Search Results

Search found 77950 results on 3118 pages for 'large file upload'.

Page 36/3118 | < Previous Page | 32 33 34 35 36 37 38 39 40 41 42 43  | Next Page >

  • How to compare two file structures in PHP?

    - by OM The Eternity
    I have a function which gives me the complete file structure upto n-level, function getDirectory($path = '.', $ignore = '') { $dirTree = array (); $dirTreeTemp = array (); $ignore[] = '.'; $ignore[] = '..'; $dh = @opendir($path); while (false !== ($file = readdir($dh))) { if (!in_array($file, $ignore)) { if (!is_dir("$path/$file")) { //display of file and directory name with their modification time $stat = stat("$path/$file"); $statdir = stat("$path"); $dirTree["$path"][] = $file. " === ". date('Y-m-d H:i:s', $stat['mtime']) . " Directory == ".$path."===". date('Y-m-d H:i:s', $statdir['mtime']) ; } else { $dirTreeTemp = getDirectory("$path/$file", $ignore); if (is_array($dirTreeTemp))$dirTree = array_merge($dirTree, $dirTreeTemp); } } } closedir($dh); return $dirTree; } $ignore = array('.htaccess', 'error_log', 'cgi-bin', 'php.ini', '.ftpquota'); //function call $dirTree = getDirectory('.', $ignore); //file structure array print print_r($dirTree); Now here my requirement is , I have two sites The Development/Test Site- where i do testing of all the changes The Production Site- where I finally post all the changes as per test in development site Now, for example, I have tested an image upload in the Development/test site, and i found it appropriate to publish on Production site then i will completely transfer the Development/Test DB detail to Production DB, but now I want to compare the files structure as well to transfer the corresponding image file to Production folder. There could be the situation when I update the image by editing the image and upload it with same name, now in this case the image file would be already present there, which will restrict the use of "file_exist" logic, so for these type of situations....HOW CAN I COMPARE THE TWO FILE STRUCTURE TO GET THE SYNCHRONIZATION DONE AS PER REQUIREMENT??

    Read the article

  • Modifying File while in use using Java

    - by Marquinio
    Hi all, I have this recurrent Java JAR program tasks that tries to modify a file every 60seconds. Problem is that if user is viewing the file than Java program will not be able to modify the file. I get the typical IOException. Anyone knows if there is a way in Java to modify a file currently in use? Or anyone knows what would be the best way to solve this problem? I was thinking of using the File canRead(), canWrite() methods to check if file is in use. If file is in use then I'm thinking of making a backup copy of data that could not be written. Then after 60 seconds add some logic to check if backup file is empty or not. If backup file is not empty then add its contents to main file. If empty then just add new data to main file. Of course, the first thing I will always do is check if file is in use. Thanks for all your ideas.

    Read the article

  • File mkdirs() method not working in android/java

    - by Leif Andersen
    I've been pulling out my hair on this for a while now. The following method is supposed to download a file, and save it to the location specified on the hard drive. private static void saveImage(Context context, boolean backgroundUpdate, URL url, File file) { if (!Tools.checkNetworkState(context, backgroundUpdate)) return; // Get the image try { // Make the file file.getParentFile().mkdirs(); // Set up the connection URLConnection uCon = url.openConnection(); InputStream is = uCon.getInputStream(); BufferedInputStream bis = new BufferedInputStream(is); // Download the data ByteArrayBuffer baf = new ByteArrayBuffer(50); int current = 0; while ((current = bis.read()) != -1) { baf.append((byte) current); } // Write the bits to the file OutputStream os = new FileOutputStream(file); os.write(baf.toByteArray()); os.close(); } catch (Exception e) { // Any exception is probably a newtork faiilure, bail return; } } Also, if the file doesn't exist, it is supposed to make the directory for the file. (And if there is another file already in that spot, it should just not do anything). However, for some reason, the mkdirs() method never makes the directory. I've tried everything from explicit parentheses, to explicitly making the parent file class, and nothing seems to work. I'm fairly certain that the drive is writable, as it's only called after that has already been determined, also that is true after running through it while debugging. So the method fails because the parent directories aren't made. Can anyone tell me if there is anything wrong with the way I'm calling it? Also, if it helps, here is the source for the file I'm calling it in: https://github.com/LeifAndersen/NetCatch/blob/master/src/net/leifandersen/mobile/android/netcatch/services/RSSService.java Thank you

