Search Results

Search found 3479 results on 140 pages for 'sequence diagram'.

Page 31/140 | < Previous Page | 27 28 29 30 31 32 33 34 35 36 37 38  | Next Page >

  • What is the method to reset the Planar 1910m monitor?

    - by Richard J Foster
    My monitor (a Planar, apparently model number PL1910M) is not working. (It is flashing a green / orange sequence which I believe to be an error code. The sequence, in case it helps consists of orange and green three times quickly followed by a longer orange, then another green followed by a long period where both colors appear to be present). I vaguely recall a co-worker suffering from a similar problem, and our IT department "resetting" the monitor by holding down a certain set of keys as they apply power. Unfortunately, I do not remember what that key sequence was, our IT department is not responding, and the Planar web site is blocked by the content filtering firewall we have in place! What is the sequence to perform the reset? (For bonus geek-credit, what does the code mean... as if it indicates a blown component clearly a reset will not help me. ;-))

    Read the article

  • What steps to take when CPAN installation fails?

    - by pythonic metaphor
    I have used CPAN to install perl modules on quite a few occasions, but I've been lucky enough to just have it work. Unfortunately, I was trying to install Thread::Pool today and one of the required dependencies, Thread::Converyor::Monitored failed the test: Test Summary Report ------------------- t/Conveyor-Monitored02.t (Wstat: 65280 Tests: 89 Failed: 0) Non-zero exit status: 255 Parse errors: Tests out of sequence. Found (2) but expected (4) Tests out of sequence. Found (4) but expected (5) Tests out of sequence. Found (5) but expected (6) Tests out of sequence. Found (3) but expected (7) Tests out of sequence. Found (6) but expected (8) Displayed the first 5 of 86 TAP syntax errors. Re-run prove with the -p option to see them all. Files=3, Tests=258, 6 wallclock secs ( 0.07 usr 0.03 sys + 4.04 cusr 1.25 csys = 5.39 CPU) Result: FAIL Failed 1/3 test programs. 0/258 subtests failed. make: *** [test_dynamic] Error 255 ELIZABETH/Thread-Conveyor-Monitored-0.12.tar.gz /usr/bin/make test -- NOT OK //hint// to see the cpan-testers results for installing this module, try: reports ELIZABETH/Thread-Conveyor-Monitored-0.12.tar.gz Running make install make test had returned bad status, won't install without force Failed during this command: ELIZABETH/Thread-Conveyor-Monitored-0.12.tar.gz: make_test NO What steps do you take to start seeing why an installation failed? I'm not even sure how to begin tracking down what's wrong.

    Read the article

  • Shuffling in windows media player

    - by Crazy Buddy
    I think media player has several issues indeed. You see, I'll be hearing songs most of the time using WMP 11 (in WinXP SP3). Today - While I was wasting my time poking some sleepy questions in SE, I also noticed this... My "Now-playing" list contains some 500 mp3s (doesn't matter). I've enabled both Shuffle and Repeat. I play those songs. When I get irritated with some song (say - the 10th song), I change it. Something mysterious happened (happens even now). A sequence of atleast 3 songs (already played before the 10th song) repeat again in the same way following the selected one... Then, I skip those somehow and arrive at another boring song (say now - 20th) and now, the sequence would've increased by about 5 songs (sometimes)... Sometimes, I even notice a specific "sequence of songs" (including the skipped one) repeating again & again. I doubt most guys would've noticed. This makes me ask a question - Why? There are a lot songs in my playlist. Why the same sets of songs? Does WMP really chooses a sequence at start and follows it. Once a change is encountered, it starts the sequence again after several songs. Is it so? Feel free to shoot it down. I don't know whether it's acceptable here. Just curious about it... Note: This is only observed when both shuffle and repeat are enabled. To confirm, I tried it in two other PCs of mine (thereby dumped 2 hours). BTW, I also didn't observe this magic in VLC, Winamp, K-Lite and not even my Nokia cellphone. I think I'm not a good Googler and so, I can't find any such issues :-)

    Read the article

  • What is the method to reset the Planar 1910m monitor?

