Search Results

Search found 19279 results on 772 pages for 'everything'.

Page 343/772 | < Previous Page | 339 340 341 342 343 344 345 346 347 348 349 350 | Next Page >

How to better explain complex software process in software specs?

- by Lostsoul

I'm really struggling with my software specs. I am not a professional programmer but enjoy doing it for fun and made some software that I want to sell later but I'm not happy with the code quality. So I wanted to hire a real developer to rewrite my software in a more professional way so it will be maintainable by other developers in the future. I read and found some sample specs and made my own by applying their structure to my document and wanted to get my developer friend to read it and give me advice. After an hour and a half he understood exactly what I was trying to do and how I did it(my algorithms,stack,etc.). How can I get better at explaining things to developers? I add many details and explanations for everything(including working code) but I'm unsure the best way I can learn to pass detailed domain knowledge(my software applies big data, machine learning, graph theory to finance). My end goal is to get them to understand as much as possible from the document and then ask anything they do not understand, but right now it seems they need to extract alot of information from me. How can I get better at communicating domain knowledge to developers?

Read the article
How change the layout (e.g. background-color) of autoplaylists in foobar2000?

- by UdeF

A nice feature of the highly customizable music player foobar2000 is to generate autoplaylists. Autoplaylists are filtered lists of music that automatically update when you add new music to your collection. You would usually generate one by searching for something and saving it as new autoplaylists, e.g.: %added% DURING LAST 4 WEEKS %genre% HAS jazz OR %genre% HAS downtempo %date% GREATER 1949 AND %date% LESS 1970 Autoplaylist playlists are locked: You can't add or delete files. You can note that thanks to the little icon in the status bar at the bottom of your screen: foobar2000 let's you customize nearly everything, so here is my question: Is there a way to change the layout of the autoplaylists? For example i want to change the background-color in my playlist view. I use the Columns UI component.

Read the article
Should this be written in C or php?

- by user1867842

This is my code; it speaks for itself on what I'm trying to do. <?php define("html","<html>"); define("htmlEnd","</html>"); etc... etc... ?> What I'm trying to do is make a wrapper for html's tags so they won't be needed anymore. But I can't get any of the attributes for html elements to be defined in PHP. This again speaks for itself; I don't know any other way of saying this. I guess how would I make another mark-up language like HTML without any tags but still keep everything about HTML is what I'm trying to say. My idea is for preventing XSS. For example, creating a special framework for the website itself that way there is no way any malicious attacker can guess because they know the HTML or PHP. I just don't want to make my website or something, and then my website gets hacked. Or if I make a website for someone and the website gets hacked. I am going to look like a unprofessional web developer. And what if I never get a job again.

Read the article
How do i know if i set up the nlb (network load balancing) cluster correctly???

- by letseatlunch

So ill start from the very beginning. I'm working on a web conference were we are going to show about 12 videos for a total of about half a gig for all 12. Since all the participants are going to be watching (and also streaming/downloading) at once it was recommended we set up a server farm. So i have 4 servers that i am trying to network together. They are all running Microsoft Server 2008 and i have spent the last three days setting them up and now that its done i want to make sure its all ready to go. so i just want to be sure that everything is setup the way that i think it is. What is the best way to do this. Really i want to make sure that the load will be split over the servers when its showtime. thanks for any help in advance letseatlunch Dave

Read the article
My Mac Book Pro is turning itself, on my bagpack

- by J. Pablo Fernández

This happens to me twice: I press the power button on my Mac Book Pro, I choose sleep, I close it, I unplug everything, I confirm that is off (by pressing my ear to it) and put it in my back. Some minutes latter it wakes up by itself. Both times I caught it in time, well, the second time it was so hot I couldn't touch some parts and it was refusing to actually wake up, the screen was blank. Restarting it worked though. Any ideas what might be going on and/or how to prevent this?

