Search Results

Search found 19279 results on 772 pages for 'everything'.

Page 343/772 | < Previous Page | 339 340 341 342 343 344 345 346 347 348 349 350  | Next Page >

  • What is the best resource or method for learning more about servers and networking?

    - by kaleidomedallion
    I can get around a server to some degree, but everything I have learned has been as I have needed to learn it. Every once in a while I will learn about some new command that will revolutionize how I think about systems and networking, and realize how I could have been using it this whole time if only I had known about it. Anything to bring someone from novice to some kind of fluency? Do I just need to earn the battle scars bit by bit over the course of years? (I mean of course I do but what can I do to help it be not quite so painful?) For instance, I am still fuzzy on all of networking. Any help would be greatly appreciated.

    Read the article

  • Laptop held hostage by administrator domain and Bit locker

    - by user144780
    I have a laptop computer that I had when I was working at an IT company. I don´t work there anymore but I could keep the computer (Lenovo) Suddenly my wireless internet didn´t work anymore showing error "insert SIM into the mobile broadband device" and month later connectiong to internet with cable got disabled I don´t know the password to sign in as an administrator on domain and whatever I try to do/install/change settings... everything needs admin rights. To surf the internet again with the computer I tried to install a new Windows but it´s seems to be protected with Bit Locker, asking for recovery key. I´ve googled and googled bunch of CMD tricks but most of the shows "system error 5 has occured" Is there anyway to get the wireless internet to work, change the admin or install new Windows? - or should I rather enjoying throwing it of the balcony or set it one fire? :)

    Read the article

  • Which jar has JBox2d's p5 package

    - by Brantley Blanchard
    Using eclipse, I'm trying to write a simple hello world program in processing that simply draws a rectangle on the screen then has gravity drop it as seen in this Tutorial. The problem is that when I try to import the p5 package, it's not resolving so I can't declare my Physics object. I tried two things. Download the zip, unzip it, then import the 3 jars (library, serialization, & testbed) a. import org.jbox2d.p5.*; doesn't resolve but the others do b. Physics physics; doesn't resolve Download the older standalone testbed jar then import it a. Physics physics; doesn't resolve; Here is basically where I'm starting import org.jbox2d.util.nonconvex.*; import org.jbox2d.dynamics.contacts.*; import org.jbox2d.testbed.*; import org.jbox2d.collision.*; import org.jbox2d.common.*; import org.jbox2d.dynamics.joints.*; import org.jbox2d.p5.*; import org.jbox2d.dynamics.*; import processing.core.PApplet; public class MyFirstJBox2d extends PApplet { Physics physics; public void setup() { size(640,480); frameRate(60); initScene(); } public void draw() { background(0); if (keyPressed) { //Reset everything physics.destroy(); initScene(); } } public void initScene() { physics = new Physics(this, width, height); physics.setDensity(1.0f); physics.createRect(300,200,340,300); } }

    Read the article

  • How change the layout (e.g. background-color) of autoplaylists in foobar2000?

    - by UdeF
    A nice feature of the highly customizable music player foobar2000 is to generate autoplaylists. Autoplaylists are filtered lists of music that automatically update when you add new music to your collection. You would usually generate one by searching for something and saving it as new autoplaylists, e.g.: %added% DURING LAST 4 WEEKS %genre% HAS jazz OR %genre% HAS downtempo %date% GREATER 1949 AND %date% LESS 1970 Autoplaylist playlists are locked: You can't add or delete files. You can note that thanks to the little icon in the status bar at the bottom of your screen: foobar2000 let's you customize nearly everything, so here is my question: Is there a way to change the layout of the autoplaylists? For example i want to change the background-color in my playlist view. I use the Columns UI component.

