Search Results

Search found 19279 results on 772 pages for 'everything'.

Page 343/772 | < Previous Page | 339 340 341 342 343 344 345 346 347 348 349 350  | Next Page >

  • ASUS N550 laptop not charging on ubuntu after updating kernel

    - by OBY Trance
    I'm using Ubuntu 13.10 on a pretty new ASUS N550jv laptop. When I was using kernel linux-image-3.11.0-11 everything was quite well (kinda..), however, when I updated the kernel using the automatic update, the kernels which were released afterwards (12+) were faulty on my machine, and caused the battery not to be charged and only stay at their current charging level (even when the machine was off!) The only fix I had was to roll-back to the '..11' version (on boot screen - advanced options), and hard-reboot (AC cord disconnected and reconnected) but now version 14 was released and "pushed away" the good old version 11. How can I fix that?? Please help me...

    Read the article

  • Lost current user (shutdown/logoff) widget after upgrading to Ubuntu 10.04

    - by xyzman
    I've upgraded to 10.04 from 9.10. Everything went fine until I've rebooted. After reboot, I've received some message about status panel and being sleepy, dismissed it. However, I haven't seen the user widget on Gnome Panel since that. This image shows which widget I'm talking about. If some one has any ideas about how it's called properly, please share. http://img237.imageshack.us/img237/8274/sampleyu.jpg Anyway, the question is, how do I turn this panel (and ability to shut my system down without resorting to console) back?

    Read the article

  • preloading RSS contents in thunderbird, before actually reading them

    - by Berry Tsakala
    i have thunderbird 3.x, and i'm subscribed to several RSS feeds. How can I tell thunderbird to load/download any new RSS items in the background? The usual behavior with RSS feeds is that it download the headrs, or few introductory lines from the contents, but only when i'm clicking a feed item it starts loading "for real". I really want to receive the feeds and not to wait for them to load, the same way i receive emails in any email client - all messages are fully downloaded at once. there could be several reasons, BTW. - e.g. if i have short connection time, i'd rather connect, sync everything at once, and read it later. - or if i have a slow wifi connection, it's annoying to wait for each and every message, but the computer is idle while reading.. thanks

    Read the article

  • After moving our Servers to a virtual environment using VMware - SQL timeouts came in, why?

    - by RayofCommand
    We moved our servers to a virtual cloud (VMware) where only our servers are in. But as soon as we finished migrating everything we are fighting against SQL Timeouts and machine slowdowns we can't explain. Even though we ~ doubled the servers capacity while switching from physical to virtual. Now I googled and found that we are not alone. People are complaining about poor performance after moving to a cloud managed by VMware. Are there any known issues? Sometimes our services can't access a disk or SQL receives a timeout and we have no idea why.

    Read the article

  • Troubles doing transparent proxy for virtual machines

    - by Dan H
    Hi iptables gurus. First here is the basic topology: Internet | Gateway | Workstation---eth0---virbr0 | +-----+-----+ | | | vm1 vm2 vm3 I need to test a traffic analyzer running on my workstation, listening on some port (say 8990) on eth0. The rule [I think] I want is "any packets leaving virbr0 going anywhere to port 80 must instead go to port 8990 on eth0". My software running on port 8990 does its own check of the NAT packet mangling to push the packets through after it inspects them. I've been banging my head on this, with different variants of: iptables -t nat -A PREROUTING -i virbr0 -p tcp --dport 80 -j DNAT \ --to 10.0.0.10:8990 And I've tried the more generic method of using the mangle table with --set-mark and ip rule add fwmark, but I'm not getting it. I guess what's confusing me is that everything runs on the same box. Thanks for any guidance.

    Read the article

  • LVM vs RAID0 vs RAID "linear" - Combine 2 disks as one, data recovery?

    - by leto
    Hi there, given two 2TB USB external disks that have to be combined to one 4TB volume and formatted with one big Filesystem (XFS), I have a small question to ask. Does LVM provide better Data recovery, should one disk be unplugged/damaged by being able to recover the data of the still working disk or is everything lost? I would appreciate a solution where only the data of one disk is lost and I can recover the content of the other with the usual filesystem/lvm/raid tools. Is that possible with LVM or RAID "linear"? This is for storing unimportant files that can be retrieved from backup, but I want to save time :) Thank you in advance

    Read the article

  • Apache2: How do I restrict access to a directory, but allow access to one file within it?

    - by Nick
    I've inherited a poorly designed web app, which has a certain file that needs to be publicly accessible, but that file is inside a directory which should not. In other words, I need a way to block all files and sub-directories within a directory, but over-ride it for a single file. I'm trying this: # No one needs to access this directly <Directory /var/www/DangerousDirectory/> Order Deny,allow Deny from all # But this file is OK: <Files /var/www/DangerousDirectory/SafeFile.html> Allow from all </Files> </Directory> But it's not working- it just blocks everything including the file I want to allow. Any suggestions?

