Search Results

Search found 19279 results on 772 pages for 'everything'.

Page 343/772 | < Previous Page | 339 340 341 342 343 344 345 346 347 348 349 350  | Next Page >

• Excel 2010 -Excel cannot complete this task with available resources

  - by Jestep

  Getting this error when trying to sort a document (Excel cannot complete this task with available resources). Document isn't particularly large, about 4,000 lines. Can't seem to figure out why this would start on this. I can sort this same file fine on everything back to Excel 2000 on older crappy computers. Computer is running Win 7 x64, 16 Gb RAM, and another 16 Gb of virtual. There's no possible way that all of the memory is actually getting exhausted when I can perform this on an older XP machine with 512 Mb of RAM, unless 2010's memory usage is inconceivably poorly designed. I found a few posts on forums stating that there might be a security update related bug. Any suggestions would be appreciated.

  Read the article

• "The requested operation could not be completed due to a file system limitation" 3202

  - by user46529

  I backup SQL Server database and it fails BACKUP DATABASE dd TO DISK = '\backupServer\backups\dd.bak' WITH COMPRESSION, CHECKSUM, NOFORMAT, INIT , BlockSize = 65536 , BufferCount = 2200 , MaxTransferSize = 4194304 The backup size is 3TB and I have 6TB free space on bacup server. I am using backup parameters per SQLCAT whitepaper. Everything works ok when I backup to local HDD and it always fails when I backup to network share. After about 6 hours. Can't find why. Thank you. Yes. The backup over the network is fastest and saves me 3Tb of local disk space :) Thanks for pointing to the memory issue. I left 4Gb to OS and it worked!

  Read the article

• HP Virtual Connect and VLAN Tagging

  - by JaapL

  We have a c7000 chasis with the ability to have 8 uplinks per ESX host. Only 6 are currenlty active. I have a Virtual Switch with multiple vlan port groups and all the VMs are working fine. Recently we've been asked to setup network load balancing for one of our VMs, so we had our Virtual Connect engineer activate the last two uplinks. We then created a new vSwitch and added the two new uplinks to this vSwitch. We then moved the VM to this new vSwitch, but we get no connectivity. What could be the issue? We also added the appropriate VLAN ID. The VConnect engineer says everything is configured correctly and networking TEAM says the appropriate trunking is setup, so we are at a loss...

  Read the article

• Port Forwarding IPTABLES public IP

  - by tric

  hello i have a computer linuxbox_1.eth0 public ip 89.40.x.y eth1 public ip 85.121.a.b i have another linuxbox_2. ethx public ip 86.34.c.d what i want to do is forward port 8001 from linuxbox_1 eth0 89.40.x.y:8001 to linuxbox_1 eth1 85.121.a.b, and then forward again port 8001 from linuxbox_1 eth1 85.121.a.b:8001 to linuxbox_2 ethx 86.34.c.d:80 i have searched for answers using google "that knows everything" but this time it has failed. i would like to use IPTABLES or any other tool like rinetd. i tryed rinetd but it somehow mistakes the eths sorry for my bad english. 10q

  Read the article

• Convert text to table

  - by Quattro

  I would like convert text into a table. Here is a link to the text http://www.tcdb.org/public/tcdb Short example: >gnl|TC-DB|A0CIB0|1.A.17.3.1 Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1 MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI >gnl|TC-DB|A0CS82|9.B.82.1.5 Chromosome undetermined scaffold_26, whole genome shotgun sequence - Paramecium tetraurelia. MIIEEQIEEKMIYKAIHRVKVNYQKKIDRYILYKKSRWFFNLLLMLLYAYRIQNIGGFYI VTYIYCVYQLQLLIDYFTPLGLPPVNLEDEEEDDDQFQNDFSELPTTLSNKNELNDKEFR PLLRTTSEFKVWQKSVFSVIFAYFCTYIPIWDIPVYWPFLFCYFFVIVGMSIRKYIKHMK KYGYTILDFTKKK I wanted to have columns for example delimited with pipe | or ; |>gnl|TC-DB|A0CIB0|1.A.17.3.1| Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1| MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI I am working with Windows and I don't know how to do it I just know every row starts with > I want to substitute the first whitespace in a row with a delimiter like | or ; after the first regular expression new line in a row, I want also a delimiter everything between the regular expression first new line and > should go into a new column (it's a sequence of a protein)