    Read the article

  • Windows 8.1 keeps prompting for Network Share Credentials after every log on or restart

    - by Peret del Trunfa
    I have a Network drive Shared in a Workgroup with 3 clients. Two clients with Windows 7 have persistent connections to the Share. No issues with those two. My windows 8.1 client keeps prompting for credentials at every restart / log on. I spent hours looking around for a solution: I have stored cred in cred manager, and tried every possible combination (WORKGROUP\user , COMPUTERNAME\user, user, .. and so on). I have changed NT and NTLM negotiation in policy manager. I've compared the settings under GPO network security with a working win 7 computer, everything is pretty much the same. -I've captured Wireshark to see SMB negotiation process, honestly I see the messages flowing around, and the share sending AUTH DENIED.. which means is how the 8.1 client formats the request.... that makes the share reject it.. Now I still don't really know why. Any ideas would be appreciated.

    Read the article

  • How do i know if i set up the nlb (network load balancing) cluster correctly???

    - by letseatlunch
    So ill start from the very beginning. I'm working on a web conference were we are going to show about 12 videos for a total of about half a gig for all 12. Since all the participants are going to be watching (and also streaming/downloading) at once it was recommended we set up a server farm. So i have 4 servers that i am trying to network together. They are all running Microsoft Server 2008 and i have spent the last three days setting them up and now that its done i want to make sure its all ready to go. so i just want to be sure that everything is setup the way that i think it is. What is the best way to do this. Really i want to make sure that the load will be split over the servers when its showtime. thanks for any help in advance letseatlunch Dave

    Read the article

  • One subdomain is not working

    - by BFTrick
    Hello there, My main domain works just fine - www.example.com and a subdomain set up by another developer works as well - sub1.example.com. But when I try to set another subdomain up I go through the process everything seems to work. The software creates the default files where the subdomain files should go. But when I try to browse there it doesn't work. My host uses Plesk to do all of the hosting stuff. What do you think the problem is? I doubt it is some sort of cache issue because I had problems on my phone which I tried after problems on the pc. Maybe for some reason Plesk needs time to set this up? I have used Cpanel before and that works instantly.

    Read the article

  • In developing a soap client proxy, which return structure is easier to use and more sensible?

    - by cori
    I'm writing (in PHP) a client/proxy for a SOAP web service. The return types are consistently wrapped in response objects that contain the return values. In many cases this make a lot of sense - for instance when multiple values are being returned: GetDetailsResponse Object ( Results Object ( [TotalResults] => 10 [NextPage] => 2 ) [Details] => Array ( [0] => Detail Object ( [Id] => 1 ) ) ) But some of the methods return a single scalar value or a single object or array wrapped in a response object: GetThingummyIdResponse Object ( [ThingummyId] => 42 ) In some cases these objects might be pretty deep, so getting at properties within requires drilling down several layers: $response->Details->Detail[0]->Contents->Item[5]->Id And if I unwrap them before passing them back I can strip out a layer from consumers' code. I know I'm probably being a little bit of an Architecture Astronaut here, but the latter style really bug me, so I've been working through my code to have my proxy methods just return the scalar value to the client code where there's no absolute need for a wrapper object. My question is, am I actually making things more difficult for the consumers of my code? Would I be better off just leaving the return values wrapped in response objects so that everything is consistent, or is removing unneccessary layers of indirection/abstraction worthwhile?

    Read the article

  • JBoss DataSource - How can ConnectionCount be larget than MaxSize?

    - by Qben
    I am running JBoss 4.0.5GA and I have stumbled upon a strange scenario (In my eyes anyway). When I decreases the <max-connections> to 1 for a Quartz DataSource and restart the server everything works fine. When I check the JMX console I can see that ConnectionCount and MaxConnectionInUseCount are both 2. The question is, how can the ConnectionCount be higher than the pool MaxSize (Which is 1 in JMX console as expected)? As a note I did this to try to trigger a production problem I have from time to time where a Quartz DB connection cannot be retrieved for some odd reason (Pool not full).