    Read the article

  • Unset the system immutable bit in Mac OS X

    - by skylarking
    In theory I believe you can unlock and remove the system immutable bit with: chflags noschg /Path/To/File But how can you do this when you've set the bit as root? I have a file that is locked, and even running this command as root will not work as the operation is not permitted. I tried logging in as Single-User mode to no avail. I seem to remember that even though you are in as root you are in at level '1'. And to be able to remove the system-immutable flag you need to be logged in at level '0'. Does this have something to do with this issue?

    Read the article

  • What's the fastest way to store/access large files?

    - by philfreo
    I do a lot of video editing on my Mac and need a way to store very large (30 GB) files, and don't have room on my HD. A USB/Firewire external hard drive would work, but it seems way too slow for consistently working with such large files. I've also considered buying another computer, with a large hard drive, and putting it on the same network with a shared folder. What's the fastest / most efficient way to do this? Please consider USB 2.0 speeds, hard drive read times, ethernet speeds, etc. Are there other options I should consider?

    Read the article

  • Reliable file copy (move) process - mostly Unix/Linux

    - by mfinni
    Short story : We have a need for a rock-solid reliable file mover process. We have source directories that are often being written to that we need to move files from. The files come in pairs - a big binary, and a small XML index. We get a CTL file that defines these file bundles. There is a process that operates on the files once they are in the destination directory; that gets rid of them when it's done. Would rsync do the best job, or do we need to get more complex? Long story as follows : We have multiple sources to pull from : one set of directories are on a Windows machine (that does have Cygwin and an SSH daemon), and a whole pile of directories are on a set of SFTP servers (Most of these are also Windows.) Our destinations are a list of directories on AIX servers. We used to use a very reliable Perl script on the Windows/Cygwin machine when it was our only source. However, we're working on getting rid of that machine, and there are other sources now, the SFTP servers, that we cannot presently run our own scripts on. For security reasons, we can't run the copy jobs on our AIX servers - they have no access to the source servers. We currently have a homegrown Java program on a Linux machine that uses SFTP to pull from the various new SFTP source directories, copies to a local tmp directory, verifies that everything is present, then copies that to the AIX machines, and then deletes the files from the source. However, we're finding any number of bugs or poorly-handled error checking. None of us are Java experts, so fixing/improving this may be difficult. Concerns for us are: With a remote source (SFTP), will rsync leave alone any file still being written? Some of these files are large. From reading the docs, it seems like rysnc will be very good about not removing the source until the destination is reliably written. Does anyone have experience confirming or disproving this? Additional info We will be concerned about the ingestion process that operates on the files once they are in the destination directory. We don't want it operating on files while we are in the process of copying them; it waits until the small XML index file is present. Our current copy job are supposed to copy the XML file last. Sometimes the network has problems, sometimes the SFTP source servers crap out on us. Sometimes we typo the config files and a destination directory doesn't exist. We never want to lose a file due to this sort of error. We need good logs If you were presented with this, would you just script up some rsync? Or would you build or buy a tool, and if so, what would it be (or what technologies would it use?) I (and others on my team) are decent with Perl.

