Search Results

Search found 19279 results on 772 pages for 'everything'.

Page 343/772 | < Previous Page | 339 340 341 342 343 344 345 346 347 348 349 350  | Next Page >

  • JBoss DataSource - How can ConnectionCount be larget than MaxSize?

    - by Qben
    I am running JBoss 4.0.5GA and I have stumbled upon a strange scenario (In my eyes anyway). When I decreases the <max-connections> to 1 for a Quartz DataSource and restart the server everything works fine. When I check the JMX console I can see that ConnectionCount and MaxConnectionInUseCount are both 2. The question is, how can the ConnectionCount be higher than the pool MaxSize (Which is 1 in JMX console as expected)? As a note I did this to try to trigger a production problem I have from time to time where a Quartz DB connection cannot be retrieved for some odd reason (Pool not full).

    Read the article

  • Best way to generate pieces in match-3 games, and then tracking them?

    - by JonLim
    I've been working on a match-3 style game in Actionscript using Flixel, and so far, I've been able to build the core mechanics of the game, including board generation, piece generation, piece swapping and movement, and checking algorithms. However, I am now running into issues with clearing out pieces and letting the above pieces fall down and generating new pieces. The reason I'm running into these issues is that when all of the pieces are generated, the pertinent values (position, sprite ID, and sprite object) are pushed into an array that helps me track everything, all the time. When pieces are moved, I swap the values of the corresponding arrays and life goes on. And that array is the core of my problem: if a row in the middle of the board clears out, ideally, all of the pieces above the cleared pieces should fall down to take their place and new pieces are generated at the top and also fall into place. Except if I try to do that now, all the pieces can fall down, but then I'd have to bump all of their values into the right arrays (oh god my head) and then generate new pieces and fit THOSE into the correct place in the array. Am I overthinking this? Or is there a far better way to track these pieces? Thanks guys!

    Read the article

  • Can i change the subnet on the vpn side of a server without having to change its whole lan (to avoid collission)

    - by Gusty
    Ohai, ive got a xp server with a client connecting via VPN. Problem (as we all know) is that sometimes the subnets clash. Instead of changing the whole server network every time this happens, cant i just have the server appear to have a different subnet to vpn clients? I have no interest in accessing other computers than the server on its LAN. I tried just turning off automatic dhcp in the servers vpn settings and changed it to 172.31.255.x. The client gets the address assigned alright and it can ping 172.31.255.1 but i cannot ping the server name (because the dns on the clients vpn connection points at 192.168.0.1?) wisdom? PS everything worked until the client hit a network with the same subnet as the server lan. thanks

    Read the article

  • Hard drive skipped in boot

    - by Yasin
    Good evening. I just installed Ubuntu 12.04 using a USB, but right after the install, after restarting the machine, I get a message asking me to insert a bootable drive. My boot settings in Bios have the hard drive first, then DVD, then USB stick, and I have two systems installed, Windows 7 and Ubuntu 12.04. I suspected the hard drive got somehow disconnected internally, so I checked but everything was in place. I used the live USB to start Ubuntu, and I could see the hard drive and mount whatever partition I wanted. The one that contains the recently installed Ubuntu, looks the same. (It hasn't been deleted or anything). I'm not sure if this is a hardware problem or a loader(grub) problem, because the hard drive is visible. Only it isn't seen by the BIOS. My only means of internet connection is a USB modem, which doesn't work when I'm using the live USB, so I have can't download anything from the internet, in case someone asks. I also reinstalled Ubuntu 12.04, to no avail. This is my second problem with this laptop, and Ubuntu, and it's not even a week old. I hope this one gets solved. Thank you.

    Read the article

  • preloading RSS contents in thunderbird, before actually reading them

    - by Berry Tsakala
    i have thunderbird 3.x, and i'm subscribed to several RSS feeds. How can I tell thunderbird to load/download any new RSS items in the background? The usual behavior with RSS feeds is that it download the headrs, or few introductory lines from the contents, but only when i'm clicking a feed item it starts loading "for real". I really want to receive the feeds and not to wait for them to load, the same way i receive emails in any email client - all messages are fully downloaded at once. there could be several reasons, BTW. - e.g. if i have short connection time, i'd rather connect, sync everything at once, and read it later. - or if i have a slow wifi connection, it's annoying to wait for each and every message, but the computer is idle while reading.. thanks

    Read the article

  • After moving our Servers to a virtual environment using VMware - SQL timeouts came in, why?

