> <xs:element name="hudson.scm.SubversionSCM_-ModuleLocation" minOccurs="0"> <xs:complexType> <xs:sequence> <xs:element name="remote" type="xs:string" minOccurs="0" /> </xs:sequence> </xs:complexType> </xs:element> </xs:sequence> </xs:complexType> </xs:element> <xs:element name="browser" minOccurs="0"> <xs:complexType> <xs:sequence> <xs:element name="url" type="xs:string" minOccurs="0" msdata:Ordinal="0" /> <xs:element name="rootModule" type="xs:string" minOccurs="0" msdata:Ordinal="1" /> </xs:sequence> <xs:attribute name="class" type="xs:string" /> </xs:complexType> </xs:element> </xs:sequence> <xs:attribute name="class" type="xs:string" /> </xs:complexType> </xs:element> </xs:all> </xs:complexType> </xs:element> <xs:element name="NewDataSet" msdata:IsDataSet="true" msdata:UseCurrentLocale="true"> <xs:complexType> <xs:choice minOccurs="0" maxOccurs="unbounded"> <xs:element ref="project" /> </xs:choice> </xs:complexType> </xs:element> </xs:schema>

    Read the article

  • SNMP: ASN.1 MIB Definitions. Referencing a table within a table

    - by Doug
    Its's been a while since I've written ASN.1 so.. Our data model is comprised of several table definitions within a table. This is not workable in SNMP, so we need to flatten the definitions. The easiest way to do this would be to have the embedded table indexed by the same OID as the parent table. Thus someTableEntry ::= SEQUENCE { someTableIndex Integer32, someTableDomain Integer32, someTableFooTable SEQUENCE OF SomeTableFooTable } becomes someTableEntry ::= SEQUENCE { someTableIndex Integer32, someTableDomain Integer32, } someTableFooTable ::= SEQUENCE { someTableIndex Integer32, .... } The good thing is that in our application there will NEVER be any kind of SET, GET or GET NEXT so no need for SNMP walk (there are some very good reasons for this that supersede the need for network management elegance. All attributes will be reported via traps only. I think this is a valid SNMP MIB definitions but wanted to get some feedback. Thanks in advance.

    Read the article

  • Why is XML Deserilzation not throwing exceptions when it should.