    Read the article

  • Sening a file from memory (rather than disk) over HTTP using libcurl

    - by cinek1lol
    Hi! I would like to send pictures via a program written in C + +. - OK WinExec("C:\\curl\\curl.exe -H Expect: -F \"fileupload=@C:\\curl\\ok.jpg\" -F \"xml=yes\" -# \"http://www.imageshack.us/index.php\" -o data.txt -A \"Mozilla/5.0 (Windows; U; Windows NT 5.1; en-US; rv:1.8.1.1) Gecko/20061204 Firefox/2.0.0.1\" -e \"http://www.imageshack.us\"", NULL); It works, but I would like to send the pictures from pre-loaded carrier to a variable char (you know what I mean? First off, I load the pictures into a variable and then send the variable), cause now I have to specify the path of the picture on a disk. I wanted to write this program in c++ by using the curl library, not through exe. extension. I have also found such a program (which has been modified by me a bit) #include <stdio.h> #include <string.h> #include <iostream> #include <curl/curl.h> #include <curl/types.h> #include <curl/easy.h> int main(int argc, char *argv[]) { CURL *curl; CURLcode res; struct curl_httppost *formpost=NULL; struct curl_httppost *lastptr=NULL; struct curl_slist *headerlist=NULL; static const char buf[] = "Expect:"; curl_global_init(CURL_GLOBAL_ALL); /* Fill in the file upload field */ curl_formadd(&formpost, &lastptr, CURLFORM_COPYNAME, "send", CURLFORM_FILE, "nowy.jpg", CURLFORM_END); curl_formadd(&formpost, &lastptr, CURLFORM_COPYNAME, "nowy.jpg", CURLFORM_COPYCONTENTS, "nowy.jpg", CURLFORM_END); curl_formadd(&formpost, &lastptr, CURLFORM_COPYNAME, "submit", CURLFORM_COPYCONTENTS, "send", CURLFORM_END); curl = curl_easy_init(); headerlist = curl_slist_append(headerlist, buf); if(curl) { curl_easy_setopt(curl, CURLOPT_URL, "http://www.imageshack.us/index.php"); if ( (argc == 2) && (!strcmp(argv[1], "xml=yes")) ) curl_easy_setopt(curl, CURLOPT_HTTPHEADER, headerlist); curl_easy_setopt(curl, CURLOPT_HTTPPOST, formpost); res = curl_easy_perform(curl); curl_easy_cleanup(curl); curl_formfree(formpost); curl_slist_free_all (headerlist); } system("pause"); return 0; }

    Read the article

  • Sending a file from memory (rather than disk) over HTTP using libcurl

    - by cinek1lol
    Hi! I would like to send pictures via a program written in C + +. - OK WinExec("C:\\curl\\curl.exe -H Expect: -F \"fileupload=@C:\\curl\\ok.jpg\" -F \"xml=yes\" -# \"http://www.imageshack.us/index.php\" -o data.txt -A \"Mozilla/5.0 (Windows; U; Windows NT 5.1; en-US; rv:1.8.1.1) Gecko/20061204 Firefox/2.0.0.1\" -e \"http://www.imageshack.us\"", NULL); It works, but I would like to send the pictures from pre-loaded carrier to a variable char (you know what I mean? First off, I load the pictures into a variable and then send the variable), cause now I have to specify the path of the picture on a disk. I wanted to write this program in c++ by using the curl library, not through exe. extension. I have also found such a program (which has been modified by me a bit) #include <stdio.h> #include <string.h> #include <iostream> #include <curl/curl.h> #include <curl/types.h> #include <curl/easy.h> int main(int argc, char *argv[]) { CURL *curl; CURLcode res; struct curl_httppost *formpost=NULL; struct curl_httppost *lastptr=NULL; struct curl_slist *headerlist=NULL; static const char buf[] = "Expect:"; curl_global_init(CURL_GLOBAL_ALL); /* Fill in the file upload field */ curl_formadd(&formpost, &lastptr, CURLFORM_COPYNAME, "send", CURLFORM_FILE, "nowy.jpg", CURLFORM_END); curl_formadd(&formpost, &lastptr, CURLFORM_COPYNAME, "nowy.jpg", CURLFORM_COPYCONTENTS, "nowy.jpg", CURLFORM_END); curl_formadd(&formpost, &lastptr, CURLFORM_COPYNAME, "submit", CURLFORM_COPYCONTENTS, "send", CURLFORM_END); curl = curl_easy_init(); headerlist = curl_slist_append(headerlist, buf); if(curl) { curl_easy_setopt(curl, CURLOPT_URL, "http://www.imageshack.us/index.php"); if ( (argc == 2) && (!strcmp(argv[1], "xml=yes")) ) curl_easy_setopt(curl, CURLOPT_HTTPHEADER, headerlist); curl_easy_setopt(curl, CURLOPT_HTTPPOST, formpost); res = curl_easy_perform(curl); curl_easy_cleanup(curl); curl_formfree(formpost); curl_slist_free_all (headerlist); } system("pause"); return 0; }