    - by RayofCommand
    We moved our servers to a virtual cloud (VMware) where only our servers are in. But as soon as we finished migrating everything we are fighting against SQL Timeouts and machine slowdowns we can't explain. Even though we ~ doubled the servers capacity while switching from physical to virtual. Now I googled and found that we are not alone. People are complaining about poor performance after moving to a cloud managed by VMware. Are there any known issues? Sometimes our services can't access a disk or SQL receives a timeout and we have no idea why.

    Read the article

  • ASUS N550 laptop not charging on ubuntu after updating kernel

    - by OBY Trance
    I'm using Ubuntu 13.10 on a pretty new ASUS N550jv laptop. When I was using kernel linux-image-3.11.0-11 everything was quite well (kinda..), however, when I updated the kernel using the automatic update, the kernels which were released afterwards (12+) were faulty on my machine, and caused the battery not to be charged and only stay at their current charging level (even when the machine was off!) The only fix I had was to roll-back to the '..11' version (on boot screen - advanced options), and hard-reboot (AC cord disconnected and reconnected) but now version 14 was released and "pushed away" the good old version 11. How can I fix that?? Please help me...

    Read the article

  • Software/internet

    - by Yiannis
    Hi guys, i am using XP SP2, and everything where working fine. Somehow i can go to some web pages, but i cant login to them, for example www.buzzerbeater.com, i cant access my hotmail/msn, outlook doesnt work either, also www.realgm.com, i cant access the forums too. I have tried with IE7/Firefox/Chrome, but same result. I was using avast free edition that i removed, and i dont have any other security software installed. My laptop from the same network works perfectly. Any ideas?

    Read the article

  • Convert text to table

    - by Quattro
    I would like convert text into a table. Here is a link to the text http://www.tcdb.org/public/tcdb Short example: >gnl|TC-DB|A0CIB0|1.A.17.3.1 Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1 MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI >gnl|TC-DB|A0CS82|9.B.82.1.5 Chromosome undetermined scaffold_26, whole genome shotgun sequence - Paramecium tetraurelia. MIIEEQIEEKMIYKAIHRVKVNYQKKIDRYILYKKSRWFFNLLLMLLYAYRIQNIGGFYI VTYIYCVYQLQLLIDYFTPLGLPPVNLEDEEEDDDQFQNDFSELPTTLSNKNELNDKEFR PLLRTTSEFKVWQKSVFSVIFAYFCTYIPIWDIPVYWPFLFCYFFVIVGMSIRKYIKHMK KYGYTILDFTKKK I wanted to have columns for example delimited with pipe | or ; |>gnl|TC-DB|A0CIB0|1.A.17.3.1| Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1| MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI I am working with Windows and I don't know how to do it I just know every row starts with > I want to substitute the first whitespace in a row with a delimiter like | or ; after the first regular expression new line in a row, I want also a delimiter everything between the regular expression first new line and > should go into a new column (it's a sequence of a protein)

    Read the article

  • A Duplicate name exists on the network

    - by Adam
    Recently we changed out office IT structure from having a dedicated server to be the DC, a dedicated server for the exchange etc... (Each running Windows Server 2003 R2) Now we have a single server running Windows SBS 2008 and created a new domain (with a different domain name) We then changed every PC so it connected to the new domain and renamed every PC with a new naming structure. After I had done this, we were getting several PCs that would get the following message just before the login screen (Alt+Ctrl+Del Screen) A Duplicate name exists on the network I have checked the ADUC and have removed the trouble PCs from the list and renamed each PC and changed the SID before connecting back onto the domain but still getting this message. I have tried everything that i can think of but still getting the problem. Any help would be greatly appreticated.

    Read the article

  • how to restore windows 7 to a know working state every time it boots

    - by Artanis
    A couple of days ago my mother asked me to set up a computer at his house, she wants to use it to basic web browsing, video chat and nothing more. The problem is, neither my mother nor my sister know anything about using or maintaining a computer. What I want is to have a working base install of windows 7 and just discard everything installed, downloaded, ... when it reboots. That way I can set up a partition just for saving files and whatever they do the computer will always return to a working state at start up. can that be done? PS: Sadly linux is not an option since my sister wants to be able to play some games with my steam account and not all of them run with wine.

    Read the article

  • Windows 7 extremely long startup

    - by Tyler
    Windows 7 before it even gets to login. On the "starting windows" splash screen takes no less than 15 minutes to finish more like 25 minutes most times. During this time the hard drive activity led indicator is blinking maybe once every 20 seconds. When I finally get to the desktop everything runs normally. I have unplugged all peripherals with same result. Ideas? It's 32bit. 4gig memory. Fast CPU which I can't recall off the top of my head.

    Read the article

  • No file sharing between two server 2008 R2 machines.

