Search Results

Search found 19279 results on 772 pages for 'everything'.

Page 343/772 | < Previous Page | 339 340 341 342 343 344 345 346 347 348 349 350  | Next Page >

  • Convert text to table

    - by Quattro
    I would like convert text into a table. Here is a link to the text http://www.tcdb.org/public/tcdb Short example: >gnl|TC-DB|A0CIB0|1.A.17.3.1 Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1 MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI >gnl|TC-DB|A0CS82|9.B.82.1.5 Chromosome undetermined scaffold_26, whole genome shotgun sequence - Paramecium tetraurelia. MIIEEQIEEKMIYKAIHRVKVNYQKKIDRYILYKKSRWFFNLLLMLLYAYRIQNIGGFYI VTYIYCVYQLQLLIDYFTPLGLPPVNLEDEEEDDDQFQNDFSELPTTLSNKNELNDKEFR PLLRTTSEFKVWQKSVFSVIFAYFCTYIPIWDIPVYWPFLFCYFFVIVGMSIRKYIKHMK KYGYTILDFTKKK I wanted to have columns for example delimited with pipe | or ; |>gnl|TC-DB|A0CIB0|1.A.17.3.1| Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1| MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI I am working with Windows and I don't know how to do it I just know every row starts with > I want to substitute the first whitespace in a row with a delimiter like | or ; after the first regular expression new line in a row, I want also a delimiter everything between the regular expression first new line and > should go into a new column (it's a sequence of a protein)

    Read the article

  • Deepest sense of programming [closed]

    - by xralf
    I suffer on depression for a few months. Programming was one of my big passions (as a hobby). I had a motivation to achieve my goals (projects), to read books and articles about it to have interest in algorithms and data structures, compilers etc. Then, my mind started to think that it has no sense, that the result is useless. I realized, that I loved programming because of an illusion that it has deep sense, that I love playing with code every day as nothing else with feeling that it leads somewhere. Could I rationalize that it has sense to work on some programming project? That there is a deep sense to do it and enjoy this activity? I have no idea what else should I do in the free time, the mornings without motivation are very depressing. It was nice time when I had an illusion that programming is enjoyable. Could you help me to figure out the deepest sense of programming in this world? Why to love it again? What everything could be achieved and realized? (things like higher salary and ego are not what I'm looking for)

    Read the article

  • Getting a Cross-Section from Two CSV Files

    - by Jonathan Sampson
    I have two CSV files that I am working with. One is massive, with about 200,000 rows. The other is much smaller, having about 12,000 rows. Both fit the same format of names, and email addresses (everything is legit here, no worries). Basically I'm trying to get only a subset of the second list by removing all values that presently exist in the larger file. So, List A has ~200k rows, and List B has ~12k. These lists overlap a bit, and I'd like to remove all entries from List B if they also exist in List A, leaving me with new and unique values only in List B. I've got a few tooks at my disposal that I can use. Open Office is loaded on this machine, along with MySQL (queries are alright). What's the easiest way to create a third CSV with the intersection of data?

    Read the article

  • Excel 2010 -Excel cannot complete this task with available resources

    - by Jestep
    Getting this error when trying to sort a document (Excel cannot complete this task with available resources). Document isn't particularly large, about 4,000 lines. Can't seem to figure out why this would start on this. I can sort this same file fine on everything back to Excel 2000 on older crappy computers. Computer is running Win 7 x64, 16 Gb RAM, and another 16 Gb of virtual. There's no possible way that all of the memory is actually getting exhausted when I can perform this on an older XP machine with 512 Mb of RAM, unless 2010's memory usage is inconceivably poorly designed. I found a few posts on forums stating that there might be a security update related bug. Any suggestions would be appreciated.

    Read the article

  • "The requested operation could not be completed due to a file system limitation" 3202

    - by user46529
    I backup SQL Server database and it fails BACKUP DATABASE dd TO DISK = '\backupServer\backups\dd.bak' WITH COMPRESSION, CHECKSUM, NOFORMAT, INIT , BlockSize = 65536 , BufferCount = 2200 , MaxTransferSize = 4194304 The backup size is 3TB and I have 6TB free space on bacup server. I am using backup parameters per SQLCAT whitepaper. Everything works ok when I backup to local HDD and it always fails when I backup to network share. After about 6 hours. Can't find why. Thank you. Yes. The backup over the network is fastest and saves me 3Tb of local disk space :) Thanks for pointing to the memory issue. I left 4Gb to OS and it worked!