    - by Richard J Foster
    My monitor (a Planar, apparently model number PL1910M) is not working. (It is flashing a green / orange sequence which I believe to be an error code. The sequence, in case it helps consists of orange and green three times quickly followed by a longer orange, then another green followed by a long period where both colors appear to be present). I vaguely recall a co-worker suffering from a similar problem, and our IT department "resetting" the monitor by holding down a certain set of keys as they apply power. Unfortunately, I do not remember what that key sequence was, our IT department is not responding, and the Planar web site is blocked by the content filtering firewall we have in place! What is the sequence to perform the reset? (For bonus geek-credit, what does the code mean... as if it indicates a blown component clearly a reset will not help me. ;-))

    Read the article

  • Use external display from boot on Samsung laptop

    - by OhMrBigshot
    I have a Samsung RV511 laptop, and recently my screen broke. I connected an external screen and it works fine, but only after Windows starts. I want to be able to use the external screen right from boot, in order to set the BIOS to boot from DVD, and to then install a different OS and also format the hard drive. Right now I can only use the screen when Windows loads. What I've tried: I've tried opening up the laptop and disconnecting the display to make it only find the external and use the VGA as default -- didn't work. I've tried using the Fn+key combo in BIOS to connect external display - nothing I've been looking around for ways to change boot sequence without entering BIOS, but it doesn't look like it's possible. Possible solutions? A way to change boot sequence without entering BIOS? Someone with the same brand/similar model to help me blindly keystroke the correct arrows/F5/F6 buttons while in BIOS mode to change boot sequence? A way to force the external display to work from boot, through modifying the internal connections (I have no problem taking the laptop apart if needed, please no soldering though), through BIOS or program? Also, if I change boot sequence without accessing external screen, would the Ubuntu 12.1 installation sequence attempt to use the external screen or would I only be able to use it after Linux is installed and running? I'd really appreciate help, I can't afford to fix the screen for a few months from now, and I'd really like to make my computer come back to decent performance! Thanks in advance!

    Read the article

  • Convert text to table

    - by Quattro
    I would like convert text into a table. Here is a link to the text http://www.tcdb.org/public/tcdb Short example: >gnl|TC-DB|A0CIB0|1.A.17.3.1 Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1 MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI >gnl|TC-DB|A0CS82|9.B.82.1.5 Chromosome undetermined scaffold_26, whole genome shotgun sequence - Paramecium tetraurelia. MIIEEQIEEKMIYKAIHRVKVNYQKKIDRYILYKKSRWFFNLLLMLLYAYRIQNIGGFYI VTYIYCVYQLQLLIDYFTPLGLPPVNLEDEEEDDDQFQNDFSELPTTLSNKNELNDKEFR PLLRTTSEFKVWQKSVFSVIFAYFCTYIPIWDIPVYWPFLFCYFFVIVGMSIRKYIKHMK KYGYTILDFTKKK I wanted to have columns for example delimited with pipe | or ; |>gnl|TC-DB|A0CIB0|1.A.17.3.1| Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1| MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI I am working with Windows and I don't know how to do it I just know every row starts with > I want to substitute the first whitespace in a row with a delimiter like | or ; after the first regular expression new line in a row, I want also a delimiter everything between the regular expression first new line and > should go into a new column (it's a sequence of a protein)

    Read the article

  • Defining recursive algebraic data types in XML XSD

    - by Ben Challenor
    Imagine I have a recursive algebraic data type like this (Haskell syntax): data Expr = Zero | One | Add Expr Expr | Mul Expr Expr I'd like to represent this in XML, and I'd like an XSD schema for it. I have figured out how to achieve this syntax: <Expr> <Add> <Expr> <Zero/> </Expr> <Expr> <Mul> <Expr> <One/> </Expr> <Expr> <Add> <Expr> <One/> </Expr> <Expr> <One/> </Expr> </Add> </Expr> </Mul> </Expr> </Add> </Expr> with this schema: <xs:complexType name="Expr"> <xs:choice minOccurs="1" maxOccurs="1"> <xs:element minOccurs="1" maxOccurs="1" name="Zero" type="Zero" /> <xs:element minOccurs="1" maxOccurs="1" name="One" type="One" /> <xs:element minOccurs="1" maxOccurs="1" name="Add" type="Add" /> <xs:element minOccurs="1" maxOccurs="1" name="Mul" type="Mul" /> </xs:choice> </xs:complexType> <xs:complexType name="Zero"> <xs:sequence> </xs:sequence> </xs:complexType> <xs:complexType name="One"> <xs:sequence> </xs:sequence> </xs:complexType> <xs:complexType name="Add"> <xs:sequence> <xs:element minOccurs="2" maxOccurs="2" name="Expr" type="Expr" /> </xs:sequence> </xs:complexType> <xs:complexType name="Mul"> <xs:sequence> <xs:element minOccurs="2" maxOccurs="2" name="Expr" type="Expr" /> </xs:sequence> </xs:complexType> But what I really want is this syntax: <Add> <Zero/> <Mul> <One/> <Add> <One/> <One/> </Add> </Mul> </Add> Is this possible? Thanks!

