Search Results

Search found 19279 results on 772 pages for 'everything'.

Page 343/772 | < Previous Page | 339 340 341 342 343 344 345 346 347 348 349 350  | Next Page >

• Can i change the subnet on the vpn side of a server without having to change its whole lan (to avoid collission)

  - by Gusty

  Ohai, ive got a xp server with a client connecting via VPN. Problem (as we all know) is that sometimes the subnets clash. Instead of changing the whole server network every time this happens, cant i just have the server appear to have a different subnet to vpn clients? I have no interest in accessing other computers than the server on its LAN. I tried just turning off automatic dhcp in the servers vpn settings and changed it to 172.31.255.x. The client gets the address assigned alright and it can ping 172.31.255.1 but i cannot ping the server name (because the dns on the clients vpn connection points at 192.168.0.1?) wisdom? PS everything worked until the client hit a network with the same subnet as the server lan. thanks

  Read the article

• What's wrong with this Open GL ES 2.0. Shader?

  - by Project Dumbo Dev

  I just can't understand this. The code works perfectly on the emulator(Which is supposed to give more problems than phones…), but when I try it on a LG-E610 it doesn't compile the vertex shader. This is my log error(Which contains the shader code as well): EDITED Shader: uniform mat4 u_Matrix; uniform int u_XSpritePos; uniform int u_YSpritePos; uniform float u_XDisplacement; uniform float u_YDisplacement; attribute vec4 a_Position; attribute vec2 a_TextureCoordinates; varying vec2 v_TextureCoordinates; void main(){ v_TextureCoordinates.x= (a_TextureCoordinates.x + u_XSpritePos) * u_XDisplacement; v_TextureCoordinates.y= (a_TextureCoordinates.y + u_YSpritePos) * u_YDisplacement; gl_Position = u_Matrix * a_Position; } Log reports this before loading/compiling shader: 11-05 18:46:25.579: D/memalloc(1649): /dev/pmem: Mapped buffer base:0x51984000 size:5570560 offset:4956160 fd:46 11-05 18:46:25.629: D/memalloc(1649): /dev/pmem: Mapped buffer base:0x5218d000 size:5836800 offset:5570560 fd:49 Maybe it has something to do with that men alloc? The phone is also giving a constant error while plugged: ERROR FBIOGET_ESDCHECKLOOP fail, from msm7627a.gralloc Edited: "InfoLog:" refers to glGetShaderInfoLog, and it's returning nothing. Since I removed the log in a previous edit I will just say i'm looking for feedback on compiling shaders. Solution + More questions: Ok, the problem seems to be that either ints are not working(generally speaking) or that you can't mix floats with ints. That brings to me the question, why on earth glGetShaderInfoLog is returning nothing? Shouldn't it tell me something is wrong on those lines? It surely does when I misspell something. I solved by turning everything into floats, but If someone can add some light into this, It would be appreciated. Thanks.

  Read the article

• Which jar has JBox2d's p5 package

  - by Brantley Blanchard

  Using eclipse, I'm trying to write a simple hello world program in processing that simply draws a rectangle on the screen then has gravity drop it as seen in this Tutorial. The problem is that when I try to import the p5 package, it's not resolving so I can't declare my Physics object. I tried two things. Download the zip, unzip it, then import the 3 jars (library, serialization, & testbed) a. import org.jbox2d.p5.*; doesn't resolve but the others do b. Physics physics; doesn't resolve Download the older standalone testbed jar then import it a. Physics physics; doesn't resolve; Here is basically where I'm starting import org.jbox2d.util.nonconvex.*; import org.jbox2d.dynamics.contacts.*; import org.jbox2d.testbed.*; import org.jbox2d.collision.*; import org.jbox2d.common.*; import org.jbox2d.dynamics.joints.*; import org.jbox2d.p5.*; import org.jbox2d.dynamics.*; import processing.core.PApplet; public class MyFirstJBox2d extends PApplet { Physics physics; public void setup() { size(640,480); frameRate(60); initScene(); } public void draw() { background(0); if (keyPressed) { //Reset everything physics.destroy(); initScene(); } } public void initScene() { physics = new Physics(this, width, height); physics.setDensity(1.0f); physics.createRect(300,200,340,300); } }