    Read the article

  • Node.js installation on Debian 6

    - by pvorb
    I used to use this method for node.js installation on Debian, since it was easy and everything worked fine. Even with multiple users. Since version 0.6.18~dfsg1-1 of the sid package, installation removes openssh-server. But I need OpenSSH to connect to my server. Is there any possibility to install Node.js via APT or do I have to compile it manually? This is my APT preferences file: Package: * Pin: release a=stable Pin-Priority: 800 Package: * Pin: release a=testing Pin-Priority: 650 Package: * Pin: release a=unstable Pin-Priority: 600

    Read the article

  • Should this be written in C or php?

    - by user1867842
    This is my code; it speaks for itself on what I'm trying to do. <?php define("html","<html>"); define("htmlEnd","</html>"); etc... etc... ?> What I'm trying to do is make a wrapper for html's tags so they won't be needed anymore. But I can't get any of the attributes for html elements to be defined in PHP. This again speaks for itself; I don't know any other way of saying this. I guess how would I make another mark-up language like HTML without any tags but still keep everything about HTML is what I'm trying to say. My idea is for preventing XSS. For example, creating a special framework for the website itself that way there is no way any malicious attacker can guess because they know the HTML or PHP. I just don't want to make my website or something, and then my website gets hacked. Or if I make a website for someone and the website gets hacked. I am going to look like a unprofessional web developer. And what if I never get a job again.

    Read the article

  • after BIOS splash, will not boot -- asks me to select an OS, but it just reboots

    - by user92040
    I'm running Linux Mint 13 MATE 64-bit. Everything has been working for several weeks. Yesterday, when I tried to boot up my computer, after the BIOS screen flashes I reach a screen with a black background that reads at the top: GNU GRUB version1.99-21ubuntu3.4 Then there is a box in which I can select from the following lines: Linux Mint 13 MATE 64-bit, 3.2.0-31-generic (/dev/sdb2) Linux Mint 13 MATE 64-bit, 3.2.0-31-generic (/dev/sdb2) -- recovery mode Previous Linux versions Memory test (memtest86+) Memory test (memtest86+, serial console 115200) At the bottom it reads: Use the ? and ? keys to select which entry is highlighed. Press enter to boot the selected OS, 'e' to edit the commands before booting or 'c' for a command-line. I have no idea why it started doing this and, worse, I have no idea how to get out of here. No matter which option I select, I can't get it to boot the OS. If I select either of the first two, it reboots to splash the BIOS and then I'm right back where I started. If I choose "Previous Linux versions" I get essentially the same screen with only two choices (which are the same as the first two choices listed above, Linux 13 MATE and the recovery mode). Again, choosing either one of those results in a reboot. If I try to run either of the memtest options, it reads: error: unknown command 'linux16', Press any key to continue... Then it brings me back to the same screen Can anyone help me please? Intel Core i5-2500 ASUS P8Z68-V LX Intel Motherboard G. Skill Ripjaws series F3-12800CL9D-8GBRL (4GB x2) Plextor 128GB M5S Series SSD

    Read the article

  • Crontab + .sh + php

    - by Kristaps Karlsons
    Hi. I'm trying to call a shell script every 5 minutes, witch executes php file under root. # crontab -l */5 * * * * /home/regularuser/call.sh permissions: -rw-rw-rw- 1 root root 162 Jun 6 23:40 call.php -rwxr-xr-x 1 root root 66 Jun 7 01:20 call.sh call.sh contents: #!/bin/bash php -q /home/regularuser/call.php echo "request processed" My problem is that my php file doesn't get executed via crontab. However, if I call call.sh - everything works perfectly. I'm new to crontab and shell scripting, so any advice/resources are welcome.