    Read the article

  • Node.js installation on Debian 6

    - by pvorb
    I used to use this method for node.js installation on Debian, since it was easy and everything worked fine. Even with multiple users. Since version 0.6.18~dfsg1-1 of the sid package, installation removes openssh-server. But I need OpenSSH to connect to my server. Is there any possibility to install Node.js via APT or do I have to compile it manually? This is my APT preferences file: Package: * Pin: release a=stable Pin-Priority: 800 Package: * Pin: release a=testing Pin-Priority: 650 Package: * Pin: release a=unstable Pin-Priority: 600

    Read the article

  • Why is only one domU giving me the "time went backwards"?

    - by Paul Tomblin
    I'm setting up a replacement server for one that was working ok but is having hardware issues. The original server is i686 (Pentium III), but the new one is amd64 (Xeon). Everything is working fine, except one of the three domUs is giving me the "clocksource/0: Time went backwards" error. The Debian Wiki says what to do if all your domUs are getting this error, but not what to do if only one of them has. The "tenants" on my domUs have done some messing about with the systems I configured for them. I don't know what the user of that particular domU might have done.

    Read the article

  • Apache2: How do I restrict access to a directory, but allow access to one file within it?

    - by Nick
    I've inherited a poorly designed web app, which has a certain file that needs to be publicly accessible, but that file is inside a directory which should not. In other words, I need a way to block all files and sub-directories within a directory, but over-ride it for a single file. I'm trying this: # No one needs to access this directly <Directory /var/www/DangerousDirectory/> Order Deny,allow Deny from all # But this file is OK: <Files /var/www/DangerousDirectory/SafeFile.html> Allow from all </Files> </Directory> But it's not working- it just blocks everything including the file I want to allow. Any suggestions?

    Read the article

  • One subdomain is not working

    - by BFTrick
    Hello there, My main domain works just fine - www.example.com and a subdomain set up by another developer works as well - sub1.example.com. But when I try to set another subdomain up I go through the process everything seems to work. The software creates the default files where the subdomain files should go. But when I try to browse there it doesn't work. My host uses Plesk to do all of the hosting stuff. What do you think the problem is? I doubt it is some sort of cache issue because I had problems on my phone which I tried after problems on the pc. Maybe for some reason Plesk needs time to set this up? I have used Cpanel before and that works instantly.

    Read the article

  • Multi-monitor resolution and position settings lost after reboot

    - by SoftDeveloper
    I've had two 1280x1024 monitors running for years on an nVidia 8800GT card with no problems. I've now replaced one monitor with a new 2560x1440 one. The card seems to support both fine, however every time I reboot the resolutions and monitor positions revert to the old settings. I've tried upgrading, downgrading, stripping out and reinstalling many versions of the nvidia drivers to no avail. Logging in as another user doesn't help - same problem. Booting into another another OS (Win7 64) works OK, so it is just this OS installation. During boot up everything looks fine (ie native 2450x1440 res) until the nVidia control panel or something is loaded which flips it back into the old mode. I have no old saved nvidia profiles. I can't find anything in the registry relating to these old settings. Its driving me crazy having to set resolutions and realign monitors on every reboot! Can anybody help?

    Read the article

  • pfSense router gives DNS rebinding warning when accessing subdomains

    - by Richard Maddis
    I have just set up a router running pfSense on our network and forwarded the appropriate ports. I have a small web server running in my network, and a domain name pointing to our (WAN) IP. When accessing that domain name, everything works fine. However, when accessing a subdomain of the domain name, pfSense will give a DNS rebinding warning. This did not happen back when I used a DD-WRT router. What is the proper way to fix this? The DNS records for the subdomain also point to the same address (I use a virtual server to differentiate the subdomains.)