    Read the article

  • DataTable ReadXmlSchema and ReadXml Resulting in error

    - by MasterMax1313
    I'm having some trouble with the ReadXmlSchema and ReadXml methods for a DataTable. I'm getting the error "DataTable does not support schema inference from Xml". Code Snippet: I've tried Table.ReadXmlSchema(new StringReader(File.ReadAllText(XsdFilePath))); Table.ReadXml(new StringReader(File.ReadAllText(XmlFilePath))); And Table.ReadXmlSchema(XsdFilePath); Table.ReadXml(XmlFilePath); Xml Snippet: <ScreenSets> <ScreenSet id="Credit 1"> <Screen xmlFile="sb-credit1.en.xml" tabText="Recommendation" isCached="false"> <Buttons> <Button id="btnClosePresentation"/> </Buttons> </Screen> </ScreenSet> <ScreenSet id="Credit 2"> <Screen xmlFile="sb-credit2.en.xml" tabText="Recommendation" isCached="false"> <Buttons> <Button id="btnClosePresentation"/> </Buttons> </Screen> </ScreenSet> <ScreenSet id="Credit 3"> <Screen xmlFile="sb-credit3.en.xml" tabText="Recommendation" isCached="false"> <Buttons> <Button id="btnClosePresentation"/> </Buttons> </Screen> </ScreenSet> </ScreenSets> Xsd: <?xml version="1.0" encoding="utf-8"?> <xs:schema attributeFormDefault="unqualified" elementFormDefault="qualified" xmlns:xs="http://www.w3.org/2001/XMLSchema"> <xs:element name="ScreenSets"> <xs:complexType> <xs:sequence> <xs:element maxOccurs="unbounded" name="ScreenSet"> <xs:complexType> <xs:sequence> <xs:element name="Screen"> <xs:complexType> <xs:sequence> <xs:element name="Buttons"> <xs:complexType> <xs:sequence> <xs:element maxOccurs="unbounded" name="Button"> <xs:complexType> <xs:attribute name="id" type="xs:string" use="required" /> </xs:complexType> </xs:element> </xs:sequence> </xs:complexType> </xs:element> </xs:sequence> <xs:attribute name="xmlFile" type="xs:string" use="required" /> <xs:attribute name="tabText" type="xs:string" use="required" /> <xs:attribute name="isCached" type="xs:boolean" use="required" /> </xs:complexType> </xs:element> </xs:sequence> <xs:attribute name="id" type="xs:string" use="required" /> </xs:complexType> </xs:element> </xs:sequence> </xs:complexType> </xs:element> </xs:schema>

    Read the article

  • Resolve naming conflict in included XSDs for JAXB compilation

    - by Jason Faust
    I am currently trying to compile with JAXB (IBM build 2.1.3) a pair of schema files into the same package. Each will compile on it's own, but when trying to compile them together i get a element naming conflict due to includes. My question is; is there a way to specify with an external binding a resolution to the naming collision. Example files follow. In the example the offending element is called "Common", which is defined in both incA and incB: incA.xsd <?xml version="1.0" encoding="UTF-8"?> <schema xmlns="http://www.w3.org/2001/XMLSchema" targetNamespace="http://www.example.org/" xmlns:tns="http://www.example.org/" elementFormDefault="qualified"> <complexType name="TypeA"> <sequence> <element name="ElementA" type="string"></element> </sequence> </complexType> <!-- Conflicting element --> <element name="Common" type="tns:TypeA"></element> </schema> incB.xsd <?xml version="1.0" encoding="UTF-8"?> <schema xmlns="http://www.w3.org/2001/XMLSchema" targetNamespace="http://www.example.org/" xmlns:tns="http://www.example.org/" elementFormDefault="qualified"> <complexType name="TypeB"> <sequence> <element name="ElementB" type="int"></element> </sequence> </complexType> <!-- Conflicting element --> <element name="Common" type="tns:TypeB"></element> </schema> A.xsd <?xml version="1.0" encoding="UTF-8"?> <schema targetNamespace="http://www.example.org/" elementFormDefault="qualified" xmlns="http://www.w3.org/2001/XMLSchema" xmlns:tns="http://www.example.org/"> <include schemaLocation="incA.xsd"></include> <complexType name="A"> <sequence> <element ref="tns:Common"></element> </sequence> </complexType> </schema> B.xsd <?xml version="1.0" encoding="UTF-8"?> <schema targetNamespace="http://www.example.org/" elementFormDefault="qualified" xmlns="http://www.w3.org/2001/XMLSchema" xmlns:tns="http://www.example.org/"> <include schemaLocation="incB.xsd"></include> <complexType name="B"> <sequence> <element ref="tns:Common"></element> </sequence> </complexType> </schema> Compiler error when both are compiled from one evocation of xjb: [ERROR] 'Common' is already defined line 9 of file:/C:/temp/incB.xsd [ERROR] (related to above error) the first definition appears here line 9 of file:/C:/temp/incA.xsd (For reference, this is a generalization to resolve an issue with compiling the OAGIS8 SP3 package)