    Read the article

  • Coding in large chunks ... Code verification skills

    - by Andrew
    As a follow up to my prev question: What is the best aproach for coding in a slow compilation environment To recap: I am stuck with a large software system with which a TDD ideology of "test often" does not work. And to make it even worse the features like pre-compiled headers/multi-threaded compilation/incremental linking, etc is not available to me - hence I think that the best way out would be to add the extensive logging into the system and to start "coding in large chunks", which I understand as code for a two-three hours first (as opposed to 15-20 mins in TDD) - thoroughly eyeball the code for a 15 minutes and only after all that do the compilation and run the tests. As I have been doing TDD for a quite a while, my code eyeballing / code verification skills got rusty (you don't really need this that much if you can quickly verify what you've done in 5 seconds by running a test or two) - so I am after a recommendations on how to learn these source code verification/error spotting skills again. I know I was able to do that easily some 5-10 years ago when I din't have much support from the compiler/unit testing tools I had until recently, thus there should be a way to get back to the basics.

    Read the article

  • How to Upload Really Large Files to SkyDrive, Dropbox, or Email

    - by Matthew Guay
    Do you need to upload a very large file to store online or email to a friend? Unfortunately, whether you’re emailing a file or using online storage sites like SkyDrive, there’s a limit on the size of files you can use. Here’s how to get around the limits. Skydrive only lets you add files up to 50 MB, and while the Dropbox desktop client lets you add really large files, the web interface has a 300 MB limit, so if you were on another PC and wanted to add giant files to your Dropbox, you’d need to split them. This same technique also works for any file sharing service—even if you were sending files through email. There’s two ways that you can get around the limits—first, by just compressing the files if you’re close to the limit, but the second and more interesting way is to split up the files into smaller chunks. Keep reading for how to do both. Latest Features How-To Geek ETC The How-To Geek Guide to Learning Photoshop, Part 8: Filters Get the Complete Android Guide eBook for Only 99 Cents [Update: Expired] Improve Digital Photography by Calibrating Your Monitor The How-To Geek Guide to Learning Photoshop, Part 7: Design and Typography How to Choose What to Back Up on Your Linux Home Server How To Harmonize Your Dual-Boot Setup for Windows and Ubuntu Hang in There Scrat! – Ice Age Wallpaper How Do You Know When You’ve Passed Geek and Headed to Nerd? On The Tip – A Lamborghini Theme for Chrome and Iron What if Wile E. Coyote and the Road Runner were Human? [Video] Peaceful Winter Cabin Wallpaper Store Tabs for Later Viewing in Opera with Tab Vault