    - by chobo2
    Hi Here is some dummy xml and dummy xml schema I made. schema <?xml version="1.0" encoding="utf-8"?> <xs:schema xmlns:xs="http://www.w3.org/2001/XMLSchema" targetNamespace="http://www.domain.com" xmlns="http://www.domain.com" elementFormDefault="qualified"> <xs:element name="vehicles"> <xs:complexType> <xs:sequence> <xs:element name="owner" minOccurs="1" maxOccurs="1"> <xs:simpleType> <xs:restriction base="xs:string"> <xs:minLength value="2" /> <xs:maxLength value="8" /> </xs:restriction> </xs:simpleType> </xs:element> <xs:element name="Car" minOccurs="1" maxOccurs="1"> <xs:complexType> <xs:sequence> <xs:element name="Information" type="CarInfo" minOccurs="0" maxOccurs="unbounded" /> </xs:sequence> </xs:complexType> </xs:element> <xs:element name="Truck"> <xs:complexType> <xs:sequence> <xs:element name="Information" type="CarInfo" minOccurs="0" maxOccurs="unbounded"/> </xs:sequence> </xs:complexType> </xs:element> <xs:element name="SUV"> <xs:complexType> <xs:sequence> <xs:element name="Information" type="CarInfo" minOccurs="0" maxOccurs="unbounded" /> </xs:sequence> </xs:complexType> </xs:element> </xs:sequence> </xs:complexType> </xs:element> <xs:complexType name="CarInfo"> <xs:sequence> <xs:element name="CarName"> <xs:simpleType> <xs:restriction base="xs:string"> <xs:minLength value="1"/> <xs:maxLength value="50"/> </xs:restriction> </xs:simpleType> </xs:element> <xs:element name="CarPassword"> <xs:simpleType> <xs:restriction base="xs:string"> <xs:minLength value="6"/> <xs:maxLength value="50"/> </xs:restriction> </xs:simpleType> </xs:element> <xs:element name="CarEmail"> <xs:simpleType> <xs:restriction base="xs:string"> <xs:pattern value="\w+([-+.']\w+)*@\w+([-.]\w+)*\.\w+([-.]\w+)*"/> </xs:restriction> </xs:simpleType> </xs:element> </xs:sequence> </xs:complexType> </xs:schema> xml sample <?xml version="1.0" encoding="utf-8" ?> <vehicles> <owner>Car</owner> <Car> <Information> <CarName>Bob</CarName> <CarPassword>123456</CarPassword> <CarEmail>[email protected]</CarEmail> </Information> <Information> <CarName>Bob2</CarName> <CarPassword>123456</CarPassword> <CarEmail>[email protected]</CarEmail> </Information> </Car> <Truck> <Information> <CarName>Jim</CarName> <CarPassword>123456</CarPassword> <CarEmail>[email protected]</CarEmail> </Information> <Information> <CarName>Jim2</CarName> <CarPassword>123456</CarPassword> <CarEmail>[email protected]</CarEmail> </Information> </Truck> <SUV> <Information> <CarName>Jane</CarName> <CarPassword>123456</CarPassword> <CarEmail>[email protected]</CarEmail> </Information> <Information> <CarName>Jane</CarName> <CarPassword>123456</CarPassword> <CarEmail>[email protected]</CarEmail> </Information> </SUV> </vehicles> Serialization Class using System; using System.Collections.Generic; using System.Xml; using System.Xml.Serialization; [XmlRoot("vehicles")] public class MyClass { public MyClass() { Cars = new List<Information>(); Trucks = new List<Information>(); SUVs = new List<Information>(); } [XmlElement(ElementName = "owner")] public string Owner { get; set; } [XmlElement("Car")] public List<Information> Cars { get; set; } [XmlElement("Truck")] public List<Information> Trucks { get; set; } [XmlElement("SUV")] public List<Information> SUVs { get; set; } } public class CarInfo { public CarInfo() { Info = new List<Information>(); } [XmlElement("Information")] public List<Information> Info { get; set; } } public class Information { [XmlElement(ElementName = "CarName")] public string CarName { get; set; } [XmlElement("CarPassword")] public string CarPassword { get; set; } [XmlElement("CarEmail")] public string CarEmail { get; set; } } Now I think this should all validate. If not assume it is write as my real file does work and this is what this dummy one is based off. Now my problem is this. I want to enforce as much as I can from my schema. Such as the "owner" tag must be the first element and should show up one time and only one time ( minOccurs="1" maxOccurs="1"). Right now I can remove the owner element from my dummy xml file and deseriliaze it and it will go on it's happy way and convert it to object and will just put that property as null. I don't want that I want it to throw an exception or something saying this does match what was expected. I don't want to have to validate things like that once deserialized. Same goes for the <car></car> tag I want that to appear always even if there is no information yet I can remove that too and it will be happy with that. So what tags do I have to add to make my serialization class know that these things are required and if they are not found throw an exception.