    Read the article

  • Alternate method to dependent, nested if statements to check multiple states

    - by octopusgrabbus
    Is there an easier way to process multiple true/false states than using nested if statements? I think there is, and it would be to create a sequence of states, and then use a function like when to determine if all states were true, and drop out if not. I am asking the question to make sure there is not a preferred Clojure way to do this. Here is the background of my problem: I have an application that depends on quite a few input files. The application depends on .csv data reports; column headers for each report (.csv files also), so each sequence in the sequence of sequences can be zipped together with its columns for the purposes of creating a smaller sequence; and column files for output data. I use the following functions to find out if a file is present: (defn kind [filename] (let [f (File. filename)] (cond (.isFile f) "file" (.isDirectory f) "directory" (.exists f) "other" :else "(cannot be found)" ))) (defn look-for [filename expected-type] (let [find-status (kind-stat filename expected-type)] find-status)) And here are the first few lines of a multiple if which looks ugly and is hard to maintain: (defn extract-re-values "Plain old-fashioned sub-routine to process real-estate values / 3rd Q re bills extract." [opts] (if (= (utl/look-for (:ifm1 opts) "f") 0) ; got re columns? (if (= (utl/look-for (:ifn1 opts) "f") 0) ; got re data? (if (= (utl/look-for (:ifm3 opts) "f") 0) ; got re values output columns? (if (= (utl/look-for (:ifm4 opts) "f") 0) ; got re_mixed_use_ratio columns? (let [re-in-col-nams (first (utl/fetch-csv-data (:ifm1 opts))) re-in-data (utl/fetch-csv-data (:ifn1 opts)) re-val-cols-out (first (utl/fetch-csv-data (:ifm3 opts))) mu-val-cols-out (first (utl/fetch-csv-data (:ifm4 opts))) chk-results (utl/chk-seq-len re-in-col-nams (first re-in-data) re-rec-count)] I am not looking for a discussion of the best way, but what is in Clojure that facilitates solving a problem like this.

    Read the article

  • SharePoint For Newbie Developers: Code Scope

    - by Mark Rackley
    So, I continue to try to come up with diagrams and information to help new SharePoint developers wrap their heads around this SharePoint beast, especially when those newer to development are on my team. To that end, I drew up the below diagram to help some of our junior devs understand where/when code is being executed in SharePoint at a high level. Note that I say “High Level”… This is a simplistic diagram that can get a LOT more complicated if you want to dive in deeper.  For the purposes of my lesson it served its purpose well. So, please no comments from you peanut gallery about information 3 levels down that’s missing unless it adds to the discussion.  Thanks So, the diagram below details where code is executed on a page load and gives the basic flow of the page load. There are actually many more steps, but again, we are staying high level here. I just know someone is still going to say something like “Well.. actually… the dlls are getting executed when…”  Anyway, here’s the diagram with some information I like to point out: Code Scope / Where it is executed So, looking at the diagram we see that dlls and XSL are executed on the server and that JavaScript/jQuery are executed on the client. This is the main thing I like to point out for the following reasons: XSL (for the most part) is faster than JavaScript I actually get this question a lot. Since XSL is executed on the server less data is getting passed over the wire and a beefier machine (hopefully) is doing the processing. The outcome of course is better performance. When You are using jQuery and making Web Service calls you are building XML strings and sending them to the server, then ALL the results come back and the client machine has to parse through the XML and use what it needs and ignore the rest (and there is a lot of garbage that comes back from SharePoint Web Service calls). XSL and JavaScript cannot work together in the same scope Let me clarify. JavaScript can send data back to SharePoint in postbacks that XSL can then use. XSL can output JavaScript and initiate JavaScript variables.  However, XSL cannot call a JavaScript method to get a value and JavaScript cannot directly interact with XSL and call its templates. They are executed in there scope only. No crossing of boundaries here. So, what does this all mean? Well, nothing too deep. This is just some basic fundamental information that all SharePoint devs need to understand. It will help you determine what is the best solution for your specific development situation and it will help the new guys understand why they get an error when trying to call a JavaScript Function from within XSL.  Let me know if you think quick little blogs like this are helpful or just add to the noise. I could probably put together several more that are similar.  As always, thanks for stopping by, hope you learned something new.

    Read the article

  • Sorting Algorithm : output

    - by Aaditya
    I faced this problem on a website and I quite can't understand the output, please help me understand it :- Bogosort, is a dumb algorithm which shuffles the sequence randomly until it is sorted. But here we have tweaked it a little, so that if after the last shuffle several first elements end up in the right places we will fix them and don't shuffle those elements furthermore. We will do the same for the last elements if they are in the right places. For example, if the initial sequence is (3, 5, 1, 6, 4, 2) and after one shuffle we get (1, 2, 5, 4, 3, 6) we will keep 1, 2 and 6 and proceed with sorting (5, 4, 3) using the same algorithm. Calculate the expected amount of shuffles for the improved algorithm to sort the sequence of the first n natural numbers given that no elements are in the right places initially. Input: 2 6 10 Output: 2 1826/189 877318/35343 For each test case output the expected amount of shuffles needed for the improved algorithm to sort the sequence of first n natural numbers in the form of irreducible fractions. I just can't understand the output.