  Read the article

• Laptop held hostage by administrator domain and Bit locker

  - by user144780

  I have a laptop computer that I had when I was working at an IT company. I don´t work there anymore but I could keep the computer (Lenovo) Suddenly my wireless internet didn´t work anymore showing error "insert SIM into the mobile broadband device" and month later connectiong to internet with cable got disabled I don´t know the password to sign in as an administrator on domain and whatever I try to do/install/change settings... everything needs admin rights. To surf the internet again with the computer I tried to install a new Windows but it´s seems to be protected with Bit Locker, asking for recovery key. I´ve googled and googled bunch of CMD tricks but most of the shows "system error 5 has occured" Is there anyway to get the wireless internet to work, change the admin or install new Windows? - or should I rather enjoying throwing it of the balcony or set it one fire? :)

  Read the article

• Persian font in Netbeans cause speed reduction

  - by linker

  I have speed problem in Netbeans 7.0 IDE when my current open document has any Persian font inside it. If it happens, the speed of software incredibly reduce.( for example if I hit backspace, it takes about 10 seconds to respond). The amazing part is when I open a fully english document in Netbeans there is no problem and everything works well. I'm running netbeans 7.0 on Mac OS X 10.7.2. This problem happens with every fonts( even with fully Persian fonts). But I really want to have Persian with default Monospaced font. Thanks in advance.

  Read the article

• Port Forwarding IPTABLES public IP

  - by tric

  hello i have a computer linuxbox_1.eth0 public ip 89.40.x.y eth1 public ip 85.121.a.b i have another linuxbox_2. ethx public ip 86.34.c.d what i want to do is forward port 8001 from linuxbox_1 eth0 89.40.x.y:8001 to linuxbox_1 eth1 85.121.a.b, and then forward again port 8001 from linuxbox_1 eth1 85.121.a.b:8001 to linuxbox_2 ethx 86.34.c.d:80 i have searched for answers using google "that knows everything" but this time it has failed. i would like to use IPTABLES or any other tool like rinetd. i tryed rinetd but it somehow mistakes the eths sorry for my bad english. 10q

  Read the article

• Convert text to table

  - by Quattro

  I would like convert text into a table. Here is a link to the text http://www.tcdb.org/public/tcdb Short example: >gnl|TC-DB|A0CIB0|1.A.17.3.1 Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1 MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI >gnl|TC-DB|A0CS82|9.B.82.1.5 Chromosome undetermined scaffold_26, whole genome shotgun sequence - Paramecium tetraurelia. MIIEEQIEEKMIYKAIHRVKVNYQKKIDRYILYKKSRWFFNLLLMLLYAYRIQNIGGFYI VTYIYCVYQLQLLIDYFTPLGLPPVNLEDEEEDDDQFQNDFSELPTTLSNKNELNDKEFR PLLRTTSEFKVWQKSVFSVIFAYFCTYIPIWDIPVYWPFLFCYFFVIVGMSIRKYIKHMK KYGYTILDFTKKK I wanted to have columns for example delimited with pipe | or ; |>gnl|TC-DB|A0CIB0|1.A.17.3.1| Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1| MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI I am working with Windows and I don't know how to do it I just know every row starts with > I want to substitute the first whitespace in a row with a delimiter like | or ; after the first regular expression new line in a row, I want also a delimiter everything between the regular expression first new line and > should go into a new column (it's a sequence of a protein)

  Read the article

• Getting a Cross-Section from Two CSV Files

  - by Jonathan Sampson

  I have two CSV files that I am working with. One is massive, with about 200,000 rows. The other is much smaller, having about 12,000 rows. Both fit the same format of names, and email addresses (everything is legit here, no worries). Basically I'm trying to get only a subset of the second list by removing all values that presently exist in the larger file. So, List A has ~200k rows, and List B has ~12k. These lists overlap a bit, and I'd like to remove all entries from List B if they also exist in List A, leaving me with new and unique values only in List B. I've got a few tooks at my disposal that I can use. Open Office is loaded on this machine, along with MySQL (queries are alright). What's the easiest way to create a third CSV with the intersection of data?