    Read the article

  • Deserializing classes from XML generated using XSD.exe

    - by heap
    I have classes generated (using xsd.exe) from an .xsd that I can serialize just fine, but when I try and deserialize it, I get the error: {"<XMLLanguages xmlns='http://tempuri.org/XMLLanguages.xsd'> was not expected."} I've searched for a couple of hours and found most peoples problems lie in not declaring namespaces in their xsd/xml, not defining namespaces in their classes, etc, but I can't find a solution for my problem. Here are code snippets for the relevant classes. <?xml version="1.0" encoding="utf-8"?> <xs:schema id="SetupData" targetNamespace="http://tempuri.org/XMLLanguages.xsd" elementFormDefault="qualified" xmlns="http://tempuri.org/XMLLanguages.xsd" xmlns:xs="http://www.w3.org/2001/XMLSchema" > <xs:element name="XMLLanguages"> <xs:complexType> <xs:sequence> <xs:element name="Tier" minOccurs="1" maxOccurs="unbounded"> <xs:complexType> <xs:sequence> <xs:element name="L" minOccurs="1" maxOccurs="unbounded" type="Language"/> </xs:sequence> <xs:attribute name="TierID" type="xs:int"/> </xs:complexType> </xs:element> </xs:sequence> </xs:complexType> </xs:element> <xs:complexType name="Language"> <xs:sequence> <xs:element name="LangID" type="xs:int"/> <xs:element name="Tier" type="xs:int"/> <xs:element name ="Name" type="xs:string"/> </xs:sequence> <xs:attribute name ="PassRate" type="xs:int"/> </xs:complexType> </xs:schema> And the class: /// <remarks/> [System.CodeDom.Compiler.GeneratedCodeAttribute("xsd", "4.0.30319.1")] [System.SerializableAttribute()] [System.Diagnostics.DebuggerStepThroughAttribute()] [System.ComponentModel.DesignerCategoryAttribute("code")] [System.Xml.Serialization.XmlTypeAttribute(Namespace = "http://tempuri.org/XMLLanguages.xsd")] [System.Xml.Serialization.XmlRootAttribute(Namespace = "http://tempuri.org/XMLLanguages.xsd", IsNullable = false)] public partial class XMLLanguages { private List<XMLLanguagesTier> tierField; /// <remarks/> [System.Xml.Serialization.XmlElementAttribute("Tier")] public List<XMLLanguagesTier> Tiers { get { return this.tierField; } set { this.tierField = value; } } } And a the line in XML causing the error: <XMLLanguages xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xmlns:xsd="http://www.w3.org/2001/XMLSchema" xmlns="http://tempuri.org/XMLLanguages.xsd">

    Read the article

  • Iterator blocks in Clojure?

    - by Checkers
    I am using clojure.contrib.sql to fetch some records from an SQLite database. (defn read-all-foo [] (with-connection *db* (with-query-results res ["select * from foo"] (into [] res)))) Now, I don't really want to realize the whole sequence before returning from the function (i.e. I want to keep it lazy), but if I return res directly or wrap it some kind of lazy wrapper (for example I want to make a certain map transformation on result sequence), SQL-related bindings will be reset and connection will be closed after I return, so realizing the sequence will throw an exception. How can I enclose the whole function in a closure and return a kind of iterator block (like yield in C# or Python)? Or is there another way to return a lazy sequence from this function?

    Read the article

  • Validate xsl fo in xslt styleesheet

    - by Biegal
    Hi, i have a little problem with validating xml, xslt in details. I have a xslt stylesheet that, transforms xml data source to xsl:fo document. Something like this: <?xml version="1.0" encoding="utf-8"?> <xsl:stylesheet version="1.0" xmlns:xsl="http://www.w3.org/1999/XSL/Transform" xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance"> <xsl:template match="/"> <fo:root xmlns:fo="http://www.w3.org/1999/XSL/Format" xmlns="http://www.w3.org/1999/xhtml"> <fo:layout-master-set> <fo:simple-page-master margin-top="25mm" margin-bottom="25mm" margin-left="25mm" margin-right="25mm" page-width="210mm" page-height="297mm" master-name="simplePageLayout"> <fo:region-body region-name="xsl-region-body" column-gap="0.25in" /> <fo:region-before region-name="xsl-region-before" display-align="after" extent="0.1mm" padding-top="0pt" padding-left="0.4in" padding-right="0.4in" padding-bottom="0pt" /> <fo:region-after region-name="xsl-region-after" display-align="before" extent="0.4in" padding-top="4pt" padding-left="0.4in" padding-right="0.4in" padding-bottom="0pt" /> </fo:simple-page-master> <fo:page-sequence-master master-name="default-sequence"> <fo:repeatable-page-master-reference master-reference="simplePageLayout" /> </fo:page-sequence-master> </fo:layout-master-set> <fo:page-sequence master-reference="default-sequence"> <fo:flow flow-name="xsl-region-body"> <fo:block font-family="Segoe UI" color="#000000" font-size="9pt" /> </fo:flow> </fo:page-sequence> </fo:root> </xsl:template> What I want to do, is to validate written xsl:fo elements, ignoring xsl tags. Is it posible? For now I use dtd validation (I have xsd schema too) for validating Fo, but it give me an error on each xsl tag. Summary. Is it posiible to validate only fo elements against the schema, ignoring xsl tags, and how should I do it? Maybe a code snnippet in C#, or a hint how to modify documents? Thanks in advance!