    Read the article

  • Database Instance

    - by Sam
    I read a statement from an exercise: construct a database instance which conforms to diagram 1 but not to diagram 2. The diagrams are different n-ary relationships that have different relationships. Diagram 1 has a many to one to many to one relationship. Diagram 2 has many to many to many to one relationship. So, to really understand this problem, what does a database instance mean? Is it to make an example or abstract entities like a1, a2, or a3. Thanks for your time.

    Read the article

  • Adding Previous/Next Functionality to jQuery Map Highlight Plugin

    - by Keith
    As you can see in my jsFiddle example, I have a diagram that uses jQuery Map Highlight plugin to allow users to click to different parts of the diagram and see the corresponding text to the left. Right now, the only way to interact with the diagram is by clicking on it. I'd like to give users the ability to hit previous and next buttons to control it as well. I'm just not sure how to go about it. Any help would be appreciated: http://jsfiddle.net/keith/jkLH7/1/

    Read the article

  • how to subtract circle from an arbitrary polygon

    - by George
    Given an arbitary polygon with vertices stored in either clockwise/counterclockwise fashion (depicted as a black rectangle in the diagram), I need to be able to subtract an arbitrary number of circles (in red on the diagram) from that polygon. Removing a circle could possibly split the polygon into two seperate polygons (as depicted by the second line in the diagram). I'm not sure where to start. http://www.freeimagehosting.net/image.php?89a0276d9d.jpg

    Read the article

  • Data Flow Object Graph and An Execution Engine for it

    - by M Dotnet
    I would like to build a custom workflow engine from scratch. The input to this workflow is a data flow diagram which is composed of a series of activities connected together through lines where each each represent the data flow. Each activity can export multiple outputs. Activities are complex math functions but the logic is hidden from the user. My workflow engine job is to execute the given data flow diagram. Each activity within the data flow diagram is a custom activity and each activity can output different outputs. How do you suggest to model the data flow diagram object? I need to be able to construct the data flow diagram problematically (no need for drag and drop) but I need to display the final result graphically (for display and debugging purposes). Are there any libraries out there that I could use? Should I keep the workflow presentable as an xml? I know that there are many projects out there trying to essentially doing similar thing by building such workflow engines but I need something light weight and open source. I do not need any state machine execution engine and mine is primarily sequential workflow with fork and join capabilities. My activities are wrappable as basic C# classes and I do NOT want to use anything as heavy as .NET workflow foundation.

    Read the article

  • Why is Matlab Stateflow 7.7 not throwing errors on undefined variables?

    - by Pyrolistical
    Previously in Matlab Stateflow 7.1 all variables and functions had to be included before they can be referred to in the state diagram or else it would throw an error when you tried to parse the diagram. But now in 7.7 it doesn't catch those kinds of errors. Its still compiling the diagram because it catches other syntactic errors. Am I missing an option somewhere? Can this be turned on?

    Read the article

  • Where am I going wrong in my Xml Schema?