Read the article
Deepest sense of programming [closed]

- by xralf

I suffer on depression for a few months. Programming was one of my big passions (as a hobby). I had a motivation to achieve my goals (projects), to read books and articles about it to have interest in algorithms and data structures, compilers etc. Then, my mind started to think that it has no sense, that the result is useless. I realized, that I loved programming because of an illusion that it has deep sense, that I love playing with code every day as nothing else with feeling that it leads somewhere. Could I rationalize that it has sense to work on some programming project? That there is a deep sense to do it and enjoy this activity? I have no idea what else should I do in the free time, the mornings without motivation are very depressing. It was nice time when I had an illusion that programming is enjoyable. Could you help me to figure out the deepest sense of programming in this world? Why to love it again? What everything could be achieved and realized? (things like higher salary and ego are not what I'm looking for)

Read the article
Convert text to table

- by Quattro

I would like convert text into a table. Here is a link to the text http://www.tcdb.org/public/tcdb Short example: >gnl|TC-DB|A0CIB0|1.A.17.3.1 Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1 MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI >gnl|TC-DB|A0CS82|9.B.82.1.5 Chromosome undetermined scaffold_26, whole genome shotgun sequence - Paramecium tetraurelia. MIIEEQIEEKMIYKAIHRVKVNYQKKIDRYILYKKSRWFFNLLLMLLYAYRIQNIGGFYI VTYIYCVYQLQLLIDYFTPLGLPPVNLEDEEEDDDQFQNDFSELPTTLSNKNELNDKEFR PLLRTTSEFKVWQKSVFSVIFAYFCTYIPIWDIPVYWPFLFCYFFVIVGMSIRKYIKHMK KYGYTILDFTKKK I wanted to have columns for example delimited with pipe | or ; |>gnl|TC-DB|A0CIB0|1.A.17.3.1| Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1| MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI I am working with Windows and I don't know how to do it I just know every row starts with > I want to substitute the first whitespace in a row with a delimiter like | or ; after the first regular expression new line in a row, I want also a delimiter everything between the regular expression first new line and > should go into a new column (it's a sequence of a protein)

Read the article
Windows 8.1 keeps prompting for Network Share Credentials after every log on or restart

- by Peret del Trunfa

I have a Network drive Shared in a Workgroup with 3 clients. Two clients with Windows 7 have persistent connections to the Share. No issues with those two. My windows 8.1 client keeps prompting for credentials at every restart / log on. I spent hours looking around for a solution: I have stored cred in cred manager, and tried every possible combination (WORKGROUP\user , COMPUTERNAME\user, user, .. and so on). I have changed NT and NTLM negotiation in policy manager. I've compared the settings under GPO network security with a working win 7 computer, everything is pretty much the same. -I've captured Wireshark to see SMB negotiation process, honestly I see the messages flowing around, and the share sending AUTH DENIED.. which means is how the 8.1 client formats the request.... that makes the share reject it.. Now I still don't really know why. Any ideas would be appreciated.

Read the article
What is the best resource or method for learning more about servers and networking?

- by kaleidomedallion

I can get around a server to some degree, but everything I have learned has been as I have needed to learn it. Every once in a while I will learn about some new command that will revolutionize how I think about systems and networking, and realize how I could have been using it this whole time if only I had known about it. Anything to bring someone from novice to some kind of fluency? Do I just need to earn the battle scars bit by bit over the course of years? (I mean of course I do but what can I do to help it be not quite so painful?) For instance, I am still fuzzy on all of networking. Any help would be greatly appreciated.

Read the article
after BIOS splash, will not boot -- asks me to select an OS, but it just reboots

- by user92040

I'm running Linux Mint 13 MATE 64-bit. Everything has been working for several weeks. Yesterday, when I tried to boot up my computer, after the BIOS screen flashes I reach a screen with a black background that reads at the top: GNU GRUB version1.99-21ubuntu3.4 Then there is a box in which I can select from the following lines: Linux Mint 13 MATE 64-bit, 3.2.0-31-generic (/dev/sdb2) Linux Mint 13 MATE 64-bit, 3.2.0-31-generic (/dev/sdb2) -- recovery mode Previous Linux versions Memory test (memtest86+) Memory test (memtest86+, serial console 115200) At the bottom it reads: Use the ? and ? keys to select which entry is highlighed. Press enter to boot the selected OS, 'e' to edit the commands before booting or 'c' for a command-line. I have no idea why it started doing this and, worse, I have no idea how to get out of here. No matter which option I select, I can't get it to boot the OS. If I select either of the first two, it reboots to splash the BIOS and then I'm right back where I started. If I choose "Previous Linux versions" I get essentially the same screen with only two choices (which are the same as the first two choices listed above, Linux 13 MATE and the recovery mode). Again, choosing either one of those results in a reboot. If I try to run either of the memtest options, it reads: error: unknown command 'linux16', Press any key to continue... Then it brings me back to the same screen Can anyone help me please? Intel Core i5-2500 ASUS P8Z68-V LX Intel Motherboard G. Skill Ripjaws series F3-12800CL9D-8GBRL (4GB x2) Plextor 128GB M5S Series SSD