    Read the article

  • Hard drive skipped in boot

    - by Yasin
    Good evening. I just installed Ubuntu 12.04 using a USB, but right after the install, after restarting the machine, I get a message asking me to insert a bootable drive. My boot settings in Bios have the hard drive first, then DVD, then USB stick, and I have two systems installed, Windows 7 and Ubuntu 12.04. I suspected the hard drive got somehow disconnected internally, so I checked but everything was in place. I used the live USB to start Ubuntu, and I could see the hard drive and mount whatever partition I wanted. The one that contains the recently installed Ubuntu, looks the same. (It hasn't been deleted or anything). I'm not sure if this is a hardware problem or a loader(grub) problem, because the hard drive is visible. Only it isn't seen by the BIOS. My only means of internet connection is a USB modem, which doesn't work when I'm using the live USB, so I have can't download anything from the internet, in case someone asks. I also reinstalled Ubuntu 12.04, to no avail. This is my second problem with this laptop, and Ubuntu, and it's not even a week old. I hope this one gets solved. Thank you.

    Read the article

  • How could there still not be a mysqldb module for Python 3? [closed]

    - by itsadok
    This SO question is now more than two years old. MySQL is an incredibly popular database engine, Python is an incredibly popular programming language, and Python 3 has been officially released two years ago, and was available even before that. What's more, the whole mysqldb module is just a layer translating Python's db-api to MySQL's API. It's not that big of a library. I must be missing something here. How come almost* nobody in the entire open source community has spent the (I'm guessing) two weeks it takes to port this lib? Is Python 3 that unpopular? Is the combination of python and mysql not as common as I assume? Or maybe it's just a lot harder to port mysqldb than I assume? Anyone know the inside story on this? * Now I see that this guy has done it, which takes some of the wind out of my question, but it still seems to little and too late to make sense. EDIT: OK, I'm aware that the stock answers for these kind of questions cover this one as well. Patches welcome, scratch your itch, we don't work for you and we don't have the time, etc. I actually took a shot at porting this about a year ago, but it was my first time doing anything with Python C extensions, and I failed. My point in writing this was not a plea for somebody to write it, but genuine curiosity: it seems that some much more complicated libraries have been ported to python 3 already, and in the poll for which libraries should be ported, mysqldb is not even nominated! That suggests that maybe (2) is the right answer. UPDATE: I found that there are several new libraries that provide mysql support under Python 3, I just wasn't googling hard enough. That explains everything.

    Read the article

  • After moving our Servers to a virtual environment using VMware - SQL timeouts came in, why?

    - by RayofCommand
    We moved our servers to a virtual cloud (VMware) where only our servers are in. But as soon as we finished migrating everything we are fighting against SQL Timeouts and machine slowdowns we can't explain. Even though we ~ doubled the servers capacity while switching from physical to virtual. Now I googled and found that we are not alone. People are complaining about poor performance after moving to a cloud managed by VMware. Are there any known issues? Sometimes our services can't access a disk or SQL receives a timeout and we have no idea why.

    Read the article

  • HP Virtual Connect and VLAN Tagging

    - by JaapL
    We have a c7000 chasis with the ability to have 8 uplinks per ESX host. Only 6 are currenlty active. I have a Virtual Switch with multiple vlan port groups and all the VMs are working fine. Recently we've been asked to setup network load balancing for one of our VMs, so we had our Virtual Connect engineer activate the last two uplinks. We then created a new vSwitch and added the two new uplinks to this vSwitch. We then moved the VM to this new vSwitch, but we get no connectivity. What could be the issue? We also added the appropriate VLAN ID. The VConnect engineer says everything is configured correctly and networking TEAM says the appropriate trunking is setup, so we are at a loss...