    - by chobo2
    Hi I am trying to make a XML Schema but everytime I use it and try to validate my data I get an error. I get this error: Validation of the XML Document failed! Error message(s): Could not find schema information for the element 'Email'. Line: 1 Column:1213 http://www.xmlforasp.net/SchemaValidator.aspx My Xml file I am trying to validate. <?xml version="1.0" encoding="utf-8" ?> <School> <SchoolPrefix>BCIT</SchoolPrefix> <TeacherAccounts> <Account> <StudentNumber>A00140000</StudentNumber> <Password>123456</Password> <Email>[email protected]</Email> </Account> <Account> <StudentNumber>A00000041</StudentNumber> <Password>1234567</Password> <Email>[email protected]</Email> </Account> <Account> <StudentNumber>A0400100</StudentNumber> <Password>1234567</Password> <Email>[email protected]</Email> </Account> </TeacherAccounts> <FullTimeAccounts> <Account> <StudentNumber>A00000000</StudentNumber> <Password>1234567</Password> <Email>[email protected]</Email> </Account> <Account> <StudentNumber>A00141000</StudentNumber> <Password>1234567</Password> <Email>[email protected]</Email> </Account> </FullTimeAccounts> <PartTimeAccounts> <Account> <StudentNumber>A81020409</StudentNumber> <Password>1234567</Password> <Email>[email protected]</Email> </Account> <Account> <StudentNumber>A040014000</StudentNumber> <Password>1234567</Password> <Email>[email protected]</Email> </Account> <Account> <StudentNumber>A00024040</StudentNumber> <Password>1234567</Password> <Email>[email protected]</Email> </Account> <Account> <StudentNumber>A00004101</StudentNumber> <Password>1234567</Password> <Email>[email protected]</Email> </Account> </PartTimeAccounts> </School> XMl Schema <?xml version="1.0" encoding="utf-8"?> <xs:schema xmlns:xs="http://www.w3.org/2001/XMLSchema" targetNamespace="http://www.nothing.com" xmlns="http://www.nothing.com" elementFormDefault="qualified"> <xs:element name="School"> <xs:complexType> <xs:sequence> <xs:element name="SchoolPrefix" minOccurs="1" maxOccurs="1"> <xs:simpleType> <xs:restriction base="xs:string"> <xs:minLength value="2" /> <xs:maxLength value="8" /> </xs:restriction> </xs:simpleType> </xs:element> <xs:element name="TeacherAccounts" minOccurs="1" maxOccurs="1"> <xs:complexType> <xs:sequence> <xs:element name="Account" type="UserInfo" minOccurs="0" maxOccurs="unbounded" /> </xs:sequence> </xs:complexType> </xs:element> <xs:element name="FullTimeAccounts"> <xs:complexType> <xs:sequence> <xs:element name="Account" type="UserInfo" minOccurs="0" maxOccurs="unbounded"/> </xs:sequence> </xs:complexType> </xs:element> <xs:element name="PartTimeAccounts"> <xs:complexType> <xs:sequence> <xs:element name="Account" type="UserInfo" minOccurs="0" maxOccurs="unbounded" /> </xs:sequence> </xs:complexType> </xs:element> </xs:sequence> </xs:complexType> </xs:element> <xs:complexType name="UserInfo"> <xs:sequence> <xs:element name="StudentNumber"> <xs:simpleType> <xs:restriction base="xs:string"> <xs:minLength value="1"/> <xs:maxLength value="50"/> </xs:restriction> </xs:simpleType> </xs:element> <xs:element name="Password"> <xs:simpleType> <xs:restriction base="xs:string"> <xs:minLength value="6"/> <xs:maxLength value="50"/> </xs:restriction> </xs:simpleType> </xs:element> <xs:element name="Email"> <xs:simpleType> <xs:restriction base="xs:string"> <xs:pattern value="\w+([-+.']\w+)*@\w+([-.]\w+)*\.\w+([-.]\w+)*"/> </xs:restriction> </xs:simpleType> </xs:element> </xs:sequence> </xs:complexType> </xs:schema>