  Read the article

• Selectively routing traffic via ethernet or wifi, with proper DNS (Mac OS X 10.6)

  - by Dan

  When I'm at work, I access various intranet pages as well as the wider Internet through ethernet. However, the company LAN blocks some ports (e.g. Google Calendar). I can get to those through WiFi. So, I gave the Airport priority, and then using route add, I set up selective routing: all intranet traffic goes through the ethernet and everything else via WiFi: sudo route add 10.0.0.0/8 <intranet gateway>. However, there are a number of intranet sites that have their own DNS; i.e., hr.company.com only resolves on the intranet. The only way that I can get the DNS to work properly is to add the internal DNS server to the Airport DNS listing, however I fear that when I go elsewhere and forget, this will break things. What's the right way to get the DNS to resolve using this setup?

  Read the article

• after BIOS splash, will not boot -- asks me to select an OS, but it just reboots

  - by user92040

  I'm running Linux Mint 13 MATE 64-bit. Everything has been working for several weeks. Yesterday, when I tried to boot up my computer, after the BIOS screen flashes I reach a screen with a black background that reads at the top: GNU GRUB version1.99-21ubuntu3.4 Then there is a box in which I can select from the following lines: Linux Mint 13 MATE 64-bit, 3.2.0-31-generic (/dev/sdb2) Linux Mint 13 MATE 64-bit, 3.2.0-31-generic (/dev/sdb2) -- recovery mode Previous Linux versions Memory test (memtest86+) Memory test (memtest86+, serial console 115200) At the bottom it reads: Use the ? and ? keys to select which entry is highlighed. Press enter to boot the selected OS, 'e' to edit the commands before booting or 'c' for a command-line. I have no idea why it started doing this and, worse, I have no idea how to get out of here. No matter which option I select, I can't get it to boot the OS. If I select either of the first two, it reboots to splash the BIOS and then I'm right back where I started. If I choose "Previous Linux versions" I get essentially the same screen with only two choices (which are the same as the first two choices listed above, Linux 13 MATE and the recovery mode). Again, choosing either one of those results in a reboot. If I try to run either of the memtest options, it reads: error: unknown command 'linux16', Press any key to continue... Then it brings me back to the same screen Can anyone help me please? Intel Core i5-2500 ASUS P8Z68-V LX Intel Motherboard G. Skill Ripjaws series F3-12800CL9D-8GBRL (4GB x2) Plextor 128GB M5S Series SSD

  Read the article

• phpmyadmin or other mysql gui - edit whole table from one screen

  - by lorem

  Let's say I have table in database. I'd like to be able to view all data from this table and be able to edit every field from single screen. I tried to do this in phpmyadmin but I'm not sure how... I can see all data but I have to click edit on single field and then I'm sent to next screen, can't really edit everything at once. How do I do this in phpmyadmin or other mysql gui? I'm on Linux, my server too. I'd like each field in table to be editable text field - maybe this will show better what I'm searching for.

  Read the article

• Very frequent "Server not found" messages

  - by Village

  Recently, while browsing and clicking or typing an address, I get: "Server not found", "Connection was reset", or a half-loaded page. Usually the page loads instantly after clicking reload, but this means I must reload on every page. Images on one site, but stored at a different server don't load until reloading for a second time. Clicking "submit" on many sites frequently doesn't work unless I reload many times. Sometimes sites load, but without colors and formating, appearing as if they would in Lynx. This seems to happen with every Web site. My Internet service claims everything on their end is fine. This happened a day after running an update in aptitude. I have not updated any hardware. I have tried clearing Iceweasel's cache. I do not have any router or other equipment. What could be going on? How can I troubleshoot this? PPPoE connection, Iceweasel 3.5.16, Debian 6