    Read the article

  • OpenGL ES 2.0 texture distortion on large geometry

    - by Spruce
    OpenGL ES 2.0 has serious precision issues with texture sampling - I've seen topics with a similar problem, but I haven't seen a real solution to this "distorted OpenGL ES 2.0 texture" problem yet. This is not related to the texture's image format or OpenGL color buffers, it seems like it's a precision error. I don't know what specifically causes the precision to fail - it doesn't seem like it's just the size of geometry that causes this distortion, because simply scaling vertex position passed to the the vertex shader does not solve the issue. Here are some examples of the texture distortion: Distorted Texture (on OpenGL ES 2.0): http://i47.tinypic.com/3322h6d.png What the texture normally looks like (also on OpenGL ES 2.0): http://i49.tinypic.com/b4jc6c.png The texture issue is limited to small scale geometry on OpenGL ES 2.0, otherwise the texture sampling appears normal, but the grainy effect gradually worsens the further the vertex data is from the origin of XYZ(0,0,0) These texture issues do not occur on desktop OpenGL (works fine under Windows XP, Windows 7, and Mac OS X) I've only seen the problem occur on Android, iPhone, or WebGL(which is similar to OpenGL ES 2.0) All textures are power of 2 but the problem still occurs Scaling the vertex data - The values of a vertex's X Y Z location are in the range of: -65536 to +65536 floating point I realized this was large, so I tried dividing the vertex positions by 1024 to shrink the geometry and hopefully get more accurate floating point precision, but this didn't fix or lessen the texture distortion issue Scaling the modelview or scaling the projection matrix does not help Changing texture filtering options does not help Disabling mipmapping, or using GL_NEAREST/GL_LINEAR does nothing Enabling/disabling anisotropic does nothing The banding effect still occurs even when using GL_CLAMP Dividing the texture coords passed to the vertex shader and then multiplying them back to the correct values in the fragment shader, also does not work precision highp sampler2D, highp float, highp int - in the fragment or the vertex shader didn't change anything (lowp/mediump did not work either) I'm thinking this problem has to have been solved at one point - Seeing that OpenGL ES 2.0 -based games have been able to render large-scale, highly detailed geometry

    Read the article

  • Organization standards for large programs

    - by Chronicide
    I'm the only software developer at the company where I work. I was hired straight out of college, and I've been working here for several years. When I started, eveeryone was managing their own data as they saw fit (lots of filing cabinets). Until recently, I've only been tasked with small standalone projects to help with simple workflows. In the beginning of the year I was asked to make a replacement for their HR software. I used SQL Server, Entity Framework, WPF, along with MVVM and Repository/Unit of work patterns. It was a huge hit. I was very happy with how it went, and it was a very solid program. As such, my employer asked me to expand this program into a corporate dashboard that tracks all of their various corporate data domains (People, Salary, Vehicles/Assets, Statistics, etc.) I use integrated authentication, and due to the initial HR build, I can map users to people in positions, so I know who is who when they open the program, and I can show each person a customized dashboard given their work functions. My concern is that I've never worked on such a large project. I'm planning, meeting with end users, developing, documenting, testing and deploying it on my own. I'm part way through the second addition, and I'm seeing that my code is getting disorganized. It's still programmed well, I'm just struggling with the organization of namespaces, classes and the database model. Are there any good guidelines to follow that will help me keep everything straight? As I have it now, I have folders for Data, Repositories/Unit of Work, Views, View Models, XAML Resources and Miscellaneous Utilities. Should I make parent folders for each data domain? Should I make separate EF models per domain instead of the one I have for the entire database? Are there any standards out there for organizing large programs that span multiple data domains? I would appreciate any suggestions.

    Read the article

  • Packaging MATLAB (or, more generally, a large binary, proprietary piece of software)

    - by nfirvine
    I'm trying to package MATLAB for internal distribution, but this could apply to any piece of software with the same architecture. In fact, I'm packaging multiple releases of MATLAB to be installed concurrently. Key things Very large installation size (~4 GB) Composed of a core, and several plugins (toolboxes) Initially, I created a single "source" package (matlab2011b) that builds several .debs (mainly matlab2011b-core and matlab2011b-toolbox-* for each toolbox). The control file is just the standard all: dh $@ There is no Makefile; only copying files. I use a number of debian/*.install files to specify files to copy from a copy of an installation to /usr/lib/. The problem is, every time I build the thing (say, to make a correction to the core package), it recopies every file listed in the *.install file to e.g debian/$packagename/usr/ (the build phase), and then has to bundle that into a .deb file. It takes a long time, on the order of hours, and is doing a lot of extra work. So my questions are: Can you make dh_install do a hardlink copy (like cp -l) to save time? (AFAICT from the man page, no.) Maybe I should just get it to do this in the Makefile? (That's gonna b e big Makefile.) Can you make debuild only rebuild .debs that need rebuilding? Or specify which .debs to rebuild? Is my approach completely stupid? Should I break each of the toolboxes into its own source package too? (I'll have to do some silly templating or something, because there's hundreds of them. :/)