Read the article
Which jar has JBox2d's p5 package

- by Brantley Blanchard

Using eclipse, I'm trying to write a simple hello world program in processing that simply draws a rectangle on the screen then has gravity drop it as seen in this Tutorial. The problem is that when I try to import the p5 package, it's not resolving so I can't declare my Physics object. I tried two things. Download the zip, unzip it, then import the 3 jars (library, serialization, & testbed) a. import org.jbox2d.p5.*; doesn't resolve but the others do b. Physics physics; doesn't resolve Download the older standalone testbed jar then import it a. Physics physics; doesn't resolve; Here is basically where I'm starting import org.jbox2d.util.nonconvex.*; import org.jbox2d.dynamics.contacts.*; import org.jbox2d.testbed.*; import org.jbox2d.collision.*; import org.jbox2d.common.*; import org.jbox2d.dynamics.joints.*; import org.jbox2d.p5.*; import org.jbox2d.dynamics.*; import processing.core.PApplet; public class MyFirstJBox2d extends PApplet { Physics physics; public void setup() { size(640,480); frameRate(60); initScene(); } public void draw() { background(0); if (keyPressed) { //Reset everything physics.destroy(); initScene(); } } public void initScene() { physics = new Physics(this, width, height); physics.setDensity(1.0f); physics.createRect(300,200,340,300); } }

Read the article
Node.js installation on Debian 6

- by pvorb

I used to use this method for node.js installation on Debian, since it was easy and everything worked fine. Even with multiple users. Since version 0.6.18~dfsg1-1 of the sid package, installation removes openssh-server. But I need OpenSSH to connect to my server. Is there any possibility to install Node.js via APT or do I have to compile it manually? This is my APT preferences file: Package: * Pin: release a=stable Pin-Priority: 800 Package: * Pin: release a=testing Pin-Priority: 650 Package: * Pin: release a=unstable Pin-Priority: 600

Read the article
In developing a soap client proxy, which return structure is easier to use and more sensible?

- by cori

I'm writing (in PHP) a client/proxy for a SOAP web service. The return types are consistently wrapped in response objects that contain the return values. In many cases this make a lot of sense - for instance when multiple values are being returned: GetDetailsResponse Object ( Results Object ( [TotalResults] => 10 [NextPage] => 2 ) [Details] => Array ( [0] => Detail Object ( [Id] => 1 ) ) ) But some of the methods return a single scalar value or a single object or array wrapped in a response object: GetThingummyIdResponse Object ( [ThingummyId] => 42 ) In some cases these objects might be pretty deep, so getting at properties within requires drilling down several layers: $response->Details->Detail[0]->Contents->Item[5]->Id And if I unwrap them before passing them back I can strip out a layer from consumers' code. I know I'm probably being a little bit of an Architecture Astronaut here, but the latter style really bug me, so I've been working through my code to have my proxy methods just return the scalar value to the client code where there's no absolute need for a wrapper object. My question is, am I actually making things more difficult for the consumers of my code? Would I be better off just leaving the return values wrapped in response objects so that everything is consistent, or is removing unneccessary layers of indirection/abstraction worthwhile?

Read the article
One subdomain is not working

- by BFTrick

Hello there, My main domain works just fine - www.example.com and a subdomain set up by another developer works as well - sub1.example.com. But when I try to set another subdomain up I go through the process everything seems to work. The software creates the default files where the subdomain files should go. But when I try to browse there it doesn't work. My host uses Plesk to do all of the hosting stuff. What do you think the problem is? I doubt it is some sort of cache issue because I had problems on my phone which I tried after problems on the pc. Maybe for some reason Plesk needs time to set this up? I have used Cpanel before and that works instantly.