    Read the article

  • Convert text to table

    - by Quattro
    I would like convert text into a table. Here is a link to the text http://www.tcdb.org/public/tcdb Short example: >gnl|TC-DB|A0CIB0|1.A.17.3.1 Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1 MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI >gnl|TC-DB|A0CS82|9.B.82.1.5 Chromosome undetermined scaffold_26, whole genome shotgun sequence - Paramecium tetraurelia. MIIEEQIEEKMIYKAIHRVKVNYQKKIDRYILYKKSRWFFNLLLMLLYAYRIQNIGGFYI VTYIYCVYQLQLLIDYFTPLGLPPVNLEDEEEDDDQFQNDFSELPTTLSNKNELNDKEFR PLLRTTSEFKVWQKSVFSVIFAYFCTYIPIWDIPVYWPFLFCYFFVIVGMSIRKYIKHMK KYGYTILDFTKKK I wanted to have columns for example delimited with pipe | or ; |>gnl|TC-DB|A0CIB0|1.A.17.3.1| Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1| MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI I am working with Windows and I don't know how to do it I just know every row starts with > I want to substitute the first whitespace in a row with a delimiter like | or ; after the first regular expression new line in a row, I want also a delimiter everything between the regular expression first new line and > should go into a new column (it's a sequence of a protein)

    Read the article

  • Drive reporting incorrect free space

    - by Oli
    So I swapped my shiny SATA SSD for an even shinier PCI-E SSD. I run my core OS on the SSD because it's silly-fast. I did this on my old SSD so I created a new EXT4 partition and then just dded the data across (sorry I don't know the exact command I ran anymore) and after reinstalling grub, I booted onto the PCI-E SSD. At first glance everything had worked perfectly and things were running faster than ever. But then I noticed the free disk space on the new, larger drive: it was almost exactly the same as it was on the other disk... A disk that was half its size. So it looks as if I've copied the files across incorrectly and it's copied some of the filesystem metadata along with it. Tools like du and Disk Usage Analyzer come back with the correct figures. Things that look at the partition (and not the files) seem to think the drive is 120GB I've been using this drive for a week now so it's way out of sync with the old SSD so dumping the data and starting again isn't a job that fills me with joy but two questions: Is there a way to fix my filesystem so it knows what it's really on about? fsck e2fsck and badblocks all seem to be able to scan it without finding a problem with it. If I do plug my old SSD back in, copy the data off my PCI-E on to it and then copy it back onto a fresh filesystem (eg juggle the data around), what's the best way of doing that? I obviously want to keep all the permissions and softlinks where they are.

    Read the article

  • Mirroring of Apps across servers

    - by user1038814
    We wish to host multiple apps across multiple servers. What we are looking for (ideally) is an existing solution which will work. For example, normally to do it we'd follow a route (for failover) like: App is installed on one server along with mysql database App is also installed on a second server. Rsync is used to mirror the files over to the second server and ensure consistency MySQL is installed with a Master-Slave setup. We use a service such as DNS Made Easy which has a DNS failover. If one server goes down it automatically routes traffic to the backup server We have done the above a few times and generally its fine. The issue I have here is that the above is for one app. What I would like to look at is how we can manage for multiple apps and if there is a layer (such as VMWare) that has complete mirroring built in at the OS level? For example how do web hosts currently do it when they ensure that more than one machine is running a bunch of hosted websites. If you were running hosting and you had 200 clients on a server you would want the same clients across 2 or more servers and want everything mirrored. Any advice would be much appreciated.

    Read the article

  • A Duplicate name exists on the network

    - by Adam
    Recently we changed out office IT structure from having a dedicated server to be the DC, a dedicated server for the exchange etc... (Each running Windows Server 2003 R2) Now we have a single server running Windows SBS 2008 and created a new domain (with a different domain name) We then changed every PC so it connected to the new domain and renamed every PC with a new naming structure. After I had done this, we were getting several PCs that would get the following message just before the login screen (Alt+Ctrl+Del Screen) A Duplicate name exists on the network I have checked the ADUC and have removed the trouble PCs from the list and renamed each PC and changed the SID before connecting back onto the domain but still getting this message. I have tried everything that i can think of but still getting the problem. Any help would be greatly appreticated.