  Read the article

• Very frequent "Server not found" messages

  - by Village

  Recently, while browsing and clicking or typing an address, I get: "Server not found", "Connection was reset", or a half-loaded page. Usually the page loads instantly after clicking reload, but this means I must reload on every page. Images on one site, but stored at a different server don't load until reloading for a second time. Clicking "submit" on many sites frequently doesn't work unless I reload many times. Sometimes sites load, but without colors and formating, appearing as if they would in Lynx. This seems to happen with every Web site. My Internet service claims everything on their end is fine. This happened a day after running an update in aptitude. I have not updated any hardware. I have tried clearing Iceweasel's cache. I do not have any router or other equipment. What could be going on? How can I troubleshoot this? PPPoE connection, Iceweasel 3.5.16, Debian 6

  Read the article

• How should I structure the implementation of turn-based board game rules?

  - by Setzer22

  I'm trying to create a turn-based strategy game on a tilemap. I'm using design by component so far, but I can't find a nice way to fit components into the part I want to ask. I'm struggling with the "game rules" logic. That is, the code that displays the menu, allows the player to select units, and command them, then tells the unit game objects what to do given the player input. The best way I could thing of handling this was using a big state machine, so everything that could be done in a "turn" is handled by this state machine, and the update code of this state machine does different things depending on the state. However, this approach leads to a large amount of code (anything not model-related) going into a big class. Of course I can subdivide this big class into more classes, but it doesn't feel modular and upgradable enough. I'd like to know of better systems to handle this in order to be able to upgrade the game with new rules without having a monstruous if/else chain (or switch / case, for that matter). Any ideas? What specific design pattern other than MVC should I be using?

  Read the article

• Multi-monitor resolution and position settings lost after reboot

  - by SoftDeveloper

  I've had two 1280x1024 monitors running for years on an nVidia 8800GT card with no problems. I've now replaced one monitor with a new 2560x1440 one. The card seems to support both fine, however every time I reboot the resolutions and monitor positions revert to the old settings. I've tried upgrading, downgrading, stripping out and reinstalling many versions of the nvidia drivers to no avail. Logging in as another user doesn't help - same problem. Booting into another another OS (Win7 64) works OK, so it is just this OS installation. During boot up everything looks fine (ie native 2450x1440 res) until the nVidia control panel or something is loaded which flips it back into the old mode. I have no old saved nvidia profiles. I can't find anything in the registry relating to these old settings. Its driving me crazy having to set resolutions and realign monitors on every reboot! Can anybody help?

  Read the article

• Hard drive skipped in boot

  - by Yasin

  Good evening. I just installed Ubuntu 12.04 using a USB, but right after the install, after restarting the machine, I get a message asking me to insert a bootable drive. My boot settings in Bios have the hard drive first, then DVD, then USB stick, and I have two systems installed, Windows 7 and Ubuntu 12.04. I suspected the hard drive got somehow disconnected internally, so I checked but everything was in place. I used the live USB to start Ubuntu, and I could see the hard drive and mount whatever partition I wanted. The one that contains the recently installed Ubuntu, looks the same. (It hasn't been deleted or anything). I'm not sure if this is a hardware problem or a loader(grub) problem, because the hard drive is visible. Only it isn't seen by the BIOS. My only means of internet connection is a USB modem, which doesn't work when I'm using the live USB, so I have can't download anything from the internet, in case someone asks. I also reinstalled Ubuntu 12.04, to no avail. This is my second problem with this laptop, and Ubuntu, and it's not even a week old. I hope this one gets solved. Thank you.

  Read the article

• pfSense router gives DNS rebinding warning when accessing subdomains

  - by Richard Maddis

  I have just set up a router running pfSense on our network and forwarded the appropriate ports. I have a small web server running in my network, and a domain name pointing to our (WAN) IP. When accessing that domain name, everything works fine. However, when accessing a subdomain of the domain name, pfSense will give a DNS rebinding warning. This did not happen back when I used a DD-WRT router. What is the proper way to fix this? The DNS records for the subdomain also point to the same address (I use a virtual server to differentiate the subdomains.)