    Read the article

  • Storing large array of tiles, but allowing easy access to data

    - by Cyral
    I've been thinking about this for a while. I have a 2D tile bases platformer in XNA with a large array of tile data, I've been running into memory problems with large maps. (I will add chunks soon!) Currently, Each tile contains an Item along with other properties like how its rotated, if it has forground / background, etc. An Item is static and has properties like the name, tooltip, type of item, how much light it emits, the collision it does to player, etc. Examples: public class Item { public static List<Item> Items; public Collision blockCollisionType; public string nameOfItem; public bool someOtherVariable,etc,etc public static Item Air public static Item Stone; public static Item Dirt; static Item() { Items = new List<Item>() { (Stone = new Item() { nameOfItem = "Stone", blockCollisionType = Collision.Solid, }), (Air = new Item() { nameOfItem = "Air", blockCollisionType = Collision.Passable, }), }; } } Would be an Item, The array of Tiles would contain a Tile for each point, public class Tile { public Item item; //What type it is public bool onBackground; public int someOtherVariables,etc,etc } Now, Most would probably use an enum, or a form of ID to identify blocks. Well my system is really nice just to find out about an item. I can simply do tiles[x,y].item.Name To get the name for example. I realized my Item property of the tile is over 1000 Bytes! Wow! What I'm looking for is a way to use an ID (Int or byte depending on how many items) instead of an Item but still have a method for retreiving data about the type of item a tile contains.

    Read the article

  • Avoid an "out of memory error" in Java(eclipse), when using large data structure?

    - by gnomed
    OK, so I am writing a program that unfortunately needs to use a huge data structure to complete its work, but it is failing with a "out of memory error" during its initialization. While I understand entirely what that means and why it is a problem, I am having trouble overcoming it, since my program needs to use this large structure and I don't know any other way to store it. The program first indexes a large corpus of text files that I provide. This works fine. Then it uses this index to initialize a large 2D array. This array will have nXn entries, where "n" is the number of unique words in the corpus of text. For the relatively small chunk I am testing it on(about 60 files) it needs to make approximately 30,000x30,000 entries. this will probably be bigger once I run it on my full intended corpus too. It consistently fails every time, after it indexes, while it is initializing the data structure(to be worked on later). Things I have done include: revamp my code to use a primitive "int[]" instead of a "TreeMap" eliminate redundant structures, etc... Also, I have run eclipse with "eclipse -vmargs -Xmx2g" to max out my allocated memory I am fairly confident this is not going to be a simple line of code solution, but is most likely going to require a very new approach. I am looking for what that approach is, any ideas? Thanks, B.

    Read the article

  • SQL SERVER World Shapefile Download and Upload to Database Spatial Database

    During my recent, training I was asked by a student if I know a place where he can download spatial files for all the countries around the world, as well as if there is a way to upload shape files to a database. Here is a quick tutorial for it.VDS Technologies has all the spatial [...]...Did you know that DotNetSlackers also publishes .net articles written by top known .net Authors? We already have over 80 articles in several categories including Silverlight. Take a look: here.

    Read the article

  • File Upload Forms: Security

    - by Snow_Mac
    SO I'm building an application for uploading files. We're paying scientists to contribute information on pests, diseases and bugs (for Plants). We need the ability to drag and drop a file to upload it. The question becomes since the users will be authicentated and setup by us, will it be necessarcy to include a virus scanner to prevent the uploading and insertition of malicious files. How important is this?

    Read the article

  • Upload Multiple Files in ASP.NET using jQuery

    Upload Multiple Files in ASP.NET using jQuery...Did you know that DotNetSlackers also publishes .net articles written by top known .net Authors? We already have over 80 articles in several categories including Silverlight. Take a look: here.