    Read the article

  • wsdl interoperability problems

    - by manu1001
    I wrote a .asmx web service which I'm trying to consume from a java client. I'm using axis2's wsdl2java to generate code. But it says that the wsdl is invalid. What exactly is the problem here? It is .net which generated the wsdl automatically after all. Are there problems with wsdl standards, rather the lack of them? What can I do now? I'm putting the wsdl here for reference. <?xml version="1.0" encoding="utf-8"?> <wsdl:definitions xmlns:soap="http://schemas.xmlsoap.org/wsdl/soap/" xmlns:tm="http://microsoft.com/wsdl/mime/textMatching/" xmlns:soapenc="http://schemas.xmlsoap.org/soap/encoding/" xmlns:mime="http://schemas.xmlsoap.org/wsdl/mime/" xmlns:tns="http://localhost:4148/" xmlns:s="http://www.w3.org/2001/XMLSchema" xmlns:soap12="http://schemas.xmlsoap.org/wsdl/soap12/" xmlns:http="http://schemas.xmlsoap.org/wsdl/http/" targetNamespace="http://localhost:4148/" xmlns:wsdl="http://schemas.xmlsoap.org/wsdl/"> <wsdl:types> <s:schema elementFormDefault="qualified" targetNamespace="http://localhost:4148/"> <s:element name="GetUser"> <s:complexType> <s:sequence> <s:element minOccurs="0" maxOccurs="1" name="uid" type="s:string" /> </s:sequence> </s:complexType> </s:element> <s:element name="GetUserResponse"> <s:complexType> <s:sequence> <s:element minOccurs="0" maxOccurs="1" name="GetUserResult" type="tns:User" /> </s:sequence> </s:complexType> </s:element> <s:complexType name="User"> <s:sequence> <s:element minOccurs="0" maxOccurs="1" name="HA" type="tns:ComplexT" /> <s:element minOccurs="0" maxOccurs="1" name="AP" type="s:string" /> <s:element minOccurs="0" maxOccurs="1" name="AL" type="tns:ArrayOfString" /> <s:element minOccurs="0" maxOccurs="1" name="CO" type="s:string" /> <s:element minOccurs="0" maxOccurs="1" name="EP" type="s:string" /> <s:element minOccurs="0" maxOccurs="1" name="ND" type="s:string" /> <s:element minOccurs="0" maxOccurs="1" name="AE" type="s:string" /> <s:element minOccurs="0" maxOccurs="1" name="IE" type="s:string" /> <s:element minOccurs="0" maxOccurs="1" name="IN" type="s:string" /> <s:element minOccurs="0" maxOccurs="1" name="HM" type="s:string" /> <s:element minOccurs="0" maxOccurs="1" name="AN" type="s:string" /> <s:element minOccurs="0" maxOccurs="1" name="MI" type="tns:ArrayOfString" /> <s:element minOccurs="0" maxOccurs="1" name="NO" type="s:string" /> <s:element minOccurs="0" maxOccurs="1" name="TL" type="s:string" /> <s:element minOccurs="0" maxOccurs="1" name="UI" type="s:string" /> <s:element minOccurs="0" maxOccurs="1" name="DT" type="s:string" /> <s:element minOccurs="0" maxOccurs="1" name="PT" type="s:string" /> <s:element minOccurs="0" maxOccurs="1" name="PO" type="s:string" /> <s:element minOccurs="0" maxOccurs="1" name="AE" type="s:string" /> <s:element minOccurs="0" maxOccurs="1" name="ME" type="tns:ArrayOfString" /> </s:sequence> </s:complexType> <s:complexType name="ComplexT"> <s:sequence> <s:element minOccurs="0" maxOccurs="1" name="SR" type="s:string" /> <s:element minOccurs="0" maxOccurs="1" name="CI" type="s:string" /> <s:element minOccurs="0" maxOccurs="1" name="TA" type="s:string" /> <s:element minOccurs="0" maxOccurs="1" name="SC" type="s:string" /> <s:element minOccurs="0" maxOccurs="1" name="RU" type="s:string" /> <s:element minOccurs="0" maxOccurs="1" name="HN" type="s:string" /> </s:sequence> </s:complexType> <s:complexType name="ArrayOfString"> <s:sequence> <s:element minOccurs="0" maxOccurs="unbounded" name="string" nillable="true" type="s:string" /> </s:sequence> </s:complexType> </s:schema> </wsdl:types> <wsdl:message name="GetUserSoapIn"> <wsdl:part name="parameters" element="tns:GetUser" /> </wsdl:message> <wsdl:message name="GetUserSoapOut"> <wsdl:part name="parameters" element="tns:GetUserResponse" /> </wsdl:message> <wsdl:portType name="UserServiceSoap"> <wsdl:operation name="GetUser"> <wsdl:input message="tns:GetUserSoapIn" /> <wsdl:output message="tns:GetUserSoapOut" /> </wsdl:operation> </wsdl:portType> <wsdl:binding name="UserServiceSoap" type="tns:UserServiceSoap"> <soap:binding transport="http://schemas.xmlsoap.org/soap/http" /> <wsdl:operation name="GetUser"> <soap:operation soapAction="http://localhost:4148/GetUser" style="document" /> <wsdl:input> <soap:body use="literal" /> </wsdl:input> <wsdl:output> <soap:body use="literal" /> </wsdl:output> </wsdl:operation> </wsdl:binding> <wsdl:binding name="UserServiceSoap12" type="tns:UserServiceSoap"> <soap12:binding transport="http://schemas.xmlsoap.org/soap/http" /> <wsdl:operation name="GetUser"> <soap12:operation soapAction="http://localhost:4148/GetUser" style="document" /> <wsdl:input> <soap12:body use="literal" /> </wsdl:input> <wsdl:output> <soap12:body use="literal" /> </wsdl:output> </wsdl:operation> </wsdl:binding> <wsdl:service name="UserService"> <wsdl:port name="UserServiceSoap" binding="tns:UserServiceSoap"> <soap:address location="http://localhost:4148/Service/UserService.asmx" /> </wsdl:port> <wsdl:port name="UserServiceSoap12" binding="tns:UserServiceSoap12"> <soap12:address location="http://localhost:4148/Service/UserService.asmx" /> </wsdl:port> </wsdl:service> </wsdl:definitions>

    Read the article

  • Concatenating several .mp3 files into one .mp3

    - by Bakhtiyor
    As it was suggested here I am using cat command to concatenate several .mp3 files into one .mp3 file. Imagine, I have following .mp3 files in the current folder: 001001.mp3 001002.mp3 001003.mp3 001004.mp3 001005.mp3 or, like this: 096001.mp3 096002.mp3 096003.mp3 096004.mp3 I need to concatenate these .mp3 files in there ascending sequence, i.e. 001001.mp3+001002.mp3+001003.mp3+etc. In order to join these .mp3 files into one I am executing following command in the current folder: cat *.mp3 > final.mp3 I tested the final .mp3 file and it is what I am expected, but I need to be sure that above command picks files in there ascending sequence. Can I be sure that above command always concatenates files in the ascending sequence? Thank you Sir!