  Read the article

• Multi-monitor resolution and position settings lost after reboot

  - by SoftDeveloper

  I've had two 1280x1024 monitors running for years on an nVidia 8800GT card with no problems. I've now replaced one monitor with a new 2560x1440 one. The card seems to support both fine, however every time I reboot the resolutions and monitor positions revert to the old settings. I've tried upgrading, downgrading, stripping out and reinstalling many versions of the nvidia drivers to no avail. Logging in as another user doesn't help - same problem. Booting into another another OS (Win7 64) works OK, so it is just this OS installation. During boot up everything looks fine (ie native 2450x1440 res) until the nVidia control panel or something is loaded which flips it back into the old mode. I have no old saved nvidia profiles. I can't find anything in the registry relating to these old settings. Its driving me crazy having to set resolutions and realign monitors on every reboot! Can anybody help?

  Read the article

• What is the best resource or method for learning more about servers and networking?

  - by kaleidomedallion

  I can get around a server to some degree, but everything I have learned has been as I have needed to learn it. Every once in a while I will learn about some new command that will revolutionize how I think about systems and networking, and realize how I could have been using it this whole time if only I had known about it. Anything to bring someone from novice to some kind of fluency? Do I just need to earn the battle scars bit by bit over the course of years? (I mean of course I do but what can I do to help it be not quite so painful?) For instance, I am still fuzzy on all of networking. Any help would be greatly appreciated.

  Read the article

• Should this be written in C or php?

  - by user1867842

  This is my code; it speaks for itself on what I'm trying to do. <?php define("html","<html>"); define("htmlEnd","</html>"); etc... etc... ?> What I'm trying to do is make a wrapper for html's tags so they won't be needed anymore. But I can't get any of the attributes for html elements to be defined in PHP. This again speaks for itself; I don't know any other way of saying this. I guess how would I make another mark-up language like HTML without any tags but still keep everything about HTML is what I'm trying to say. My idea is for preventing XSS. For example, creating a special framework for the website itself that way there is no way any malicious attacker can guess because they know the HTML or PHP. I just don't want to make my website or something, and then my website gets hacked. Or if I make a website for someone and the website gets hacked. I am going to look like a unprofessional web developer. And what if I never get a job again.

  Read the article

• When I type " nothing comes out, and if I type it again, 2 of it comes out as such: ""

  - by Pacerier

  Something is wrong with my keyboard?: when I type ", nothing comes out, and if I type it again, 2 of them come out as such: "". Same goes with the ' key. The first time I type it, nothing comes out, then if I hit it again two of them appear (so I have to backspace one of them everytime). I've got no idea what I did to my computer, it was working properly yesterday. (I think I was messing around with the language thing, however I've just undid everything I've did and its still not working.)

  Read the article

• Hard drive skipped in boot

  - by Yasin

  Good evening. I just installed Ubuntu 12.04 using a USB, but right after the install, after restarting the machine, I get a message asking me to insert a bootable drive. My boot settings in Bios have the hard drive first, then DVD, then USB stick, and I have two systems installed, Windows 7 and Ubuntu 12.04. I suspected the hard drive got somehow disconnected internally, so I checked but everything was in place. I used the live USB to start Ubuntu, and I could see the hard drive and mount whatever partition I wanted. The one that contains the recently installed Ubuntu, looks the same. (It hasn't been deleted or anything). I'm not sure if this is a hardware problem or a loader(grub) problem, because the hard drive is visible. Only it isn't seen by the BIOS. My only means of internet connection is a USB modem, which doesn't work when I'm using the live USB, so I have can't download anything from the internet, in case someone asks. I also reinstalled Ubuntu 12.04, to no avail. This is my second problem with this laptop, and Ubuntu, and it's not even a week old. I hope this one gets solved. Thank you.

  Read the article

• How do i know if i set up the nlb (network load balancing) cluster correctly???