    Read the article

  • db:migrate creates sequences but doesn't alter table?

    - by RewbieNewbie
    Hello, I have a migration that creates a postres sequence for auto incrementing a primary identifier, and then executes a statement for altering the column and specifying the default value: execute 'CREATE SEQUENCE "ServiceAvailability_ID_seq";' execute <<-SQL ALTER TABLE "ServiceAvailability" ALTER COLUMN "ID" set DEFAULT NEXTVAL('ServiceAvailability_ID_seq'); SQL If I run db:migrate everything seems to work, in that no errors are returned, however, if I run the rails application I get: Mnull value in column "ID" violates not-null constraint I have discovered by executing the sql statement in the migration manually, that this error is because the alter statement isn't working, or isn't being executed. If I manually execute the following statement: CREATE SEQUENCE "ServiceAvailability_ID_seq; I get: error : ERROR: relation "serviceavailability_id_seq" already exists Which means the migration successfully created the sequence! However, if I manually run: ALTER TABLE "ServiceProvider" ALTER COLUMN "ID" set DEFAULT NEXTVAL('ServiceProvider_ID_seq'); SQL It runs successfully and creates the default NEXTVAL. So the question is, why is the migration file creating the sequence with the first execute statement, but not altering the table in the second execute? (Remembering, no errors are output on running db:migrate) Thank you and apologies for tl:dr

    Read the article

  • Initialization of std::vector<unsigned int> with a list of consecutive unsigned integers

    - by Thomas
    I want to use a special method to initialize a std::vector<unsigned int> which is described in a C++ book I use as a reference (the German book 'Der C++ Programmer' by Ulrich Breymann, in case that matters). In that book is a section on sequence types of the STL, referring in particular to list, vector and deque. In this section he writes that there are two special constructors of such sequence types, namely, if Xrefers to such a type, X(n, t) // creates a sequence with n copies of t X(i, j) // creates a sequence from the elements of the interval [i, j) I want to use the second one for an interval of unsigned int, that is std::vector<unsigned int> l(1U, 10U); to get a list initialized with {1,2,...,9}. What I get, however, is a vector with one unsigned int with value 10 :-| Does the second variant exist, and if yes, how do I force that it is called?