    Read the article

  • Running JBoss 6 with Runit / daemontools or other process supervision framework

    - by Alex Recarey
    I'm tying to use runit to daemonize JBoss. I use the /opt/jboss-6.1.0.Final/bin/run.sh script to start the server. When I do so from the comandline, JBoss does not detach (which is what we want), and will also shut down when CTRL+C is pressed. In theory a perfect candidate to use runit on. Everything works fine except when I try to get runit to shut down JBoss. When I issue the command sv stop jboss nothing happens. Runit thinks the process is stopped but jboss continues to run normally. I'm not doing anything special with the run script. This is my runit run script: #!/bin/sh exec 2>&1 exec /opt/jboss-6.1.0.Final/bin/run.sh -c standard -b 0.0.0.0 Looking at the jboss_init_redhat.sh script, the start section does mention ./bin/run.sh but the stop section has the following text: JBOSS_CMD_STOP=${JBOSS_CMD_STOP:-"java -classpath $JBOSSCP org.jboss.Shutdown --shutdown"} Any ideas of what I could try?

    Read the article

  • Can i change the subnet on the vpn side of a server without having to change its whole lan (to avoid collission)

    - by Gusty
    Ohai, ive got a xp server with a client connecting via VPN. Problem (as we all know) is that sometimes the subnets clash. Instead of changing the whole server network every time this happens, cant i just have the server appear to have a different subnet to vpn clients? I have no interest in accessing other computers than the server on its LAN. I tried just turning off automatic dhcp in the servers vpn settings and changed it to 172.31.255.x. The client gets the address assigned alright and it can ping 172.31.255.1 but i cannot ping the server name (because the dns on the clients vpn connection points at 192.168.0.1?) wisdom? PS everything worked until the client hit a network with the same subnet as the server lan. thanks

    Read the article

  • A Duplicate name exists on the network

    - by Adam
    Recently we changed out office IT structure from having a dedicated server to be the DC, a dedicated server for the exchange etc... (Each running Windows Server 2003 R2) Now we have a single server running Windows SBS 2008 and created a new domain (with a different domain name) We then changed every PC so it connected to the new domain and renamed every PC with a new naming structure. After I had done this, we were getting several PCs that would get the following message just before the login screen (Alt+Ctrl+Del Screen) A Duplicate name exists on the network I have checked the ADUC and have removed the trouble PCs from the list and renamed each PC and changed the SID before connecting back onto the domain but still getting this message. I have tried everything that i can think of but still getting the problem. Any help would be greatly appreticated.

    Read the article

  • Windows 7 extremely long startup

    - by Tyler
    Windows 7 before it even gets to login. On the "starting windows" splash screen takes no less than 15 minutes to finish more like 25 minutes most times. During this time the hard drive activity led indicator is blinking maybe once every 20 seconds. When I finally get to the desktop everything runs normally. I have unplugged all peripherals with same result. Ideas? It's 32bit. 4gig memory. Fast CPU which I can't recall off the top of my head.

    Read the article

  • Does a modern PC require a graphics card to run?

    - by ArtM
    As I can remember, on old systems (Pentium II or III) it was not possible to boot and run the PC if the graphics card was missing (AGP cards were used in those days). Many years from then, I'm using motherboards with integrated graphics and I have no experience related to this subject, the "graphics card" always was present. Currently I intend to build a home/private "server" for my purposes and most of the motherboards I want to buy have no integrated graphics (AMD 870 or 970). I can take a normal graphics card from my firends for a few hours/days and use it when installing the necessary software. The question is: can I boot and run the PC without problems after I install everything I need and the graphics card is removed? if a general answer cannot be given, at least some examples of manufacturers/MB series/MB models will be helpfull I think it's obvious, but for completeness: I mean cheap desktop components, not real servers.

    Read the article

  • Very frequent "Server not found" messages

    - by Village
    Recently, while browsing and clicking or typing an address, I get: "Server not found", "Connection was reset", or a half-loaded page. Usually the page loads instantly after clicking reload, but this means I must reload on every page. Images on one site, but stored at a different server don't load until reloading for a second time. Clicking "submit" on many sites frequently doesn't work unless I reload many times. Sometimes sites load, but without colors and formating, appearing as if they would in Lynx. This seems to happen with every Web site. My Internet service claims everything on their end is fine. This happened a day after running an update in aptitude. I have not updated any hardware. I have tried clearing Iceweasel's cache. I do not have any router or other equipment. What could be going on? How can I troubleshoot this? PPPoE connection, Iceweasel 3.5.16, Debian 6