    Read the article

  • Project Euler 2: (Iron)Python

    - by Ben Griswold
    In my attempt to learn (Iron)Python out in the open, here’s my solution for Project Euler Problem 2.  As always, any feedback is welcome. # Euler 2 # http://projecteuler.net/index.php?section=problems&id=2 # Find the sum of all the even-valued terms in the # Fibonacci sequence which do not exceed four million. # Each new term in the Fibonacci sequence is generated # by adding the previous two terms. By starting with 1 # and 2, the first 10 terms will be: # 1, 2, 3, 5, 8, 13, 21, 34, 55, 89, ... # Find the sum of all the even-valued terms in the # sequence which do not exceed four million. import time start = time.time() total = 0 previous = 0 i = 1 while i <= 4000000: if i % 2 == 0: total +=i # variable swapping removes the need for a temp variable i, previous = previous, previous + i print total print "Elapsed Time:", (time.time() - start) * 1000, "millisecs" a=raw_input('Press return to continue')

    Read the article

  • RPi and Java Embedded GPIO: Sensor Connections for Java Enabled Interface

    - by hinkmond
    Now we're ready to connect the hardware needed to make a static electricity sensor for the Raspberry Pi and use Java code to access it through a GPIO port. First, very carefully bend the NTE312 (or MPF-102) transistor "gate" pin (see the diagram on the back of the package or refer to the pin diagram on the Web). You can see it in the inset photo on the bottom left corner. I bent the leftmost pin of the NTE312 transistor as I held the flat part toward me. That is going to be your antenna. So, connect one of the jumper wires to the bent pin. I used the dark green jumper wire (looks almost black; coiled at the bottom) in the photo. Then push the other 2 pins of the transistor into your breadboard. Connect one of the pins to Pin # 1 (3.3V) on the GPIO header of your RPi. See the diagram if you need to glance back at it. In the photo, that's the orange jumper wire. And connect the final unconnected transistor pin to Pin # 22 (GPIO25) on the RPi header. That's the blue jumper wire in my photo. For reference, connect the LED anode (long pin on a common anode LED/short pin on a common cathode LED, check your LED pin diagram) to the same breadboard hole that is connecting to Pin # 22 (same row of holes where the blue wire is connected), and connect the other pin of the LED to GROUND (row of holes that connect to the black wire in the photo). Test by blowing up a balloon, rubbing it on your hair (or your co-worker's hair, if you are hair-challenged) to statically charge it, and bringing it near your antenna (green wire in the photo). The LED should light up when it's near and go off when you pull it away. If you need more static charge, find a co-worker with really long hair, or rub the balloon on a piece of silk (which is just as good but not as fun). Next blog post is where we do some Java coding to access this sensor on your RPi. Finally, back to software! Ha! Hinkmond

    Read the article

  • Escaping In Expressions

    The expressions language is a C style syntax, so you may need to escape certain characters, for example: "C:\FolderPath\" + @VariableName Should be "C:\\FolderPath\\" + @VariableName Another use of the escape sequence allows you to specify character codes, like this \xNNNN, where NNNN is the Unicode character code that you want. For example the following expression will produce the same result as the previous example as the Unicode character code 005C equals a back slash character: "C:\x005CFolderPath\x005C" + @VariableName For more information about Unicode characters see http://www.unicode.org/charts/ Literals are also supported within expressions, both string literals using the common escape sequence syntax as well as modifiers which influence the handling of numeric values. See the "Literals (SSIS)":http://msdn2.microsoft.com/en-US/library/ms141001(SQL.90).aspx topic. Using the Unicode escaped character sequence you can make up for the lack of a CHAR function or equivalent.

    Read the article

  • multiple project [closed]

    - by user1783508
    I want a application in which I can create multiple project ex illustration [-] project 1 requirement arhitecture design test [-] project 2 requirement arhitecture design test create any Uml diagram Ex illustration add class diagram add use case add etc. and many other feature. In other words, I want an application like eclipse but for software documentation namely requirement, design etc.

    Read the article

  • Parallel Data Warehouse

    - by jchang
    The Microsoft Parallel Data Warehouse diagram was somewhat difficult to understand in terms of the functionality of each subsystem in relation to the configuration of its components. So now that HP has provided a detailed list of the PDW components , the diagram below shows the PDW subsystems with component configuration (InfiniBand, FC, and network connections not shown). Observe that there are three different ProLiant server models, the DL360 G7, DL370 G6 and the DL380 G7, in five different configurations...(read more)

    Read the article

< Previous Page | 27 28 29 30 31 32 33 34 35 36 37 38  | Next Page >