Read the article
A Duplicate name exists on the network

- by Adam

Recently we changed out office IT structure from having a dedicated server to be the DC, a dedicated server for the exchange etc... (Each running Windows Server 2003 R2) Now we have a single server running Windows SBS 2008 and created a new domain (with a different domain name) We then changed every PC so it connected to the new domain and renamed every PC with a new naming structure. After I had done this, we were getting several PCs that would get the following message just before the login screen (Alt+Ctrl+Del Screen) A Duplicate name exists on the network I have checked the ADUC and have removed the trouble PCs from the list and renamed each PC and changed the SID before connecting back onto the domain but still getting this message. I have tried everything that i can think of but still getting the problem. Any help would be greatly appreticated.

Read the article
Unable to start after 13.04 > 13.10 udate

- by romainl

At the end of the update process, clicking on the Restart button had no visible effect whatsoever. After waiting 5 to 10 minutes, I decided to reboot the computer manually. Since then, I rebooted a good dozen times (not with the hope that it would work but with the hope of reading the messages) with the same non-result and the same symptoms: I get the ASCII text-on-purple Ubuntu 13.10 . . . . splash screen with these messages: * Restoring resolver state... [OK] * Starting crash report submission daemon [OK] * Starting CUPS printing spooler/server [OK] Everything disappears. The whole process hangs at a purple screen with the mouse cursor right in the middle. At this point, I'm unable to use the mouse and the keyboard. Booting from a 12.04 CD works perfectly, Disk Utility says that all my disks are OK and I can mount my main partition without problems. Something obviously went wrong at the end of the upgrade but I have no idea what. I'd appreciate any pointer. This is the kind of moment where you really think "Next time, I'll separate my /home partition for sure". My machine is an aging but working Dell Inspiron 530 with an Intel Core Duo E2160 processor, 2 GHz of RAM and an ATI Radeon HD3650 video card. Thanks.

Read the article
Hard drive skipped in boot

- by Yasin

Good evening. I just installed Ubuntu 12.04 using a USB, but right after the install, after restarting the machine, I get a message asking me to insert a bootable drive. My boot settings in Bios have the hard drive first, then DVD, then USB stick, and I have two systems installed, Windows 7 and Ubuntu 12.04. I suspected the hard drive got somehow disconnected internally, so I checked but everything was in place. I used the live USB to start Ubuntu, and I could see the hard drive and mount whatever partition I wanted. The one that contains the recently installed Ubuntu, looks the same. (It hasn't been deleted or anything). I'm not sure if this is a hardware problem or a loader(grub) problem, because the hard drive is visible. Only it isn't seen by the BIOS. My only means of internet connection is a USB modem, which doesn't work when I'm using the live USB, so I have can't download anything from the internet, in case someone asks. I also reinstalled Ubuntu 12.04, to no avail. This is my second problem with this laptop, and Ubuntu, and it's not even a week old. I hope this one gets solved. Thank you.

Read the article
Setup Email Server (sendmail + dovecot + squirrelmail)

- by henry

I am in the process of setting up my very first email server. I can get everything up and running (thanks to apt-get). Manage to tie the users with system users. Now I am setting up virtual users for dovecot. But however, I also notice I can setup users in sendmail itself. Why is it so that you can setup users in 2 different places. Other mail server will send to the user in sendmail or dovecot?

Read the article
Make download dialog show up for pictures in IIS 6.0

- by LinuxGnut

I have a client that is offering picture downloads from their site. They want the user to have to download the picture, rather than having it appear in the browser when the link is clicked. Inserting the text "Right-click to save as" or something similar isn't an option with this client, as everything needs to be done their way. Now, I know I could accomplish this task in PHP or ASP, but I'd rather not have to write an addition to Magento to accomplish this. So is there a way in IIS 6.0 (Server 2003) to send the correct headers for image formats in that it will make a download dialog pop up?

Read the article
After moving our Servers to a virtual environment using VMware - SQL timeouts came in, why?

- by RayofCommand

We moved our servers to a virtual cloud (VMware) where only our servers are in. But as soon as we finished migrating everything we are fighting against SQL Timeouts and machine slowdowns we can't explain. Even though we ~ doubled the servers capacity while switching from physical to virtual. Now I googled and found that we are not alone. People are complaining about poor performance after moving to a cloud managed by VMware. Are there any known issues? Sometimes our services can't access a disk or SQL receives a timeout and we have no idea why.