    Read the article

  • after BIOS splash, will not boot -- asks me to select an OS, but it just reboots

    - by user92040
    I'm running Linux Mint 13 MATE 64-bit. Everything has been working for several weeks. Yesterday, when I tried to boot up my computer, after the BIOS screen flashes I reach a screen with a black background that reads at the top: GNU GRUB version1.99-21ubuntu3.4 Then there is a box in which I can select from the following lines: Linux Mint 13 MATE 64-bit, 3.2.0-31-generic (/dev/sdb2) Linux Mint 13 MATE 64-bit, 3.2.0-31-generic (/dev/sdb2) -- recovery mode Previous Linux versions Memory test (memtest86+) Memory test (memtest86+, serial console 115200) At the bottom it reads: Use the ? and ? keys to select which entry is highlighed. Press enter to boot the selected OS, 'e' to edit the commands before booting or 'c' for a command-line. I have no idea why it started doing this and, worse, I have no idea how to get out of here. No matter which option I select, I can't get it to boot the OS. If I select either of the first two, it reboots to splash the BIOS and then I'm right back where I started. If I choose "Previous Linux versions" I get essentially the same screen with only two choices (which are the same as the first two choices listed above, Linux 13 MATE and the recovery mode). Again, choosing either one of those results in a reboot. If I try to run either of the memtest options, it reads: error: unknown command 'linux16', Press any key to continue... Then it brings me back to the same screen Can anyone help me please? Intel Core i5-2500 ASUS P8Z68-V LX Intel Motherboard G. Skill Ripjaws series F3-12800CL9D-8GBRL (4GB x2) Plextor 128GB M5S Series SSD

    Read the article

  • How should I structure the implementation of turn-based board game rules?

    - by Setzer22
    I'm trying to create a turn-based strategy game on a tilemap. I'm using design by component so far, but I can't find a nice way to fit components into the part I want to ask. I'm struggling with the "game rules" logic. That is, the code that displays the menu, allows the player to select units, and command them, then tells the unit game objects what to do given the player input. The best way I could thing of handling this was using a big state machine, so everything that could be done in a "turn" is handled by this state machine, and the update code of this state machine does different things depending on the state. However, this approach leads to a large amount of code (anything not model-related) going into a big class. Of course I can subdivide this big class into more classes, but it doesn't feel modular and upgradable enough. I'd like to know of better systems to handle this in order to be able to upgrade the game with new rules without having a monstruous if/else chain (or switch / case, for that matter). Any ideas? What specific design pattern other than MVC should I be using?

    Read the article

  • Windows 8.1 keeps prompting for Network Share Credentials after every log on or restart

    - by Peret del Trunfa
    I have a Network drive Shared in a Workgroup with 3 clients. Two clients with Windows 7 have persistent connections to the Share. No issues with those two. My windows 8.1 client keeps prompting for credentials at every restart / log on. I spent hours looking around for a solution: I have stored cred in cred manager, and tried every possible combination (WORKGROUP\user , COMPUTERNAME\user, user, .. and so on). I have changed NT and NTLM negotiation in policy manager. I've compared the settings under GPO network security with a working win 7 computer, everything is pretty much the same. -I've captured Wireshark to see SMB negotiation process, honestly I see the messages flowing around, and the share sending AUTH DENIED.. which means is how the 8.1 client formats the request.... that makes the share reject it.. Now I still don't really know why. Any ideas would be appreciated.

    Read the article

  • Port Forwarding IPTABLES public IP

    - by tric
    hello i have a computer linuxbox_1.eth0 public ip 89.40.x.y eth1 public ip 85.121.a.b i have another linuxbox_2. ethx public ip 86.34.c.d what i want to do is forward port 8001 from linuxbox_1 eth0 89.40.x.y:8001 to linuxbox_1 eth1 85.121.a.b, and then forward again port 8001 from linuxbox_1 eth1 85.121.a.b:8001 to linuxbox_2 ethx 86.34.c.d:80 i have searched for answers using google "that knows everything" but this time it has failed. i would like to use IPTABLES or any other tool like rinetd. i tryed rinetd but it somehow mistakes the eths sorry for my bad english. 10q

    Read the article

  • SharePoint 2010 MySites - Host on separate servers

    - by Chris W
    We're playing with the SP 2010 Beta ahead of a planned deployment later this year in an academic environment. We anticipate that the majority of traffic will be through MySites when everything is provisioned so we're looking at how we can plan our SP topology to scale nicely. An initial thought is to run the main portal on one server, host "Student" MySites on one server and "Staff" on another. Is it acutally possible to do this easily or are we going down a bad path? Specifically - can we have 2 different MySites site collections, each hosted on a dedicated server? If so, can we configure SharePoint to work out from the users's logon account type of user they are and route them to the correct server?