    - by ProfKaos
    I have just replaced XP with Server 2008 R2 on my test sever, and have been running 2008 R2 on my dev laptop. When my server was still XP, file sharing just worked, but now it just doesn't. I've enabled everything I can about sharing, and I can ping the server by machine name, but if I try an access a share, I get asked for a password. The passowrd dialog assumes a domain for this user, but neither my laptop admin user nor my server admin user can get past this login. What am I doing wrong?

    Read the article

  • USB drivers stopped working in Windows 8

    - by Maxim V. Pavlov
    I have installed an MSDN version of Windows 8 Professional (x64) RTM. For about 3 restarts everything worked well. But once I've rebooted again - USB drivers (all of them, inluding the USB 3 drivers) stopped working. Device Manager properties said that the USB driver is not compatible with the system. Gigabyte doesn't list Windows 8 drivers for my MB X58A-UD3R. Tried to reinstall windows 7 USB drivers - system said the current driver is fine and didn't want to reinstall. Is this the common Windows 8 problem? How can solve it or debug it even more?

    Read the article

  • Running JBoss 6 with Runit / daemontools or other process supervision framework

    - by Alex Recarey
    I'm tying to use runit to daemonize JBoss. I use the /opt/jboss-6.1.0.Final/bin/run.sh script to start the server. When I do so from the comandline, JBoss does not detach (which is what we want), and will also shut down when CTRL+C is pressed. In theory a perfect candidate to use runit on. Everything works fine except when I try to get runit to shut down JBoss. When I issue the command sv stop jboss nothing happens. Runit thinks the process is stopped but jboss continues to run normally. I'm not doing anything special with the run script. This is my runit run script: #!/bin/sh exec 2>&1 exec /opt/jboss-6.1.0.Final/bin/run.sh -c standard -b 0.0.0.0 Looking at the jboss_init_redhat.sh script, the start section does mention ./bin/run.sh but the stop section has the following text: JBOSS_CMD_STOP=${JBOSS_CMD_STOP:-"java -classpath $JBOSSCP org.jboss.Shutdown --shutdown"} Any ideas of what I could try?

    Read the article

  • Can't see CMD.EXE on Windows 7

    - by Andrea
    I have a problem with Windows 7 and cmd.exe with these conditions: Logon as non admin user Launch cmd.exe I can see cmd.exe in task manager but it's invisible in the desktop and I don't know what to do, everything is fine and I can see cmd.exe if I do login with an admin account. I can see it in the "Process" tab but not in the "Application" tab, and if I launch five cmd.exe's, I see five processes, but from that tab I have no "Bring to front" or "Maximise" I can't find any WOW folder under C:\Windows, even with show hidden and system files enabled. I'm running Windows 7 32-bit running on a 64-bit Intel Core 2 Duo E7500

    Read the article

  • Lost current user (shutdown/logoff) widget after upgrading to Ubuntu 10.04

    - by xyzman
    I've upgraded to 10.04 from 9.10. Everything went fine until I've rebooted. After reboot, I've received some message about status panel and being sleepy, dismissed it. However, I haven't seen the user widget on Gnome Panel since that. This image shows which widget I'm talking about. If some one has any ideas about how it's called properly, please share. http://img237.imageshack.us/img237/8274/sampleyu.jpg Anyway, the question is, how do I turn this panel (and ability to shut my system down without resorting to console) back?

    Read the article

  • Somehow Google considers a properly 301'd URL as 200 and is still indexing the new content in old page?

    - by user2178914
    We redirected all the old URL's to new ones properly using htaccess. The problem is Google, somehow is still finding content in the old page(which it shouldn't) and stores it in the cache rather than the new URL. For eg: Old Page- http://www.natures-energies.com/iching.htm New Page- http://www.natures-energies.com/index.php?option=com_content&view=article&id=760 If you type the old URL into the browser it redirects If you fetch the old URL as Googlebot in the webmaster tools the header says 301/permanently redirected. If I try to crawl as any other bot it still says 301 redirected. Even if you click the old link in Google it redirects to the new URL. Only in its cache it shows the old URL and moreover it shows the new content in it! I am stumped on how Google manages to grab the new content and puts in the old URL instead of the new one! One more interesting thing is that if I try a cache for the new page it shows the cache of the new content with old URL! Any help would be appreciated. I am at end of my wits. I think i have tried almost everything. Is there anything that I'm missing to see? You can use this search to find the old url's. Maybe you'll some patterns that i missed. site:www.natures-energies.com inurl:htm -inurl:https|index

    Read the article

  • "The requested operation could not be completed due to a file system limitation" 3202