  Read the article

• Apache2: How do I restrict access to a directory, but allow access to one file within it?

  - by Nick

  I've inherited a poorly designed web app, which has a certain file that needs to be publicly accessible, but that file is inside a directory which should not. In other words, I need a way to block all files and sub-directories within a directory, but over-ride it for a single file. I'm trying this: # No one needs to access this directly <Directory /var/www/DangerousDirectory/> Order Deny,allow Deny from all # But this file is OK: <Files /var/www/DangerousDirectory/SafeFile.html> Allow from all </Files> </Directory> But it's not working- it just blocks everything including the file I want to allow. Any suggestions?

  Read the article

• Writing better timesheet

  - by gunbuster363

  Recently, my company started to require us to fill out a monthly timesheet, writing down everything you do in office. A timesheet contain 29-31 days, depends on the number of days of the month. I need to write the things I did in every row of the excel file, which represent a day. This timesheet embarrasses me, because something like this can happen: I spent Monday writing a program, and the program was done. Because my boss didn't give me other program to write, basically I am just sitting there and pretending I am busy in the following days before my boss gives me another assignment. Of course I should not write it in the timesheet as it is. I can write it in the timesheet that I write the program using 4 days, but it makes me feel very inefficient. I can separate the process into 1) write the program, 2)deploy the program, 3)test the program, but that can make the process so long like 3 weeks, really. Have you encountered such a situation? How would you deal with this? EDIT: some people said I should be more proactive about asking for more assignments, but here is the situation: the boss of my boss gives some jobs to my boss, then my boss gives the jobs to me, sometimes I can also see my boss being quite less busy. One of my colleagues said that I should not ask for another assignment in a proactive manner, because it would be a headache for my boss to think a job out of nowhere for me. I don't want the things turn out like that, really.

  Read the article

• Getting a Cross-Section from Two CSV Files

  - by Jonathan Sampson

  I have two CSV files that I am working with. One is massive, with about 200,000 rows. The other is much smaller, having about 12,000 rows. Both fit the same format of names, and email addresses (everything is legit here, no worries). Basically I'm trying to get only a subset of the second list by removing all values that presently exist in the larger file. So, List A has ~200k rows, and List B has ~12k. These lists overlap a bit, and I'd like to remove all entries from List B if they also exist in List A, leaving me with new and unique values only in List B. I've got a few tooks at my disposal that I can use. Open Office is loaded on this machine, along with MySQL (queries are alright). What's the easiest way to create a third CSV with the intersection of data?

  Read the article

• after BIOS splash, will not boot -- asks me to select an OS, but it just reboots

  - by user92040

  I'm running Linux Mint 13 MATE 64-bit. Everything has been working for several weeks. Yesterday, when I tried to boot up my computer, after the BIOS screen flashes I reach a screen with a black background that reads at the top: GNU GRUB version1.99-21ubuntu3.4 Then there is a box in which I can select from the following lines: Linux Mint 13 MATE 64-bit, 3.2.0-31-generic (/dev/sdb2) Linux Mint 13 MATE 64-bit, 3.2.0-31-generic (/dev/sdb2) -- recovery mode Previous Linux versions Memory test (memtest86+) Memory test (memtest86+, serial console 115200) At the bottom it reads: Use the ? and ? keys to select which entry is highlighed. Press enter to boot the selected OS, 'e' to edit the commands before booting or 'c' for a command-line. I have no idea why it started doing this and, worse, I have no idea how to get out of here. No matter which option I select, I can't get it to boot the OS. If I select either of the first two, it reboots to splash the BIOS and then I'm right back where I started. If I choose "Previous Linux versions" I get essentially the same screen with only two choices (which are the same as the first two choices listed above, Linux 13 MATE and the recovery mode). Again, choosing either one of those results in a reboot. If I try to run either of the memtest options, it reads: error: unknown command 'linux16', Press any key to continue... Then it brings me back to the same screen Can anyone help me please? Intel Core i5-2500 ASUS P8Z68-V LX Intel Motherboard G. Skill Ripjaws series F3-12800CL9D-8GBRL (4GB x2) Plextor 128GB M5S Series SSD