  - by letseatlunch

  So ill start from the very beginning. I'm working on a web conference were we are going to show about 12 videos for a total of about half a gig for all 12. Since all the participants are going to be watching (and also streaming/downloading) at once it was recommended we set up a server farm. So i have 4 servers that i am trying to network together. They are all running Microsoft Server 2008 and i have spent the last three days setting them up and now that its done i want to make sure its all ready to go. so i just want to be sure that everything is setup the way that i think it is. What is the best way to do this. Really i want to make sure that the load will be split over the servers when its showtime. thanks for any help in advance letseatlunch Dave

  Read the article

• Drive reporting incorrect free space

  - by Oli

  So I swapped my shiny SATA SSD for an even shinier PCI-E SSD. I run my core OS on the SSD because it's silly-fast. I did this on my old SSD so I created a new EXT4 partition and then just dded the data across (sorry I don't know the exact command I ran anymore) and after reinstalling grub, I booted onto the PCI-E SSD. At first glance everything had worked perfectly and things were running faster than ever. But then I noticed the free disk space on the new, larger drive: it was almost exactly the same as it was on the other disk... A disk that was half its size. So it looks as if I've copied the files across incorrectly and it's copied some of the filesystem metadata along with it. Tools like du and Disk Usage Analyzer come back with the correct figures. Things that look at the partition (and not the files) seem to think the drive is 120GB I've been using this drive for a week now so it's way out of sync with the old SSD so dumping the data and starting again isn't a job that fills me with joy but two questions: Is there a way to fix my filesystem so it knows what it's really on about? fsck e2fsck and badblocks all seem to be able to scan it without finding a problem with it. If I do plug my old SSD back in, copy the data off my PCI-E on to it and then copy it back onto a fresh filesystem (eg juggle the data around), what's the best way of doing that? I obviously want to keep all the permissions and softlinks where they are.

  Read the article

• USB drivers stopped working in Windows 8

  - by Maxim V. Pavlov

  I have installed an MSDN version of Windows 8 Professional (x64) RTM. For about 3 restarts everything worked well. But once I've rebooted again - USB drivers (all of them, inluding the USB 3 drivers) stopped working. Device Manager properties said that the USB driver is not compatible with the system. Gigabyte doesn't list Windows 8 drivers for my MB X58A-UD3R. Tried to reinstall windows 7 USB drivers - system said the current driver is fine and didn't want to reinstall. Is this the common Windows 8 problem? How can solve it or debug it even more?

  Read the article

• Writing better timesheet

  - by gunbuster363

  Recently, my company started to require us to fill out a monthly timesheet, writing down everything you do in office. A timesheet contain 29-31 days, depends on the number of days of the month. I need to write the things I did in every row of the excel file, which represent a day. This timesheet embarrasses me, because something like this can happen: I spent Monday writing a program, and the program was done. Because my boss didn't give me other program to write, basically I am just sitting there and pretending I am busy in the following days before my boss gives me another assignment. Of course I should not write it in the timesheet as it is. I can write it in the timesheet that I write the program using 4 days, but it makes me feel very inefficient. I can separate the process into 1) write the program, 2)deploy the program, 3)test the program, but that can make the process so long like 3 weeks, really. Have you encountered such a situation? How would you deal with this? EDIT: some people said I should be more proactive about asking for more assignments, but here is the situation: the boss of my boss gives some jobs to my boss, then my boss gives the jobs to me, sometimes I can also see my boss being quite less busy. One of my colleagues said that I should not ask for another assignment in a proactive manner, because it would be a headache for my boss to think a job out of nowhere for me. I don't want the things turn out like that, really.

  Read the article

• Does Windows 8 support the "start in [folder]" property for shortcuts?

  - by FumbleFingers

  I use Foobar2000 to play music, and for years now I've run it in what they call "portable mode". What that means is that the program itself isn't actually "installed" in the traditional Windows sense. All "non-system" dll's required by the application are in the same folder as the executable; earlier versions of Windows find them there, and everything runs fine. But Windows 8 fails because it doesn't find them. I want things set up this way because I keep Foobar2000 on a portable external hard drive, so I can just move it between different computers without having to go through the Windows install process. With all previous versions of Windows, I could either directly run the application from File Explorer, or create a shortcut on the desktop with the "start in folder" property set to the actual folder containing the program. I can still use the first method, but I want a shortcut! Is there any way to do what I want?