    Read the article

  • Another serialization ? - c#

    - by ltech
    I had asked this Yesterday If my xsd schema changes to <xs:element name="Document" minOccurs="0" maxOccurs="unbounded"> <xs:complexType> <xs:sequence> <xs:element name="MetaDoc" minOccurs="0" maxOccurs="unbounded"> <xs:complexType> <xs:sequence> <xs:element name="ATTRIBUTES" minOccurs="0" maxOccurs="unbounded"> <xs:complexType> <xs:sequence> <xs:element name="author" type="xs:string" minOccurs="0" /> <xs:element name="max_versions" type="xs:string" minOccurs="0" /> <xs:element name="summary" type="xs:string" minOccurs="0" /> </xs:sequence> </xs:complexType> </xs:element> </xs:sequence> </xs:complexType> </xs:element> </xs:sequence> </xs:complexType> </xs:element> My xsd - class generation becomes /// <remarks/> [System.Xml.Serialization.XmlArrayAttribute(Form=System.Xml.Schema.XmlSchemaForm.Unqualified)] [System.Xml.Serialization.XmlArrayItemAttribute("MetaDoc", typeof(DocumentMetaDocATTRIBUTES[]), Form=System.Xml.Schema.XmlSchemaForm.Unqualified, IsNullable=false)] [System.Xml.Serialization.XmlArrayItemAttribute("ATTRIBUTES", typeof(DocumentMetaDocATTRIBUTES), Form=System.Xml.Schema.XmlSchemaForm.Unqualified, IsNullable=false, NestingLevel=1)] public DocumentMetaDocATTRIBUTES[][][] Document { get { return this.documentField; } set { this.documentField = value; } } If I am deriving to CollectionBase, as shown in my previous post, how would I manage the XmlArrayItemAttribute ? so that I can read this part of my input xml into my strongly types object <Document> <MetaDoc> <ATTRIBUTES> <author>asas</author> <max_versions>1</max_versions> <summary>aasasqqqq</summary> </ATTRIBUTES> </MetaDoc> </Document>

    Read the article

  • database schema eligible for delta synchronization

    - by WilliamLou
    it's a question for discussion only. Right now, I need to re-design a mysql database table. Basically, this table contains all the contract records I synchronized from another database. The contract record can be modified, deleted or users can add new contract records via GUI interface. At this stage, the table structure is exactly the same as the Contract info (column: serial number, expiry date etc.). In that case, I can only synchronize the whole table (delete all old records, replace with new ones). If I want to delta(only synchronize with modified, new, deleted records) synchronize the table, how should I change the database schema? here is the method I come up with, but I need your suggestions because I think it's a common scenario in database applications. 1)introduce a sequence number concept/column: for each sequence, mark the new added records, modified records, deleted records with this sequence number. By recording the last synchronized sequence number, only pass those records with higher sequence number; 2) because deleted contracts can be added back, and the original table has primary key constraints, should I create another table for those deleted records? or add a flag column to indicate if this contract has been deleted? I hope I explain my question clearly. Anyway, if you know any articles or your own suggestions about this, please let me know. Thanks!

    Read the article

  • I am confused -- Will this code always work?

    - by Shekhar
    Hello, I have written this piece of code public class Test{ public static void main(String[] args) { List<Integer> list = new ArrayList<Integer>(); for(int i = 1;i<= 4;i++){ new Thread(new TestTask(i, list)).start(); } while(list.size() != 4){ // this while loop required so that all threads complete their work } System.out.println("List "+list); } } class TestTask implements Runnable{ private int sequence; private List<Integer> list; public TestTask(int sequence, List<Integer> list) { this.sequence = sequence; this.list = list; } @Override public void run() { list.add(sequence); } } This code works and prints all the four elements of list on my machine. My question is that will this code always work. I think there might be a issue in this code when two/or more threads add element to this list at the same point. In that case it while loop will never end and code will fail. Can anybody suggest a better way to do this? I am not very good at multithreading and don't know which concurrent collection i can use? Thanks Shekhar

    Read the article

  • Is this code well-defined?

    - by Nawaz
    This code is taken from a discussion going on here. someInstance.Fun(++k).Gun(10).Sun(k).Tun(); Is this code well-defined? Is ++k Fun() evaluated before k in Sun()? What if k is user-defined type, not built-in type? And in what ways the above function calls order is different from this: eat(++k);drink(10);sleep(k); As far as I can say, in both situations, there exists a sequence point after each function call. If so, then why can't the first case is also well-defined like the second one? Section 1.9.17 of the C++ ISO standard says this about sequence points and function evaluation: When calling a function (whether or not the function is inline), there is a sequence point after the evaluation of all function arguments (if any) which takes place before execution of any expressions or statements in the function body. There is also a sequence point after the copying of a returned value and before the execution of any expressions outside the function.