  Read the article

• Node.js installation on Debian 6

  - by pvorb

  I used to use this method for node.js installation on Debian, since it was easy and everything worked fine. Even with multiple users. Since version 0.6.18~dfsg1-1 of the sid package, installation removes openssh-server. But I need OpenSSH to connect to my server. Is there any possibility to install Node.js via APT or do I have to compile it manually? This is my APT preferences file: Package: * Pin: release a=stable Pin-Priority: 800 Package: * Pin: release a=testing Pin-Priority: 650 Package: * Pin: release a=unstable Pin-Priority: 600

  Read the article

• A Duplicate name exists on the network

  - by Adam

  Recently we changed out office IT structure from having a dedicated server to be the DC, a dedicated server for the exchange etc... (Each running Windows Server 2003 R2) Now we have a single server running Windows SBS 2008 and created a new domain (with a different domain name) We then changed every PC so it connected to the new domain and renamed every PC with a new naming structure. After I had done this, we were getting several PCs that would get the following message just before the login screen (Alt+Ctrl+Del Screen) A Duplicate name exists on the network I have checked the ADUC and have removed the trouble PCs from the list and renamed each PC and changed the SID before connecting back onto the domain but still getting this message. I have tried everything that i can think of but still getting the problem. Any help would be greatly appreticated.

  Read the article

• USB drivers stopped working in Windows 8

  - by Maxim V. Pavlov

  I have installed an MSDN version of Windows 8 Professional (x64) RTM. For about 3 restarts everything worked well. But once I've rebooted again - USB drivers (all of them, inluding the USB 3 drivers) stopped working. Device Manager properties said that the USB driver is not compatible with the system. Gigabyte doesn't list Windows 8 drivers for my MB X58A-UD3R. Tried to reinstall windows 7 USB drivers - system said the current driver is fine and didn't want to reinstall. Is this the common Windows 8 problem? How can solve it or debug it even more?

  Read the article

• Why is only one domU giving me the "time went backwards"?

  - by Paul Tomblin

  I'm setting up a replacement server for one that was working ok but is having hardware issues. The original server is i686 (Pentium III), but the new one is amd64 (Xeon). Everything is working fine, except one of the three domUs is giving me the "clocksource/0: Time went backwards" error. The Debian Wiki says what to do if all your domUs are getting this error, but not what to do if only one of them has. The "tenants" on my domUs have done some messing about with the systems I configured for them. I don't know what the user of that particular domU might have done.

  Read the article

• How could there still not be a mysqldb module for Python 3? [closed]

  - by itsadok

  This SO question is now more than two years old. MySQL is an incredibly popular database engine, Python is an incredibly popular programming language, and Python 3 has been officially released two years ago, and was available even before that. What's more, the whole mysqldb module is just a layer translating Python's db-api to MySQL's API. It's not that big of a library. I must be missing something here. How come almost* nobody in the entire open source community has spent the (I'm guessing) two weeks it takes to port this lib? Is Python 3 that unpopular? Is the combination of python and mysql not as common as I assume? Or maybe it's just a lot harder to port mysqldb than I assume? Anyone know the inside story on this? * Now I see that this guy has done it, which takes some of the wind out of my question, but it still seems to little and too late to make sense. EDIT: OK, I'm aware that the stock answers for these kind of questions cover this one as well. Patches welcome, scratch your itch, we don't work for you and we don't have the time, etc. I actually took a shot at porting this about a year ago, but it was my first time doing anything with Python C extensions, and I failed. My point in writing this was not a plea for somebody to write it, but genuine curiosity: it seems that some much more complicated libraries have been ported to python 3 already, and in the poll for which libraries should be ported, mysqldb is not even nominated! That suggests that maybe (2) is the right answer. UPDATE: I found that there are several new libraries that provide mysql support under Python 3, I just wasn't googling hard enough. That explains everything.

  Read the article

• After moving our Servers to a virtual environment using VMware - SQL timeouts came in, why?

  - by RayofCommand

  We moved our servers to a virtual cloud (VMware) where only our servers are in. But as soon as we finished migrating everything we are fighting against SQL Timeouts and machine slowdowns we can't explain. Even though we ~ doubled the servers capacity while switching from physical to virtual. Now I googled and found that we are not alone. People are complaining about poor performance after moving to a cloud managed by VMware. Are there any known issues? Sometimes our services can't access a disk or SQL receives a timeout and we have no idea why.