Read the article
itunes equalizer per track settings

- by DA

I'm a little confused about iTune's ability to set eq presets on a per-song basis. I have a song that I open, set to a given EQ preset, then close. When I play this song, however, the audio isn't being adjusted. If I open the EQ and turn it 'on', though, it then obeys the song's eq setting. Of course, if I leave the EQ on, then songs that do not have their own EQ setting default to whatever the EQ was originally set at. Not a HUGE deal, but it means that I would then normally have to have EQ always turned on, set to flat, so that any song that I HAVE given a EQ setting to will use it. Am I understanding how that works correctly? Is there a way to have individual songs use their EQ setting without having to turn on the EQ for everything?

Read the article
Is there a way to adjust colors of a specific window?

- by Synetech

Is there a (Windows) program or something that will allow the user to adjust the brightness/contrast/gamma of a specific window rather than the whole screen? As a use-case scenario, imagine having a web-page showing on one half of the screen, and another program taking up the rest of the screen. This other program uses the default Windows colors (e.g., white background), so it may be glaringly bright. Alternately, the web-page may be too dark to see. Adjusting the monitor or video-card settings would affect everything which will be no good. Adjusting the default Windows colors is, at best, inconvenient. Instead, there needs to be a way to set the colors of one of the windows to equalize the whole screen.

Read the article
What's wrong with this Open GL ES 2.0. Shader?

- by Project Dumbo Dev

I just can't understand this. The code works perfectly on the emulator(Which is supposed to give more problems than phones…), but when I try it on a LG-E610 it doesn't compile the vertex shader. This is my log error(Which contains the shader code as well): EDITED Shader: uniform mat4 u_Matrix; uniform int u_XSpritePos; uniform int u_YSpritePos; uniform float u_XDisplacement; uniform float u_YDisplacement; attribute vec4 a_Position; attribute vec2 a_TextureCoordinates; varying vec2 v_TextureCoordinates; void main(){ v_TextureCoordinates.x= (a_TextureCoordinates.x + u_XSpritePos) * u_XDisplacement; v_TextureCoordinates.y= (a_TextureCoordinates.y + u_YSpritePos) * u_YDisplacement; gl_Position = u_Matrix * a_Position; } Log reports this before loading/compiling shader: 11-05 18:46:25.579: D/memalloc(1649): /dev/pmem: Mapped buffer base:0x51984000 size:5570560 offset:4956160 fd:46 11-05 18:46:25.629: D/memalloc(1649): /dev/pmem: Mapped buffer base:0x5218d000 size:5836800 offset:5570560 fd:49 Maybe it has something to do with that men alloc? The phone is also giving a constant error while plugged: ERROR FBIOGET_ESDCHECKLOOP fail, from msm7627a.gralloc Edited: "InfoLog:" refers to glGetShaderInfoLog, and it's returning nothing. Since I removed the log in a previous edit I will just say i'm looking for feedback on compiling shaders. Solution + More questions: Ok, the problem seems to be that either ints are not working(generally speaking) or that you can't mix floats with ints. That brings to me the question, why on earth glGetShaderInfoLog is returning nothing? Shouldn't it tell me something is wrong on those lines? It surely does when I misspell something. I solved by turning everything into floats, but If someone can add some light into this, It would be appreciated. Thanks.

Read the article
phpmyadmin or other mysql gui - edit whole table from one screen

- by lorem

Let's say I have table in database. I'd like to be able to view all data from this table and be able to edit every field from single screen. I tried to do this in phpmyadmin but I'm not sure how... I can see all data but I have to click edit on single field and then I'm sent to next screen, can't really edit everything at once. How do I do this in phpmyadmin or other mysql gui? I'm on Linux, my server too. I'd like each field in table to be editable text field - maybe this will show better what I'm searching for.

Read the article
Can i change the subnet on the vpn side of a server without having to change its whole lan (to avoid collission)

- by Gusty

Ohai, ive got a xp server with a client connecting via VPN. Problem (as we all know) is that sometimes the subnets clash. Instead of changing the whole server network every time this happens, cant i just have the server appear to have a different subnet to vpn clients? I have no interest in accessing other computers than the server on its LAN. I tried just turning off automatic dhcp in the servers vpn settings and changed it to 172.31.255.x. The client gets the address assigned alright and it can ping 172.31.255.1 but i cannot ping the server name (because the dns on the clients vpn connection points at 192.168.0.1?) wisdom? PS everything worked until the client hit a network with the same subnet as the server lan. thanks

Read the article

< Previous Page | 339 340 341 342 343 344 345 346 347 348 349 350 | Next Page >