    Read the article

  • Can't see CMD.EXE on Windows 7

    - by Andrea
    I have a problem with Windows 7 and cmd.exe with these conditions: Logon as non admin user Launch cmd.exe I can see cmd.exe in task manager but it's invisible in the desktop and I don't know what to do, everything is fine and I can see cmd.exe if I do login with an admin account. I can see it in the "Process" tab but not in the "Application" tab, and if I launch five cmd.exe's, I see five processes, but from that tab I have no "Bring to front" or "Maximise" I can't find any WOW folder under C:\Windows, even with show hidden and system files enabled. I'm running Windows 7 32-bit running on a 64-bit Intel Core 2 Duo E7500

    Read the article

  • Mysql process goes over 100% of CPU usage

    - by Temnovit
    Hello! I'm experiencing some problems with my LAMP server. Recently, everything became very slow, even though visitor count on my websites didn't change to much. When I run top command, it sais that mysql process has taken over 150-200% of CPU. How's that possible, I always thought that 100% is a maximum? I'm running Ubuntu 9.04 server edition with 1,5 GB RAM my.cnf settings: key_buffer = 64M max_allowed_packet = 16M thread_stack = 192K thread_cache_size = 8 myisam-recover = BACKUP max_connections = 200 table_cache = 512 table_definition_cache = 512 thread_concurrency = 2 read_buffer_size = 1M sort_buffer_size = 4M join_buffer_size = 1M query_cache_limit = 1M # the maximum size of individual query results query_cache_size = 128M Here is the output of MySQLTuner: The top command: What could be the cause of this problem? Can I make changes to my my.cnf to prevent server from hanging?

    Read the article

  • "The requested operation could not be completed due to a file system limitation" 3202

    - by user46529
    I backup SQL Server database and it fails BACKUP DATABASE dd TO DISK = '\backupServer\backups\dd.bak' WITH COMPRESSION, CHECKSUM, NOFORMAT, INIT , BlockSize = 65536 , BufferCount = 2200 , MaxTransferSize = 4194304 The backup size is 3TB and I have 6TB free space on bacup server. I am using backup parameters per SQLCAT whitepaper. Everything works ok when I backup to local HDD and it always fails when I backup to network share. After about 6 hours. Can't find why. Thank you. Yes. The backup over the network is fastest and saves me 3Tb of local disk space :) Thanks for pointing to the memory issue. I left 4Gb to OS and it worked!

    Read the article

  • What is the best resource or method for learning more about servers and networking?

    - by kaleidomedallion
    I can get around a server to some degree, but everything I have learned has been as I have needed to learn it. Every once in a while I will learn about some new command that will revolutionize how I think about systems and networking, and realize how I could have been using it this whole time if only I had known about it. Anything to bring someone from novice to some kind of fluency? Do I just need to earn the battle scars bit by bit over the course of years? (I mean of course I do but what can I do to help it be not quite so painful?) For instance, I am still fuzzy on all of networking. Any help would be greatly appreciated.

    Read the article

  • Convert text to table

    - by Quattro
    I would like convert text into a table. Here is a link to the text http://www.tcdb.org/public/tcdb Short example: >gnl|TC-DB|A0CIB0|1.A.17.3.1 Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1 MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI >gnl|TC-DB|A0CS82|9.B.82.1.5 Chromosome undetermined scaffold_26, whole genome shotgun sequence - Paramecium tetraurelia. MIIEEQIEEKMIYKAIHRVKVNYQKKIDRYILYKKSRWFFNLLLMLLYAYRIQNIGGFYI VTYIYCVYQLQLLIDYFTPLGLPPVNLEDEEEDDDQFQNDFSELPTTLSNKNELNDKEFR PLLRTTSEFKVWQKSVFSVIFAYFCTYIPIWDIPVYWPFLFCYFFVIVGMSIRKYIKHMK KYGYTILDFTKKK I wanted to have columns for example delimited with pipe | or ; |>gnl|TC-DB|A0CIB0|1.A.17.3.1| Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1| MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI I am working with Windows and I don't know how to do it I just know every row starts with > I want to substitute the first whitespace in a row with a delimiter like | or ; after the first regular expression new line in a row, I want also a delimiter everything between the regular expression first new line and > should go into a new column (it's a sequence of a protein)

    Read the article

  • Script/scheduled task to clean up Dowloads folder (Windows 7)?

    - by Andrew
    My downloads folder is my primary connection to the internet (and thus the world), and has rapidly become a virtual junk drawer. I imagine I'm not alone here. What I'd like to do is have some sort of a script that -creates a new folder (named YYYY_MM Archive so it sorts nicely) -takes everything* inside of the Downloads folder (for the current user) -moves it to the new folder and have this run once/month. *(excluding previous archives) This strikes me as the type of thing Saw some answers on related questions that seemed to suggest that this is an eminently doable task in PowerShell. Is it? I'm on Windows 7 Enterprise.