    Read the article

  • Unable to start after 13.04 > 13.10 udate

    - by romainl
    At the end of the update process, clicking on the Restart button had no visible effect whatsoever. After waiting 5 to 10 minutes, I decided to reboot the computer manually. Since then, I rebooted a good dozen times (not with the hope that it would work but with the hope of reading the messages) with the same non-result and the same symptoms: I get the ASCII text-on-purple Ubuntu 13.10 . . . . splash screen with these messages: * Restoring resolver state... [OK] * Starting crash report submission daemon [OK] * Starting CUPS printing spooler/server [OK] Everything disappears. The whole process hangs at a purple screen with the mouse cursor right in the middle. At this point, I'm unable to use the mouse and the keyboard. Booting from a 12.04 CD works perfectly, Disk Utility says that all my disks are OK and I can mount my main partition without problems. Something obviously went wrong at the end of the upgrade but I have no idea what. I'd appreciate any pointer. This is the kind of moment where you really think "Next time, I'll separate my /home partition for sure". My machine is an aging but working Dell Inspiron 530 with an Intel Core Duo E2160 processor, 2 GHz of RAM and an ATI Radeon HD3650 video card. Thanks.

    Read the article

  • Repairing a TFS 2005 install or starting anew.

    - by Johan Buret
    Following : Installing Team Foundation Server on a shared database instance We did use a shared database instance setup for TFS 2005, and that was not a good idea, because of the Reporting Service dependency. The reporting instance on the server gives error code 404. What works now Basic source code control. We're able to check in and out source code. What doesn't work : Everything else, including : Opening and creating new team projects. Build automation. Internal bug tracking. Goal setup Having a fully working TFS install, and keeping the history. 1) A full install of TFS 2005 on the same server, but within its own database and reporting instance. 2) Using another server might be an option, but it's really not prefered Downtime should be minimum, my colleagues needs to be able to work on the source Readings I've read the MSDN page about moving/restoring TFS 2005, but I'm still unsure about what to do. Thanks in advance for help

    Read the article

  • What's wrong with this Open GL ES 2.0. Shader?

    - by Project Dumbo Dev
    I just can't understand this. The code works perfectly on the emulator(Which is supposed to give more problems than phones…), but when I try it on a LG-E610 it doesn't compile the vertex shader. This is my log error(Which contains the shader code as well): EDITED Shader: uniform mat4 u_Matrix; uniform int u_XSpritePos; uniform int u_YSpritePos; uniform float u_XDisplacement; uniform float u_YDisplacement; attribute vec4 a_Position; attribute vec2 a_TextureCoordinates; varying vec2 v_TextureCoordinates; void main(){ v_TextureCoordinates.x= (a_TextureCoordinates.x + u_XSpritePos) * u_XDisplacement; v_TextureCoordinates.y= (a_TextureCoordinates.y + u_YSpritePos) * u_YDisplacement; gl_Position = u_Matrix * a_Position; } Log reports this before loading/compiling shader: 11-05 18:46:25.579: D/memalloc(1649): /dev/pmem: Mapped buffer base:0x51984000 size:5570560 offset:4956160 fd:46 11-05 18:46:25.629: D/memalloc(1649): /dev/pmem: Mapped buffer base:0x5218d000 size:5836800 offset:5570560 fd:49 Maybe it has something to do with that men alloc? The phone is also giving a constant error while plugged: ERROR FBIOGET_ESDCHECKLOOP fail, from msm7627a.gralloc Edited: "InfoLog:" refers to glGetShaderInfoLog, and it's returning nothing. Since I removed the log in a previous edit I will just say i'm looking for feedback on compiling shaders. Solution + More questions: Ok, the problem seems to be that either ints are not working(generally speaking) or that you can't mix floats with ints. That brings to me the question, why on earth glGetShaderInfoLog is returning nothing? Shouldn't it tell me something is wrong on those lines? It surely does when I misspell something. I solved by turning everything into floats, but If someone can add some light into this, It would be appreciated. Thanks.