    Read the article

  • Track ping, download and upload daily

    - by euDennis
    I'm with some problems with my internet with oscillations in connection, causing some sites to get "Not Found" page sometimes. This isn't all the time, just some random times daily. My question is. There is any tool to monitor these basic information (ping, upload and download) daily to make an report and check the oscillations? Because, if someone from internet provider come at my house, probably it won't see the oscillations. Thanks, bye

    Read the article

  • Uploading images from Flex to Rails using Paperclip

    - by 23tux
    Hi everyone, I'm looking for a way to upload images that were created in my flex app to rails. I've tried to use paperclip, but it don't seem to work. I've got this tutorial here: http://blog.alexonrails.net/?p=218 The problem is, that they are using a FileReference to browse for files on the clients computer. They call the .upload(...) function and send the data to the upload controller. But I'm using a URLLoader to upload a image, that is modified in my Flex-App. First, here is the code from the tutorial: private function selectHandler(event:Event):void { var vars:URLVariables = new URLVariables(); var request:URLRequest = new URLRequest(uri); request.method = URLRequestMethod.POST; vars.description = "My Description"; request.data = vars; var uploadDataFieldName:String = 'filemanager[file]'; fileReference.upload(request, uploadDataFieldName); } I don't know how to set that var uploadDataFieldName:String = 'filemanager[file]'; in a URLLoader. I've got the image data compressed as a JPEG in a ByteArray. It looks like this: public function savePicture():void { var filename:String = "blubblub.jpg"; var vars:URLVariables = new URLVariables(); vars.position = layoutView.currentPicPosition; vars.url = filename; vars.user_id = 1; vars.comic_id = 1; vars.file_content_type = "image/jpeg"; vars.file_file_name = filename; var rawBytes:ByteArray = new JPGEncoder(75).encode(bitmapdata); vars.picture = rawBytes; var request:URLRequest = new URLRequest(Data.SERVER_ADDR + "pictures/upload"); request.method = URLRequestMethod.POST; request.data = vars; var loader:URLLoader = new URLLoader(request); loader.addEventListener(Event.COMPLETE, savePictureHandler); loader.addEventListener(IOErrorEvent.IO_ERROR, errorHandlerUpload); loader.load(request); } If I set the var.picture URLVariable to the bytearray, then I get the error, that the upload is nil. Here is the Rails part: Picture-Model: require 'paperclip' class Picture < ActiveRecord::Base # relations from picture belongs_to :comic belongs_to :user has_many :picture_bubbles has_many :bubbles, :through => :picture_bubbles # attached file for picture upload -> with paperclip plugin has_attached_file :file, :path => "public/system/pictures/:basename.:extension" end and the picture controller with the upload function: class PicturesController < ApplicationController protect_from_forgery :except => :upload def upload @picture = Picture.new(params[:picture]) @picture.position = params[:position] @picture.comic_id = params[:comic_id] @picture.url = params[:url] @picture.user_id = params[:user_id] if @picture.save render(:nothing => true, :status => 200) else render(:nothing => true, :status => 500) end end end Does anyone know how to solve this problem? thx, tux

    Read the article

  • ASP.net file operations delay

    - by mtranda
    Ok, so here's the problem: I'm reading the stream from a FileUpload control, reading in chunks of n bytes and writing the array in a loop until I reach the stream's end. Now the reason I do this is because I need to check several things while the upload is still going on (rather than doing a Save(); which does the whole thing in one go). Here's the problem: when doing this from the local machine, I can see the file just fine as it's uploading and its size increases (had to add a Sleep(); clause in the loop to actually get to see the file being written). However, when I upload the file from a remote machine, I don't get to see it until the the file has completed uploading. Also, I've added another call to write the progress to a text file as the progress is going on, and I get the same thing. Local: the file updates as the upload goes on, remote: the token file only appears after the upload's done (which is somewhat useless since I need it while the upload's still happening). Is there some sort of security setting in (or ASP.net) that maybe saves files in a temporary location for remote machines as opposed to the local machine and then moves them to the specified destination? I would liken this with ASP.net displaying error messages when browsing from the local machine (even on the public hostname) as opposed to the generic compilation error page/generic exception page that is shown when browsing from a remote machine (and customErrors are not off) Any clues on this? Thanks in advance.

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

< Previous Page | 32 33 34 35 36 37 38 39 40 41 42 43  | Next Page >