    Read the article

  • No file sharing between two server 2008 R2 machines.

    - by ProfKaos
    I have just replaced XP with Server 2008 R2 on my test sever, and have been running 2008 R2 on my dev laptop. When my server was still XP, file sharing just worked, but now it just doesn't. I've enabled everything I can about sharing, and I can ping the server by machine name, but if I try an access a share, I get asked for a password. The passowrd dialog assumes a domain for this user, but neither my laptop admin user nor my server admin user can get past this login. What am I doing wrong?

    Read the article

  • how to restore windows 7 to a know working state every time it boots

    - by Artanis
    A couple of days ago my mother asked me to set up a computer at his house, she wants to use it to basic web browsing, video chat and nothing more. The problem is, neither my mother nor my sister know anything about using or maintaining a computer. What I want is to have a working base install of windows 7 and just discard everything installed, downloaded, ... when it reboots. That way I can set up a partition just for saving files and whatever they do the computer will always return to a working state at start up. can that be done? PS: Sadly linux is not an option since my sister wants to be able to play some games with my steam account and not all of them run with wine.

    Read the article

  • Database development/admin - What exactly should I be trying to learn? [closed]

    - by Sauron
    I've been a bit weary about approaching learning databases. I've dabbled into them before, and "DATA" in itself appeals to me a lot. Maintaining/searching/moving, everything about it in the abstract sense I love. (This isn't a career question, this is a learning question.) But as RDBMS's begin to be easier to maintain, and with tools that "anyone" can use to manage data I feared for the database admin jobs. (Yet I see jobs for SQL everywhere!). I know "No-SQL" was a big deal but it kinda has its niche. But that leaves me here... unsure of really "what" to study. What tools should I have in my tool belt? I'm sure RDBMS's will be around in both use and maintaining legacy code. But what else? Obviously data will always be around, but is this a secure field or a dying one? And what should I be concentrating on?

    Read the article

  • Hard drive skipped in boot

    - by Yasin
    Good evening. I just installed Ubuntu 12.04 using a USB, but right after the install, after restarting the machine, I get a message asking me to insert a bootable drive. My boot settings in Bios have the hard drive first, then DVD, then USB stick, and I have two systems installed, Windows 7 and Ubuntu 12.04. I suspected the hard drive got somehow disconnected internally, so I checked but everything was in place. I used the live USB to start Ubuntu, and I could see the hard drive and mount whatever partition I wanted. The one that contains the recently installed Ubuntu, looks the same. (It hasn't been deleted or anything). I'm not sure if this is a hardware problem or a loader(grub) problem, because the hard drive is visible. Only it isn't seen by the BIOS. My only means of internet connection is a USB modem, which doesn't work when I'm using the live USB, so I have can't download anything from the internet, in case someone asks. I also reinstalled Ubuntu 12.04, to no avail. This is my second problem with this laptop, and Ubuntu, and it's not even a week old. I hope this one gets solved. Thank you.

    Read the article

  • pfSense router gives DNS rebinding warning when accessing subdomains

    - by Richard Maddis
    I have just set up a router running pfSense on our network and forwarded the appropriate ports. I have a small web server running in my network, and a domain name pointing to our (WAN) IP. When accessing that domain name, everything works fine. However, when accessing a subdomain of the domain name, pfSense will give a DNS rebinding warning. This did not happen back when I used a DD-WRT router. What is the proper way to fix this? The DNS records for the subdomain also point to the same address (I use a virtual server to differentiate the subdomains.)

    Read the article

  • Changing location in Google Chrome when searching

    - by Alex
    I've recently moved to the Czech Republic from Scotland and I can't find a way to permanently stop Google from automatically defaulting back to google.cz all the time. I've checked to ensure that all my google accounts and cookie based settings (e.g. Advanced Search Options) are set to English but it's still clearly doing an IP address lookup and disregarding everything else. The default Search Engine for Google Chrome (and switches to google.cz automatically): {google:baseURL}search?{google:RLZ}{google:acceptedSuggestion}{google:originalQueryForSuggestion}sourceid=chrome&ie={inputEncoding}&q=%s I've tried hardcoding it to: http://www.google.com/search?{google:RLZ}{google:acceptedSuggestion}{google:originalQueryForSuggestion}sourceid=chrome&ie={inputEncoding}&q=%s this kind of works, but won't work for inline searching, i.e. I always have to press enter in order to get any results which is a bit annoying as I've gotten so used to AJAX style searching I can't have been the only one to get this issue? Any help is appreciated

    Read the article

< Previous Page | 339 340 341 342 343 344 345 346 347 348 349 350  | Next Page >