    - by user46529
    I backup SQL Server database and it fails BACKUP DATABASE dd TO DISK = '\backupServer\backups\dd.bak' WITH COMPRESSION, CHECKSUM, NOFORMAT, INIT , BlockSize = 65536 , BufferCount = 2200 , MaxTransferSize = 4194304 The backup size is 3TB and I have 6TB free space on bacup server. I am using backup parameters per SQLCAT whitepaper. Everything works ok when I backup to local HDD and it always fails when I backup to network share. After about 6 hours. Can't find why. Thank you. Yes. The backup over the network is fastest and saves me 3Tb of local disk space :) Thanks for pointing to the memory issue. I left 4Gb to OS and it worked!

    Read the article

  • LVM vs RAID0 vs RAID "linear" - Combine 2 disks as one, data recovery?

    - by leto
    Hi there, given two 2TB USB external disks that have to be combined to one 4TB volume and formatted with one big Filesystem (XFS), I have a small question to ask. Does LVM provide better Data recovery, should one disk be unplugged/damaged by being able to recover the data of the still working disk or is everything lost? I would appreciate a solution where only the data of one disk is lost and I can recover the content of the other with the usual filesystem/lvm/raid tools. Is that possible with LVM or RAID "linear"? This is for storing unimportant files that can be retrieved from backup, but I want to save time :) Thank you in advance

    Read the article

  • What is the best resource or method for learning more about servers and networking?

    - by kaleidomedallion
    I can get around a server to some degree, but everything I have learned has been as I have needed to learn it. Every once in a while I will learn about some new command that will revolutionize how I think about systems and networking, and realize how I could have been using it this whole time if only I had known about it. Anything to bring someone from novice to some kind of fluency? Do I just need to earn the battle scars bit by bit over the course of years? (I mean of course I do but what can I do to help it be not quite so painful?) For instance, I am still fuzzy on all of networking. Any help would be greatly appreciated.

    Read the article

  • pfSense router gives DNS rebinding warning when accessing subdomains

    - by Richard Maddis
    I have just set up a router running pfSense on our network and forwarded the appropriate ports. I have a small web server running in my network, and a domain name pointing to our (WAN) IP. When accessing that domain name, everything works fine. However, when accessing a subdomain of the domain name, pfSense will give a DNS rebinding warning. This did not happen back when I used a DD-WRT router. What is the proper way to fix this? The DNS records for the subdomain also point to the same address (I use a virtual server to differentiate the subdomains.)

    Read the article

  • Mysql process goes over 100% of CPU usage

    - by Temnovit
    Hello! I'm experiencing some problems with my LAMP server. Recently, everything became very slow, even though visitor count on my websites didn't change to much. When I run top command, it sais that mysql process has taken over 150-200% of CPU. How's that possible, I always thought that 100% is a maximum? I'm running Ubuntu 9.04 server edition with 1,5 GB RAM my.cnf settings: key_buffer = 64M max_allowed_packet = 16M thread_stack = 192K thread_cache_size = 8 myisam-recover = BACKUP max_connections = 200 table_cache = 512 table_definition_cache = 512 thread_concurrency = 2 read_buffer_size = 1M sort_buffer_size = 4M join_buffer_size = 1M query_cache_limit = 1M # the maximum size of individual query results query_cache_size = 128M Here is the output of MySQLTuner: The top command: What could be the cause of this problem? Can I make changes to my my.cnf to prevent server from hanging?

    Read the article

  • My Mac Book Pro is turning itself, on my bagpack

    - by J. Pablo Fernández
    This happens to me twice: I press the power button on my Mac Book Pro, I choose sleep, I close it, I unplug everything, I confirm that is off (by pressing my ear to it) and put it in my back. Some minutes latter it wakes up by itself. Both times I caught it in time, well, the second time it was so hot I couldn't touch some parts and it was refusing to actually wake up, the screen was blank. Restarting it worked though. Any ideas what might be going on and/or how to prevent this?

    Read the article

  • Is GPU active when there are not any monitors?

    - by Mixer
    Does GPU render anything when there is no monitor plugged in? Today I turned my old PC into some kind of a "server" which means that I want it running 24/7. I don't need any display (I will operate through ssh) so when everything was set up I removed my monitor. After a hour I checked my graphic card's cooling system and it was still hot. My graphic card is GeForce 8600 (with DVI connector), OS is Debian Linux. What is the best solution in this situation (standalone server) if GPU is active and I don't want it to waste power?

    Read the article

< Previous Page | 339 340 341 342 343 344 345 346 347 348 349 350  | Next Page >