    Read the article

  • XML Schema for a .NET type that inherits and implements

    - by John Ruiz
    Hi, Please consider the following three .NET types: I have an interface, an abstract class, and a concrete class. My question is how to write the XML Schema to include the properties from the interface and from the abstract class. public interface IStartable { bool RequiresKey { get; set; } void Start(object key); } public abstract class Vehicle { uint WheelCount { get; set; } } public class Car : Vehicle, IStartable { public bool RequiresKey { get; set; } public string Make { get; set; } publilc string Model { get; set; } public Car() {} public void Start(object key) { // start car with key } } I don't know how to complete this schema: <xs:schema xmlns:xs="http://www.w3.org/2001/XMLSchema" targetNamespace="cars" xmlns="cars" xmlns:c="cars"> <!-- How do I get car to have vehicle's wheelcount AND IStartable's RequiresKey? --> <xs:element name="Car" type="c:Car" /> <xs:complexType name="Car"> <xs:complexContent> <xs:extension base="c:Vehicle"> <xs:group ref=c:CarGroup" /> </xs:extension> </xs:complexContent> </xs:complexType> <xs:group name="CarGroup"> <xs:sequence> <xs:element name="Make" type="xs:token" /> <xs:element name="Model" type="xs:token" /> </xs:sequence> </xs:group> <xs:complexType name="Vehicle"> <xs:sequence> <xs:element name="WheelCount" type="xs:unsignedInt" /> </xs:sequence> </xs:complexType> <xs:complexType name="IStartable"> <xs:sequence> <xs:element name="RequiresKey" type="xs:boolean" /> </xs:sequence> </xs:complexType> </xs:schema>

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • Unable to serialize correctly- c#

    - by ltech
    I had asked this Yesterday If my xsd schema changes to <xs:element name="Document" minOccurs="0" maxOccurs="unbounded"> <xs:complexType> <xs:sequence> <xs:element name="MetaDoc" minOccurs="0" maxOccurs="unbounded"> <xs:complexType> <xs:sequence> <xs:element name="ATTRIBUTES" minOccurs="0" maxOccurs="unbounded"> <xs:complexType> <xs:sequence> <xs:element name="author" type="xs:string" minOccurs="0" /> <xs:element name="max_versions" type="xs:string" minOccurs="0" /> <xs:element name="summary" type="xs:string" minOccurs="0" /> </xs:sequence> </xs:complexType> </xs:element> </xs:sequence> </xs:complexType> </xs:element> </xs:sequence> </xs:complexType> </xs:element> My xsd - class generation becomes /// <remarks/> [System.Xml.Serialization.XmlArrayAttribute(Form=System.Xml.Schema.XmlSchemaForm.Unqualified)] [System.Xml.Serialization.XmlArrayItemAttribute("MetaDoc", typeof(DocumentMetaDocATTRIBUTES[]), Form=System.Xml.Schema.XmlSchemaForm.Unqualified, IsNullable=false)] [System.Xml.Serialization.XmlArrayItemAttribute("ATTRIBUTES", typeof(DocumentMetaDocATTRIBUTES), Form=System.Xml.Schema.XmlSchemaForm.Unqualified, IsNullable=false, NestingLevel=1)] public DocumentMetaDocATTRIBUTES[][][] Document { get { return this.documentField; } set { this.documentField = value; } } If I am deriving to CollectionBase, as shown in my previous post, how would I manage the XmlArrayItemAttribute ? so that I can read this part of my input xml into my strongly types object <Document> <MetaDoc> <ATTRIBUTES> <author>asas</author> <max_versions>1</max_versions> <summary>aasasqqqq</summary> </ATTRIBUTES> </MetaDoc> </Document>