  Read the article

• Unable to start after 13.04 > 13.10 udate

  - by romainl

  At the end of the update process, clicking on the Restart button had no visible effect whatsoever. After waiting 5 to 10 minutes, I decided to reboot the computer manually. Since then, I rebooted a good dozen times (not with the hope that it would work but with the hope of reading the messages) with the same non-result and the same symptoms: I get the ASCII text-on-purple Ubuntu 13.10 . . . . splash screen with these messages: * Restoring resolver state... [OK] * Starting crash report submission daemon [OK] * Starting CUPS printing spooler/server [OK] Everything disappears. The whole process hangs at a purple screen with the mouse cursor right in the middle. At this point, I'm unable to use the mouse and the keyboard. Booting from a 12.04 CD works perfectly, Disk Utility says that all my disks are OK and I can mount my main partition without problems. Something obviously went wrong at the end of the upgrade but I have no idea what. I'd appreciate any pointer. This is the kind of moment where you really think "Next time, I'll separate my /home partition for sure". My machine is an aging but working Dell Inspiron 530 with an Intel Core Duo E2160 processor, 2 GHz of RAM and an ATI Radeon HD3650 video card. Thanks.

  Read the article

• Is it a good idea to dynamically position and size controls on a form or statically set them?

  - by CrystalBlue

  I've worked mostly with interface building tools such as xCode's Interface Builder and Visual Studio's environment to place forms and position them on screens. But I'm finding that with my latest project, placing controls on the form through a graphical interface is not going to work. This more has to do with the number of custom controls I have to create that I can't visually see before hand. When I first tackled this, I began to position all of my controls relative to the last ones that I created. Doing this had its own pros and cons. On the one hand, this gave me the opportunity to set one number (a margin for example) and when I changed the margin, the controls all sized correctly to one another (such as shortening controls in the center while keeping controls next to the margin the same). But this started to become a spiders-web of code that I knew wouldn't go very far before getting dangerous. Change one number and everything re sizes, but remove one control and you've created many more errors and size problems for all the other controls. It became more surgery then small changes to controls and layout. Is there a good way or maybe a preferred way to determine when I should be using relative or absolute positioning in forms?

  Read the article

• How could there still not be a mysqldb module for Python 3? [closed]

  - by itsadok

  This SO question is now more than two years old. MySQL is an incredibly popular database engine, Python is an incredibly popular programming language, and Python 3 has been officially released two years ago, and was available even before that. What's more, the whole mysqldb module is just a layer translating Python's db-api to MySQL's API. It's not that big of a library. I must be missing something here. How come almost* nobody in the entire open source community has spent the (I'm guessing) two weeks it takes to port this lib? Is Python 3 that unpopular? Is the combination of python and mysql not as common as I assume? Or maybe it's just a lot harder to port mysqldb than I assume? Anyone know the inside story on this? * Now I see that this guy has done it, which takes some of the wind out of my question, but it still seems to little and too late to make sense. EDIT: OK, I'm aware that the stock answers for these kind of questions cover this one as well. Patches welcome, scratch your itch, we don't work for you and we don't have the time, etc. I actually took a shot at porting this about a year ago, but it was my first time doing anything with Python C extensions, and I failed. My point in writing this was not a plea for somebody to write it, but genuine curiosity: it seems that some much more complicated libraries have been ported to python 3 already, and in the poll for which libraries should be ported, mysqldb is not even nominated! That suggests that maybe (2) is the right answer. UPDATE: I found that there are several new libraries that provide mysql support under Python 3, I just wasn't googling hard enough. That explains everything.

  Read the article

< Previous Page | 339 340 341 342 343 344 345 346 347 348 349 350  | Next Page >