    Read the article

  • USB drivers stopped working in Windows 8

    - by Maxim V. Pavlov
    I have installed an MSDN version of Windows 8 Professional (x64) RTM. For about 3 restarts everything worked well. But once I've rebooted again - USB drivers (all of them, inluding the USB 3 drivers) stopped working. Device Manager properties said that the USB driver is not compatible with the system. Gigabyte doesn't list Windows 8 drivers for my MB X58A-UD3R. Tried to reinstall windows 7 USB drivers - system said the current driver is fine and didn't want to reinstall. Is this the common Windows 8 problem? How can solve it or debug it even more?

    Read the article

  • How do i know if i set up the nlb (network load balancing) cluster correctly???

    - by letseatlunch
    So ill start from the very beginning. I'm working on a web conference were we are going to show about 12 videos for a total of about half a gig for all 12. Since all the participants are going to be watching (and also streaming/downloading) at once it was recommended we set up a server farm. So i have 4 servers that i am trying to network together. They are all running Microsoft Server 2008 and i have spent the last three days setting them up and now that its done i want to make sure its all ready to go. so i just want to be sure that everything is setup the way that i think it is. What is the best way to do this. Really i want to make sure that the load will be split over the servers when its showtime. thanks for any help in advance letseatlunch Dave

    Read the article

  • A Duplicate name exists on the network

    - by Adam
    Recently we changed out office IT structure from having a dedicated server to be the DC, a dedicated server for the exchange etc... (Each running Windows Server 2003 R2) Now we have a single server running Windows SBS 2008 and created a new domain (with a different domain name) We then changed every PC so it connected to the new domain and renamed every PC with a new naming structure. After I had done this, we were getting several PCs that would get the following message just before the login screen (Alt+Ctrl+Del Screen) A Duplicate name exists on the network I have checked the ADUC and have removed the trouble PCs from the list and renamed each PC and changed the SID before connecting back onto the domain but still getting this message. I have tried everything that i can think of but still getting the problem. Any help would be greatly appreticated.

    Read the article

  • Unable to start after 13.04 > 13.10 udate

    - by romainl
    At the end of the update process, clicking on the Restart button had no visible effect whatsoever. After waiting 5 to 10 minutes, I decided to reboot the computer manually. Since then, I rebooted a good dozen times (not with the hope that it would work but with the hope of reading the messages) with the same non-result and the same symptoms: I get the ASCII text-on-purple Ubuntu 13.10 . . . . splash screen with these messages: * Restoring resolver state... [OK] * Starting crash report submission daemon [OK] * Starting CUPS printing spooler/server [OK] Everything disappears. The whole process hangs at a purple screen with the mouse cursor right in the middle. At this point, I'm unable to use the mouse and the keyboard. Booting from a 12.04 CD works perfectly, Disk Utility says that all my disks are OK and I can mount my main partition without problems. Something obviously went wrong at the end of the upgrade but I have no idea what. I'd appreciate any pointer. This is the kind of moment where you really think "Next time, I'll separate my /home partition for sure". My machine is an aging but working Dell Inspiron 530 with an Intel Core Duo E2160 processor, 2 GHz of RAM and an ATI Radeon HD3650 video card. Thanks.

    Read the article

  • When I type " nothing comes out, and if I type it again, 2 of it comes out as such: ""

    - by Pacerier
    Something is wrong with my keyboard?: when I type ", nothing comes out, and if I type it again, 2 of them come out as such: "". Same goes with the ' key. The first time I type it, nothing comes out, then if I hit it again two of them appear (so I have to backspace one of them everytime). I've got no idea what I did to my computer, it was working properly yesterday. (I think I was messing around with the language thing, however I've just undid everything I've did and its still not working.)

    Read the article

< Previous Page | 339 340 341 342 343 344 345 346 347 348 349 350  | Next Page >