    Read the article

  • Swift CMutablePointers in factories e.g. NewMusicSequence

    - by Gene De Lisa
    How do you use C level factory methods in Swift? Let's try using a factory such as NewMusicSequence(). OSStatus status var sequence:MusicSequence status=NewMusicSequence(&sequence) This errors out with "error: variable 'sequence' passed by reference before being initialized". Set sequence to nil, and you get EXC_BAD_INSTRUCTION. You can try being explicit like this: var sp:CMutablePointer<MusicSequence>=nil status=NewMusicSequence(sp) But then you get a bad access exception when you set sp to nil. If you don't set sp, you get an "error: variable 'sp' used before being initialized" Here's the reference.

    Read the article

  • "Anagram solver" based on statistics rather than a dictionary/table?

    - by James M.
    My problem is conceptually similar to solving anagrams, except I can't just use a dictionary lookup. I am trying to find plausible words rather than real words. I have created an N-gram model (for now, N=2) based on the letters in a bunch of text. Now, given a random sequence of letters, I would like to permute them into the most likely sequence according to the transition probabilities. I thought I would need the Viterbi algorithm when I started this, but as I look deeper, the Viterbi algorithm optimizes a sequence of hidden random variables based on the observed output. I am trying to optimize the output sequence. Is there a well-known algorithm for this that I can read about? Or am I on the right track with Viterbi and I'm just not seeing how to apply it?

    Read the article

  • Does a Postgresql dump create sequences that start with - or after - the last key?

    - by bennylope
    I recently created a SQL dump of a database behind a Django project, and after cleaning the SQL up a little bit was able to restore the DB and all of the data. The problem was the sequences were all mucked up. I tried adding a new user and generated the Python error IntegrityError: duplicate key violates unique constraint. Naturally I figured my SQL dump didn't restart the sequence. But it did: DROP SEQUENCE "auth_user_id_seq" CASCADE; CREATE SEQUENCE "auth_user_id_seq" INCREMENT 1 START 446 MAXVALUE 9223372036854775807 MINVALUE 1 CACHE 1; ALTER TABLE "auth_user_id_seq" OWNER TO "db_user"; I figured out that a repeated attempt at creating a user (or any new row in any table with existing data and such a sequence) allowed for successful object/row creation. That solved the pressing problem. But given that the last user ID in that table was 446 - the same start value in the sequence creation above - it looks like Postgresql was simply trying to start creating rows with that key. Does the SQL dump provide the wrong start key by 1? Or should I invoke some other command to start sequences after the given start ID? Keenly curious.

    Read the article

  • Anonymous iterators blocks in Clojure?

    - by Checkers
    I am using clojure.contrib.sql to fetch some records from an SQLite database. (defn read-all-foo [] (let [sql "select * from foo"] (with-connection *db* (with-query-results res [sql] (into [] res))))) Now, I don't really want to realize the whole sequence before returning from the function (i.e. I want to keep it lazy), but if I return res directly or wrap it some kind of lazy wrapper (for example I want to make a certain map transformation on result sequence), SQL bindings will be gone after I return, so realizing the sequence will throw an error. How can I enclose the whole function in a closure and return a kind of anonymous iterator block (like yield in C# or Python)? Or is there another way to return a lazy sequence from this function?

    Read the article

  • How to specify a child element in XML schema with a name but any content?

    - by mackenir
    I am trying to write some XML schema code to specify that a particular element 'abc' may have a child element with name 'xyz', and that element may have any attributes, and any child elements. At the moment I have this: <xs:element name="abc"> <xs:complexType> <xs:sequence> <xs:element name="xyz"> <xs:complexType> <xs:sequence> <xs:any/> </xs:sequence> <xs:anyAttribute/> </xs:complexType> </xs:element> </xs:sequence> </xs:complexType> </xs:element> But when I validate my XML against the schema, I get validation failures complaining about the child elements of the xyz element.

    Read the article

< Previous Page | 28 29 30 31 32 33 34 35 36 37 38 39  | Next Page >