    Read the article

  • Linux, GNU GCC, ld, version scripts and the ELF binary format -- How does it work? [closed]

    - by themoondothshine
    I'm trying to learn more about library versioning in Linux and how to put it all to work. Here's the context: I have two versions of a dynamic library which expose the same set of interfaces, say libsome1.so and libsome2.so. An application is linked against libsome1.so. This application uses libdl.so to dynamically load another module, say libmagic.so. Now libmagic.so is linked against libsome2.so. Obviously, without using linker scripts to hide symbols in libmagic.so, at run-time all calls to interfaces in libsome2.so are resolved to libsome1.so. This can be confirmed by checking the value returned by libVersion() against the value of the macro LIB_VERSION. So I try next to compile and link libmagic.so with a linker script which hides all symbols except 3 which are defined in libmagic.so and are exported by it. This works... Or at least libVersion() and LIB_VERSION values match (and it reports version 2 not 1). However, when some data structures are serialized to disk, I noticed some corruption. In the application's directory if I delete libsome1.so and create a soft link in its place to point to libsome2.so, everything works as expected and the same corruption does not happen. I can't help but think that this may be caused due to some conflict in the run-time linker's resolution of symbols. I've tried many things, like trying to link libsome2.so so that all symbols are alised to symbol@@VER_2 (which I am still confused about because the command nm -CD libsome2.so still lists symbols as symbol and not symbol@@VER_2), but nothing seems to work. What am I doing wrong?

    Read the article

  • VMWare workstation: guest OS becomes sluggish after being idle for 12+ hours?

    - by GenEric35
    Hi, My VM becomes sluggish after a few hours(~12 hours or so) of being idle, there is no impact on the host, just the gueste. The guest OS becomes sluggish. It has lots of RAM, runs on Raid 0, quad core i5 750, everything is defragged, but the only way I found to keep it's responsiveness optimal is to shutdown(dumps the memory) and the start; a restart of the guest OS doesnt dump the memory so I need to be able to do a stop of the VM, and then a start. Coming from Hyper-V I had to learn VMWare and after a few months of fine tunning it I'm quite impressed with how configurable VMWare is. This is the only small issue I haven't been able to fix, has anyone encountered this?

    Read the article

  • Can i change the subnet on the vpn side of a server without having to change its whole lan (to avoid collission)

    - by Gusty
    Ohai, ive got a xp server with a client connecting via VPN. Problem (as we all know) is that sometimes the subnets clash. Instead of changing the whole server network every time this happens, cant i just have the server appear to have a different subnet to vpn clients? I have no interest in accessing other computers than the server on its LAN. I tried just turning off automatic dhcp in the servers vpn settings and changed it to 172.31.255.x. The client gets the address assigned alright and it can ping 172.31.255.1 but i cannot ping the server name (because the dns on the clients vpn connection points at 192.168.0.1?) wisdom? PS everything worked until the client hit a network with the same subnet as the server lan. thanks

    Read the article

  • itunes equalizer per track settings

    - by DA
    I'm a little confused about iTune's ability to set eq presets on a per-song basis. I have a song that I open, set to a given EQ preset, then close. When I play this song, however, the audio isn't being adjusted. If I open the EQ and turn it 'on', though, it then obeys the song's eq setting. Of course, if I leave the EQ on, then songs that do not have their own EQ setting default to whatever the EQ was originally set at. Not a HUGE deal, but it means that I would then normally have to have EQ always turned on, set to flat, so that any song that I HAVE given a EQ setting to will use it. Am I understanding how that works correctly? Is there a way to have individual songs use their EQ setting without having to turn on the EQ for everything?

    Read the article

  • Is there a way to adjust colors of a specific window?

    - by Synetech
    Is there a (Windows) program or something that will allow the user to adjust the brightness/contrast/gamma of a specific window rather than the whole screen? As a use-case scenario, imagine having a web-page showing on one half of the screen, and another program taking up the rest of the screen. This other program uses the default Windows colors (e.g., white background), so it may be glaringly bright. Alternately, the web-page may be too dark to see. Adjusting the monitor or video-card settings would affect everything which will be no good. Adjusting the default Windows colors is, at best, inconvenient. Instead, there needs to be a way to set the colors of one of the windows to equalize the whole screen.

    Read the article

< Previous Page | 339 340 341 342 343 344 345 346 347 348 349 350  | Next Page >