  Read the article

• Best way to generate pieces in match-3 games, and then tracking them?

  - by JonLim

  I've been working on a match-3 style game in Actionscript using Flixel, and so far, I've been able to build the core mechanics of the game, including board generation, piece generation, piece swapping and movement, and checking algorithms. However, I am now running into issues with clearing out pieces and letting the above pieces fall down and generating new pieces. The reason I'm running into these issues is that when all of the pieces are generated, the pertinent values (position, sprite ID, and sprite object) are pushed into an array that helps me track everything, all the time. When pieces are moved, I swap the values of the corresponding arrays and life goes on. And that array is the core of my problem: if a row in the middle of the board clears out, ideally, all of the pieces above the cleared pieces should fall down to take their place and new pieces are generated at the top and also fall into place. Except if I try to do that now, all the pieces can fall down, but then I'd have to bump all of their values into the right arrays (oh god my head) and then generate new pieces and fit THOSE into the correct place in the array. Am I overthinking this? Or is there a far better way to track these pieces? Thanks guys!

  Read the article

• SharePoint 2010 MySites - Host on separate servers

  - by Chris W

  We're playing with the SP 2010 Beta ahead of a planned deployment later this year in an academic environment. We anticipate that the majority of traffic will be through MySites when everything is provisioned so we're looking at how we can plan our SP topology to scale nicely. An initial thought is to run the main portal on one server, host "Student" MySites on one server and "Staff" on another. Is it acutally possible to do this easily or are we going down a bad path? Specifically - can we have 2 different MySites site collections, each hosted on a dedicated server? If so, can we configure SharePoint to work out from the users's logon account type of user they are and route them to the correct server?

  Read the article

• What is the best resource or method for learning more about servers and networking?

  - by kaleidomedallion

  I can get around a server to some degree, but everything I have learned has been as I have needed to learn it. Every once in a while I will learn about some new command that will revolutionize how I think about systems and networking, and realize how I could have been using it this whole time if only I had known about it. Anything to bring someone from novice to some kind of fluency? Do I just need to earn the battle scars bit by bit over the course of years? (I mean of course I do but what can I do to help it be not quite so painful?) For instance, I am still fuzzy on all of networking. Any help would be greatly appreciated.

  Read the article

• When I type " nothing comes out, and if I type it again, 2 of it comes out as such: ""

  - by Pacerier

  Something is wrong with my keyboard?: when I type ", nothing comes out, and if I type it again, 2 of them come out as such: "". Same goes with the ' key. The first time I type it, nothing comes out, then if I hit it again two of them appear (so I have to backspace one of them everytime). I've got no idea what I did to my computer, it was working properly yesterday. (I think I was messing around with the language thing, however I've just undid everything I've did and its still not working.)

  Read the article

• Unable to start after 13.04 > 13.10 udate

  - by romainl

  At the end of the update process, clicking on the Restart button had no visible effect whatsoever. After waiting 5 to 10 minutes, I decided to reboot the computer manually. Since then, I rebooted a good dozen times (not with the hope that it would work but with the hope of reading the messages) with the same non-result and the same symptoms: I get the ASCII text-on-purple Ubuntu 13.10 . . . . splash screen with these messages: * Restoring resolver state... [OK] * Starting crash report submission daemon [OK] * Starting CUPS printing spooler/server [OK] Everything disappears. The whole process hangs at a purple screen with the mouse cursor right in the middle. At this point, I'm unable to use the mouse and the keyboard. Booting from a 12.04 CD works perfectly, Disk Utility says that all my disks are OK and I can mount my main partition without problems. Something obviously went wrong at the end of the upgrade but I have no idea what. I'd appreciate any pointer. This is the kind of moment where you really think "Next time, I'll separate my /home partition for sure". My machine is an aging but working Dell Inspiron 530 with an Intel Core Duo E2160 processor, 2 GHz of RAM and an ATI Radeon HD3650 video card. Thanks.

  Read the article

< Previous Page | 339 340 341 342 343 344 345 346 347 348 349 350  | Next Page >